3PZ1B

Crystal structure of rabggtase(delta lrr; delta ig) in complex with bms3
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structure-Guided Development of Selective RabGGTase Inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 119
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3pz1B00
1GXNA 1KZPB 2H6GB 3DSUB 4D4AA 5FO9B 3SFXB 2B39A 3HXEB 3KSLB 4GTPB 1JCSB 1R76A 2G02A 1H3BA 2I07B 1W6KA 2XWBB 3EU5B 1O6RA 4FXKB 1O1TB 1QQFA 1FT2B 2R2LB 1O5MB 1QSJA 3Q7AB 3G6JB 1O79A 1X81B 4GTTB 3DSXB 3D5RA 1TN7B 1LD7B 2V8IA 4BOJA 1N94B 1N4PB 4V1SA 1NI1B 1GSZA 5FOBB 1SA5B 2PMVA 2SQCA 2ZIRB 3PZ1B 1N4RB 1GXMA 4LNVA 1KZOB 1TN8B 4YDOB 2H6IB 4D4CA 5JPNB 3KSQB 3DSVB 3Q7FB 3CU7A 4D4BA 1LTXB 3HXFB 3C72B 3PZ2B 1O1SB 1JCRB 3K7XA 2XQWA 1QBQB 4GTQB 3DSTB 3EUVB 4KKIA 1O6HA 4LNGB 4KKJA 2G0DA 1H37A 3DPYB 4BOKA 3DRAB 1S64B 1N9AB 4ZRQA 1H35A 3PZ4B 4GTSB 4MU9A 1MZCB 4GTRB 2BBCA 1TNUB 1DCEB 4FXGB 3PZ3B 4V1RA 4ZRPA 4D94A 3E33B 1N4SB 4GTMB 1FPPB 3RJ3A 2WY8A 2XWJB 3HXCB 1W6JA 2H6HB 1H39A 3DSWB 1UMPA 2WIIB 1JCQB 5FO8B 5FO7B 3KQ4A 2WY7A 4ZH1A 2PN5A 2IEJB 1SA4B 1TNYB 3Q79B 2V3NA 3OXUA 3E34B 1D8EB 2GOXA 1GHQA 3DSSB 2V8JA 3E30B 4GTOB 2V8KA 3Q78B 3SQCA 3HXBB 1N4QB 3KLSA 1H3CA 2NOJA 1O1RB 1SQCA 2BB5A 3E32B 3HXDB 2WINB 2A73B 4L9PB 4LNBB 3SFYB 1C3DA 2F0YB 3E37B 2BB6A 4C1SA 1NL4B 1TNOB 1GXOA 5JPMB 3D5SA 1HZFA 1N95B 4ONTA 1H36A 4M76A 2ZISB 4D4DA 3Q73B 2V3PA 1TN6B 2BEDB 1O6QA 3Q75B 4MBGB 1TNBB 2H6FB 1H3AA 1D8DB 3OEDA 5AGDA 1FT1B 4EHMB 1LD8B 4GTVB 4YDEB 1S63B 1TNZB
chains in the Genus database with same CATH superfamily
2H6GB 4XUVA 4F13A 3S4AA 1L2AA 3SFXB 5IK9A 4DODA 1R76A 3WKGA 1CB8A 3E80A 2WCOA 1H3BA 2ONHA 1W6KA 5GW7A 3M72A 2GZ6A 4OJZA 2R2LB 1H54A 4LIXA 1WZZA 4OK2A 2ONGA 3X17A 1UG9A 1F9DA 2V8IA 3N0GA 3P5RA 1X1JA 4OZVA 1RQ5A 1J0NA 1LXKA 5IM1A 3WIWA 1HMWA 4YDOB 3VW5A 3GLYA 4GAXA 1WU6A 3RX5A 2BRPA 1W3YA 3C72B 1OJPA 1JCRB 1HM2A 2QNOA 3EUVB 2CQSA 3NNBA 3QRYA 1J0MA 4MMIA 3TF4A 1IA6A 3PMMA 3ANIA 1N9AB 4GTSB 1DOGA 1RWGA 1TNUB 5EATA 1KRFA 1H12A 3CIHA 3RJ3A 2WY8A 2XWJB 3DSWB 3WKIA 2WIIB 1JCQB 3E73A 5FO7B 1KSDA 3W5MA 1HXCA 2BRWA 2FBAA 3ANKA 2Z07A 3VXDA 1IA7A 3M02A 2GOXA 1F1SA 4CE7A 2V8KA 3SQCA 4TXTA 1V7WA 1LF9A 3VSNA 5IK0A 4WVCA 3K11A 1NXCA 5IKAA 2BB5A 1FBWA 1LXMA 3HXDB 3SFYB 1VD5A 2F0YB 3E37B 1N7QA 3W5NA 1GXOA 4FUSA 4GL3A 5ILIA 1HZFA 1N95B 1RWAA 3M7BA 1N7RA 4ZH5A 1FBOA 1TN6B 3Q75B 1N7NA 5AGDA 4GTMB 4YDEB 1N24A 4EL8A 3DSUB 2JF4A 4D4AA 5FO9B 2RI8A 2GH4A 3G4FA 1KSCA 3AFLA 1WU5A 3M71A 1KFGA 3W7WA 4FXKB 3M75A 1FT2B 1FMIA 2Q1FA 3Q7AB 3W7SA 4MMHA 2E24A 1HV6A 4GTTB 3DSXB 3D5RA 1TN7B 3QXFA 1CEMA 4FJQA 2E22A 5FOBB 2SQCA 2ZIRB 1N4RB 2D5JA 2H6IB 3S4CA 5JPNB 3ACTA 3WKFA 2JJBA 3CU7A 4Q2BA 1N7PA 1OJMA 3K7XA 2XQWA 4GTQB 4NEIA 1V5DA 1XW2A 4WVBA 4E1YA 3RRSA 1CLCA 4WU0A 4KKJA 5GZKA 1S64B 5DGRA 3M74A 4AYOA 1HXAA 3PZ4B 2VN4A 1MZCB 2FUQA 1X1HA 2BBCA 4AYRA 4FXGB 1RWCA 4D94A 3ON6A 1FPPB 1HX9A 1UMPA 1HCUA 3LZ9A 4OZWA 1HMUA 3KQ4A 4JJJA 2PN5A 3WIRA 1GAIA 5M7IA 2IEJB 1TNYB 1IS9A 2V3NA 5MEHA 3G4DA 3DSSB 1HM3A 2V8JA 4TF4A 1N1ZA 3Q78B 1H3CA 1KWFA 5EASA 5ILDA 3QXQA 3SDQA 5ILHA 3QPFA 1X1IA 3E32B 3GT5A 2WINB 1K72A 1F9OA 2A73B 2RGKA 3E7JA 2EADA 5IK6A 4C1SA 3PYAA 2DRSA 5JPMB 1H36A 4M76A 3QSPA 2AFAA 3M73A 2AHFA 2H6FB 3P5PA 3QT9A 1D8DB 1FAEA 3RSYA 3SDRA 5JMDA 4GTVB 1TNZB 3QDEA 2OKXA 5IL8A 2WYNA 4GTPB 5C05A 1JCSB 4Q88A 5ILYA 3M78A 2G02A 1WU4A 1G9GA 2DRQA 2I07B 1KKTA 1N7OA 3QWTA 4KTRA 3EU5B 4WVAA 1O1TB 2FUZA 1C82A 1O5MB 3H3KA 1QSJA 2ZBLA 1O79A 3M7LA 1QAZA 3QFYA 2VN7A 1FO3A 5IL3A 4BOJA 1N94B 1N4PB 4V1SA 3E6UA 5DGQA 3S4DA 1GXMA 4DI5A 3SDUA 1H14A 1N20A 1TN8B 2BRVX 2NVPA 1UT9A 4AYQA 4D4BA 3HXFB 2DRRA 3DSTB 4KKIA 1O6HA 1JS4A 1I8QA 3QFZA 4LNGB 2G0DA 1H37A 3A0OA 1GA2A 4BOKA 5ILKA 1FO2A 4ZRQA 1H35A 4KTPA 1XWTA 4QT9A 4GTRB 1DCEB 3WIQA 3PZ3B 4V1RA 4ZRPA 3E33B 1N4SB 2X03A 3RENA 3HXCB 1W6JA 2H6HB 3EU8A 3M7CA 3RX7A 1F9GA 1HXGA 3WC3A 1FP3A 5FO8B 2B4FA 1L1YA 2WY7A 3WKHA 1SA4B 1OJNA 2D8LA 2EAEA 3M77A 4RNQA 3RX8A 1GHQA 3E30B 1N4QB 3M01A 2NOJA 1DL2A 1O1RB 3QT3A 1GLMA 1RWFA 3EZ8A 2YIKA 5CZLA 1LF6A 1N1BA 2BB6A 3N0FA 1OJOA 1GAHA 1TNOB 2CQTA 3M00A 3D5SA 4ONTA 3A3VA 1FCEA 2ZISB 3VSMA 3Q73B 4D4DA 2BEDB 1O6QA 3QG0A 1N21A 3PYBA 2JG0A 3P2CA 1H3AA 3OEDA 2XFGA 4EHMB 1LD8B 5GY3A 1S63B 1GXNA 1KZPB 4L6XA 3S4BA 3T33A 3W7TA 4J5TA 2B39A 3HXEB 1RWHA 4Z4LA 3KSLB 3H2WA 2AHGA 3EQAA 2XWBB 1V5CA 1O6RA 1QQFA 3GZKA 4CJ0A 3G6JB 1XWQA 3W7XA 4YCRA 1G9JA 1X81B 3WUXA 2FUTA 1LD7B 4FNVA 2EABA 3M7EA 1V7XA 4L0GA 1NI1B 1GSZA 1SA5B 1KREA 2PMVA 3PZ1B 5JMFA 1X9DA 4LNVA 5IKHA 4DOEA 4AYPA 1KZOB 4D4CA 1AYXA 4ZG8A 1H13A 3KSQB 3DSVB 1N22A 3Q7FB 3NFVA 1LTXB 1EGUA 1RW9A 3PZ2B 1O1SB 1QBQB 3H7LA 1V7VA 2P0VA 3D3IA 5ILZA 3DPYB 5CA3A 3DRAB 2WDAA 5ILJA 3ANJA 3SAEA 5CD2A 4MU9A 1KS8A 4CJ1A 3W7UA 1LOHA 2ZZRA 2A8ZA 1H39A 5E2JA 2FV1A 1NC5A 5DHKA 3AFJA 4ZH1A 3ACSA 2J5CA 1G87A 3Q79B 4OK4A 3OXUA 3E34B 2F6DA 1D8EB 5DHIA 1N23A 2DROA 4Z4JA 4GTOB 5KKBA 1HN0A 3HXBB 1G6IA 3KLSA 3M76A 3SDVA 1TF4A 2EACA 1SQCA 4F10A 4L9PB 4LNBB 5EAUA 1C3DA 1NL4B 1ULVA 3SDTA 1AGMA 3S9VA 2V3PA 5M7YA 2FV0A 4MBGB 1TNBB 1FT1B 2RI9A
chains in the Genus database with same CATH topology
2H6GB 4XUVA 3S4AA 1L2AA 3SFXB 4DODA 1R76A 3WKGA 1H3BA 1W6KA 5GW7A 3M72A 2GZ6A 2R2LB 1H54A 4LIXA 1WZZA 3X17A 1UG9A 1F9DA 2V8IA 3P5RA 1RQ5A 3WIWA 4YDOB 3VW5A 3GLYA 1WU6A 3RX5A 3C72B 1JCRB 2QNOA 3EUVB 2CQSA 3QRYA 3TF4A 1IA6A 3PMMA 3ANIA 1N9AB 4GTSB 1DOGA 1TNUB 1KRFA 1H12A 3CIHA 3RJ3A 2WY8A 2XWJB 3DSWB 3WKIA 2WIIB 1JCQB 3E73A 5FO7B 1KSDA 3W5MA 2FBAA 3ANKA 2Z07A 3VXDA 1IA7A 2GOXA 4CE7A 2V8KA 3SQCA 4TXTA 1V7WA 1LF9A 4WVCA 3K11A 1NXCA 2BB5A 1FBWA 3HXDB 3SFYB 1VD5A 2F0YB 3E37B 3W5NA 1GXOA 4FUSA 4GL3A 1HZFA 1N95B 3M7BA 4ZH5A 1FBOA 1TN6B 3Q75B 5AGDA 4GTMB 4YDEB 4EL8A 3DSUB 2JF4A 4D4AA 5FO9B 2RI8A 2GH4A 1KSCA 1WU5A 3M71A 1KFGA 3W7WA 4FXKB 3M75A 1FT2B 1FMIA 3Q7AB 3W7SA 4GTTB 3DSXB 3D5RA 1TN7B 3QXFA 1CEMA 5FOBB 2SQCA 2ZIRB 1N4RB 2D5JA 2H6IB 3S4CA 5JPNB 3ACTA 3WKFA 2JJBA 3CU7A 4Q2BA 3K7XA 2XQWA 4GTQB 1V5DA 1XW2A 4WVBA 3RRSA 1CLCA 4WU0A 4KKJA 5GZKA 1S64B 5DGRA 3M74A 4AYOA 3PZ4B 2VN4A 1MZCB 2BBCA 4AYRA 4FXGB 4D94A 3ON6A 1FPPB 1UMPA 1HCUA 3KQ4A 4JJJA 2PN5A 3WIRA 1GAIA 5M7IA 2IEJB 1TNYB 1IS9A 2V3NA 5MEHA 3DSSB 2V8JA 4TF4A 3Q78B 1H3CA 1KWFA 3QXQA 3SDQA 3QPFA 3E32B 3GT5A 2WINB 1K72A 1F9OA 2A73B 2RGKA 2EADA 4C1SA 3PYAA 2DRSA 5JPMB 1H36A 4M76A 3QSPA 2AFAA 3M73A 3P5PA 3QT9A 2AHFA 2H6FB 1D8DB 1FAEA 3RSYA 3SDRA 4GTVB 1TNZB 3QDEA 2OKXA 2WYNA 4GTPB 4Q88A 1JCSB 3M78A 2G02A 1WU4A 1G9GA 2DRQA 2I07B 1KKTA 3QWTA 4KTRA 3EU5B 4WVAA 1O1TB 2FUZA 1O5MB 3H3KA 1QSJA 2ZBLA 1O79A 3M7LA 3QFYA 2VN7A 1FO3A 4BOJA 1N94B 1N4PB 4V1SA 3E6UA 5DGQA 3S4DA 1GXMA 3SDUA 1H14A 1TN8B 2NVPA 1UT9A 4AYQA 4D4BA 3HXFB 2DRRA 3DSTB 4KKIA 1O6HA 1JS4A 4LNGB 3QFZA 2G0DA 1H37A 1GA2A 4BOKA 1FO2A 4ZRQA 1H35A 4KTPA 1XWTA 4QT9A 4GTRB 1DCEB 3WIQA 3PZ3B 4V1RA 4ZRPA 3E33B 1N4SB 3RENA 3HXCB 1W6JA 2H6HB 3EU8A 3M7CA 3RX7A 3WC3A 1FP3A 5FO8B 2B4FA 1L1YA 2WY7A 3WKHA 1SA4B 2D8LA 2EAEA 3M77A 3RX8A 1GHQA 3E30B 1N4QB 2NOJA 1DL2A 1O1RB 3QT3A 1GLMA 3EZ8A 2YIKA 5CZLA 1LF6A 2BB6A 1GAHA 1TNOB 2CQTA 3D5SA 4ONTA 3A3VA 1FCEA 2ZISB 4D4DA 3Q73B 2BEDB 1O6QA 3QG0A 3PYBA 2JG0A 3P2CA 1H3AA 3OEDA 2XFGA 4EHMB 1LD8B 5GY3A 1S63B 1GXNA 1KZPB 4L6XA 3S4BA 3T33A 3W7TA 4J5TA 2B39A 3HXEB 4Z4LA 3KSLB 3H2WA 2AHGA 3EQAA 2XWBB 1V5CA 1O6RA 1QQFA 3GZKA 4CJ0A 3G6JB 1XWQA 3W7XA 4YCRA 1G9JA 1X81B 3WUXA 1LD7B 2EABA 3M7EA 1V7XA 4L0GA 1NI1B 1GSZA 1SA5B 1KREA 2PMVA 3PZ1B 1X9DA 4LNVA 4DOEA 4AYPA 1KZOB 4D4CA 1AYXA 4ZG8A 1H13A 3KSQB 3DSVB 3Q7FB 1LTXB 3PZ2B 1O1SB 1QBQB 3H7LA 1V7VA 2P0VA 3D3IA 3DPYB 5CA3A 3DRAB 3ANJA 3SAEA 5CD2A 4MU9A 1KS8A 4CJ1A 3W7UA 2ZZRA 2A8ZA 1H39A 5E2JA 2FV1A 1NC5A 3AFJA 4ZH1A 3ACSA 1G87A 3Q79B 3OXUA 3E34B 2F6DA 1D8EB 2DROA 4Z4JA 4GTOB 5KKBA 3HXBB 1G6IA 3KLSA 3M76A 3SDVA 1TF4A 2EACA 1SQCA 4L9PB 4LNBB 1C3DA 1NL4B 1ULVA 3SDTA 1AGMA 3S9VA 2V3PA 5M7YA 2FV0A 4MBGB 1TNBB 1FT1B 2RI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXN A;  1KZP B;  2H6G B;  3DSU B;  4D4A A;  5FO9 B;  3SFX B;  2B39 A;  3HXE B;  3KSL B;  4GTP B;  1JCS B;  1R76 A;  2G02 A;  1H3B A;  2I07 B;  1W6K A;  2XWB B;  3EU5 B;  1O6R A;  4FXK B;  1O1T B;  1QQF A;  1FT2 B;  2R2L B;  1O5M B;  1QSJ A;  3Q7A B;  3G6J B;  1O79 A;  1X81 B;  4GTT B;  3DSX B;  3D5R A;  1TN7 B;  1LD7 B;  2V8I A;  4BOJ A;  1N94 B;  1N4P B;  4V1S A;  1NI1 B;  1GSZ A;  5FOB B;  1SA5 B;  2PMV A;  2SQC A;  2ZIR B;  3PZ1 B;  1N4R B;  1GXM A;  4LNV A;  1KZO B;  1TN8 B;  4YDO B;  2H6I B;  4D4C A;  5JPN B;  3KSQ B;  3DSV B;  3Q7F B;  3CU7 A;  4D4B A;  1LTX B;  3HXF B;  3C72 B;  3PZ2 B;  1O1S B;  1JCR B;  3K7X A;  2XQW A;  1QBQ B;  4GTQ B;  3DST B;  3EUV B;  4KKI A;  1O6H A;  4LNG B;  4KKJ A;  2G0D A;  1H37 A;  3DPY B;  4BOK A;  3DRA B;  1S64 B;  1N9A B;  4ZRQ A;  1H35 A;  3PZ4 B;  4GTS B;  4MU9 A;  1MZC B;  4GTR B;  2BBC A;  1TNU B;  1DCE B;  4FXG B;  3PZ3 B;  4V1R A;  4ZRP A;  4D94 A;  3E33 B;  1N4S B;  4GTM B;  1FPP B;  3RJ3 A;  2WY8 A;  2XWJ B;  3HXC B;  1W6J A;  2H6H B;  1H39 A;  3DSW B;  1UMP A;  2WII B;  1JCQ B;  5FO8 B;  5FO7 B;  3KQ4 A;  2WY7 A;  4ZH1 A;  2PN5 A;  2IEJ B;  1SA4 B;  1TNY B;  3Q79 B;  2V3N A;  3OXU A;  3E34 B;  1D8E B;  2GOX A;  1GHQ A;  3DSS B;  2V8J A;  3E30 B;  4GTO B;  2V8K A;  3Q78 B;  3SQC A;  3HXB B;  1N4Q B;  3KLS A;  1H3C A;  2NOJ A;  1O1R B;  1SQC A;  2BB5 A;  3E32 B;  3HXD B;  2WIN B;  2A73 B;  4L9P B;  4LNB B;  3SFY B;  1C3D A;  2F0Y B;  3E37 B;  2BB6 A;  4C1S A;  1NL4 B;  1TNO B;  1GXO A;  5JPM B;  3D5S A;  1HZF A;  1N95 B;  4ONT A;  1H36 A;  4M76 A;  2ZIS B;  4D4D A;  3Q73 B;  2V3P A;  1TN6 B;  2BED B;  1O6Q A;  3Q75 B;  4MBG B;  1TNB B;  2H6F B;  1H3A A;  1D8D B;  3OED A;  5AGD A;  1FT1 B;  4EHM B;  1LD8 B;  4GTV B;  4YDE B;  1S63 B;  1TNZ B; 
#chains in the Genus database with same CATH topology
 2H6G B;  4XUV A;  4F13 A;  3S4A A;  1L2A A;  3SFX B;  5IK9 A;  4DOD A;  1R76 A;  3WKG A;  1CB8 A;  3E80 A;  2WCO A;  1H3B A;  2ONH A;  1W6K A;  5GW7 A;  3M72 A;  2GZ6 A;  4OJZ A;  2R2L B;  1H54 A;  4LIX A;  1WZZ A;  4OK2 A;  2ONG A;  3X17 A;  1UG9 A;  1F9D A;  2V8I A;  3N0G A;  3P5R A;  1X1J A;  4OZV A;  1RQ5 A;  1J0N A;  1LXK A;  5IM1 A;  3WIW A;  1HMW A;  4YDO B;  3VW5 A;  3GLY A;  4GAX A;  1WU6 A;  3RX5 A;  2BRP A;  1W3Y A;  3C72 B;  1OJP A;  1JCR B;  1HM2 A;  2QNO A;  3EUV B;  2CQS A;  3NNB A;  3QRY A;  1J0M A;  4MMI A;  3TF4 A;  1IA6 A;  3PMM A;  3ANI A;  1N9A B;  4GTS B;  1DOG A;  1RWG A;  1TNU B;  5EAT A;  1KRF A;  1H12 A;  3CIH A;  3RJ3 A;  2WY8 A;  2XWJ B;  3DSW B;  3WKI A;  2WII B;  1JCQ B;  3E73 A;  5FO7 B;  1KSD A;  3W5M A;  1HXC A;  2BRW A;  2FBA A;  3ANK A;  2Z07 A;  3VXD A;  1IA7 A;  3M02 A;  2GOX A;  1F1S A;  4CE7 A;  2V8K A;  3SQC A;  4TXT A;  1V7W A;  1LF9 A;  3VSN A;  5IK0 A;  4WVC A;  3K11 A;  1NXC A;  5IKA A;  2BB5 A;  1FBW A;  1LXM A;  3HXD B;  3SFY B;  1VD5 A;  2F0Y B;  3E37 B;  1N7Q A;  3W5N A;  1GXO A;  4FUS A;  4GL3 A;  5ILI A;  1HZF A;  1N95 B;  1RWA A;  3M7B A;  1N7R A;  4ZH5 A;  1FBO A;  1TN6 B;  3Q75 B;  1N7N A;  5AGD A;  4GTM B;  4YDE B;  1N24 A;  4EL8 A;  3DSU B;  2JF4 A;  4D4A A;  5FO9 B;  2RI8 A;  2GH4 A;  3G4F A;  1KSC A;  3AFL A;  1WU5 A;  3M71 A;  1KFG A;  3W7W A;  4FXK B;  3M75 A;  1FT2 B;  1FMI A;  2Q1F A;  3Q7A B;  3W7S A;  4MMH A;  2E24 A;  1HV6 A;  4GTT B;  3DSX B;  3D5R A;  1TN7 B;  3QXF A;  1CEM A;  4FJQ A;  2E22 A;  5FOB B;  2SQC A;  2ZIR B;  1N4R B;  2D5J A;  2H6I B;  3S4C A;  5JPN B;  3ACT A;  3WKF A;  2JJB A;  3CU7 A;  4Q2B A;  1N7P A;  1OJM A;  3K7X A;  2XQW A;  4GTQ B;  4NEI A;  1V5D A;  1XW2 A;  4WVB A;  4E1Y A;  3RRS A;  1CLC A;  4WU0 A;  4KKJ A;  5GZK A;  1S64 B;  5DGR A;  3M74 A;  4AYO A;  1HXA A;  3PZ4 B;  2VN4 A;  1MZC B;  2FUQ A;  1X1H A;  2BBC A;  4AYR A;  4FXG B;  1RWC A;  4D94 A;  3ON6 A;  1FPP B;  1HX9 A;  1UMP A;  1HCU A;  3LZ9 A;  4OZW A;  1HMU A;  3KQ4 A;  4JJJ A;  2PN5 A;  3WIR A;  1GAI A;  5M7I A;  2IEJ B;  1TNY B;  1IS9 A;  2V3N A;  5MEH A;  3G4D A;  3DSS B;  1HM3 A;  2V8J A;  4TF4 A;  1N1Z A;  3Q78 B;  1H3C A;  1KWF A;  5EAS A;  5ILD A;  3QXQ A;  3SDQ A;  5ILH A;  3QPF A;  1X1I A;  3E32 B;  3GT5 A;  2WIN B;  1K72 A;  1F9O A;  2A73 B;  2RGK A;  3E7J A;  2EAD A;  5IK6 A;  4C1S A;  3PYA A;  2DRS A;  5JPM B;  1H36 A;  4M76 A;  3QSP A;  2AFA A;  3M73 A;  2AHF A;  2H6F B;  3P5P A;  3QT9 A;  1D8D B;  1FAE A;  3RSY A;  3SDR A;  5JMD A;  4GTV B;  1TNZ B;  3QDE A;  2OKX A;  5IL8 A;  2WYN A;  4GTP B;  5C05 A;  1JCS B;  4Q88 A;  5ILY A;  3M78 A;  2G02 A;  1WU4 A;  1G9G A;  2DRQ A;  2I07 B;  1KKT A;  1N7O A;  3QWT A;  4KTR A;  3EU5 B;  4WVA A;  1O1T B;  2FUZ A;  1C82 A;  1O5M B;  3H3K A;  1QSJ A;  2ZBL A;  1O79 A;  3M7L A;  1QAZ A;  3QFY A;  2VN7 A;  1FO3 A;  5IL3 A;  4BOJ A;  1N94 B;  1N4P B;  4V1S A;  3E6U A;  5DGQ A;  3S4D A;  1GXM A;  4DI5 A;  3SDU A;  1H14 A;  1N20 A;  1TN8 B;  2BRV X;  2NVP A;  1UT9 A;  4AYQ A;  4D4B A;  3HXF B;  2DRR A;  3DST B;  4KKI A;  1O6H A;  1JS4 A;  1I8Q A;  3QFZ A;  4LNG B;  2G0D A;  1H37 A;  3A0O A;  1GA2 A;  4BOK A;  5ILK A;  1FO2 A;  4ZRQ A;  1H35 A;  4KTP A;  1XWT A;  4QT9 A;  4GTR B;  1DCE B;  3WIQ A;  3PZ3 B;  4V1R A;  4ZRP A;  3E33 B;  1N4S B;  2X03 A;  3REN A;  3HXC B;  1W6J A;  2H6H B;  3EU8 A;  3M7C A;  3RX7 A;  1F9G A;  1HXG A;  3WC3 A;  1FP3 A;  5FO8 B;  2B4F A;  1L1Y A;  2WY7 A;  3WKH A;  1SA4 B;  1OJN A;  2D8L A;  2EAE A;  3M77 A;  4RNQ A;  3RX8 A;  1GHQ A;  3E30 B;  1N4Q B;  3M01 A;  2NOJ A;  1DL2 A;  1O1R B;  3QT3 A;  1GLM A;  1RWF A;  3EZ8 A;  2YIK A;  5CZL A;  1LF6 A;  1N1B A;  2BB6 A;  3N0F A;  1OJO A;  1GAH A;  1TNO B;  2CQT A;  3M00 A;  3D5S A;  4ONT A;  3A3V A;  1FCE A;  2ZIS B;  3VSM A;  3Q73 B;  4D4D A;  2BED B;  1O6Q A;  3QG0 A;  1N21 A;  3PYB A;  2JG0 A;  3P2C A;  1H3A A;  3OED A;  2XFG A;  4EHM B;  1LD8 B;  5GY3 A;  1S63 B;  1GXN A;  1KZP B;  4L6X A;  3S4B A;  3T33 A;  3W7T A;  4J5T A;  2B39 A;  3HXE B;  1RWH A;  4Z4L A;  3KSL B;  3H2W A;  2AHG A;  3EQA A;  2XWB B;  1V5C A;  1O6R A;  1QQF A;  3GZK A;  4CJ0 A;  3G6J B;  1XWQ A;  3W7X A;  4YCR A;  1G9J A;  1X81 B;  3WUX A;  2FUT A;  1LD7 B;  4FNV A;  2EAB A;  3M7E A;  1V7X A;  4L0G A;  1NI1 B;  1GSZ A;  1SA5 B;  1KRE A;  2PMV A;  3PZ1 B;  5JMF A;  1X9D A;  4LNV A;  5IKH A;  4DOE A;  4AYP A;  1KZO B;  4D4C A;  1AYX A;  4ZG8 A;  1H13 A;  3KSQ B;  3DSV B;  1N22 A;  3Q7F B;  3NFV A;  1LTX B;  1EGU A;  1RW9 A;  3PZ2 B;  1O1S B;  1QBQ B;  3H7L A;  1V7V A;  2P0V A;  3D3I A;  5ILZ A;  3DPY B;  5CA3 A;  3DRA B;  2WDA A;  5ILJ A;  3ANJ A;  3SAE A;  5CD2 A;  4MU9 A;  1KS8 A;  4CJ1 A;  3W7U A;  1LOH A;  2ZZR A;  2A8Z A;  1H39 A;  5E2J A;  2FV1 A;  1NC5 A;  5DHK A;  3AFJ A;  4ZH1 A;  3ACS A;  2J5C A;  1G87 A;  3Q79 B;  4OK4 A;  3OXU A;  3E34 B;  2F6D A;  1D8E B;  5DHI A;  1N23 A;  2DRO A;  4Z4J A;  4GTO B;  5KKB A;  1HN0 A;  3HXB B;  1G6I A;  3KLS A;  3M76 A;  3SDV A;  1TF4 A;  2EAC A;  1SQC A;  4F10 A;  4L9P B;  4LNB B;  5EAU A;  1C3D A;  1NL4 B;  1ULV A;  3SDT A;  1AGM A;  3S9V A;  2V3P A;  5M7Y A;  2FV0 A;  4MBG B;  1TNB B;  1FT1 B;  2RI9 A; 
#chains in the Genus database with same CATH homology
 2H6G B;  4XUV A;  3S4A A;  1L2A A;  3SFX B;  4DOD A;  1R76 A;  3WKG A;  1H3B A;  1W6K A;  5GW7 A;  3M72 A;  2GZ6 A;  2R2L B;  1H54 A;  4LIX A;  1WZZ A;  3X17 A;  1UG9 A;  1F9D A;  2V8I A;  3P5R A;  1RQ5 A;  3WIW A;  4YDO B;  3VW5 A;  3GLY A;  1WU6 A;  3RX5 A;  3C72 B;  1JCR B;  2QNO A;  3EUV B;  2CQS A;  3QRY A;  3TF4 A;  1IA6 A;  3PMM A;  3ANI A;  1N9A B;  4GTS B;  1DOG A;  1TNU B;  1KRF A;  1H12 A;  3CIH A;  3RJ3 A;  2WY8 A;  2XWJ B;  3DSW B;  3WKI A;  2WII B;  1JCQ B;  3E73 A;  5FO7 B;  1KSD A;  3W5M A;  2FBA A;  3ANK A;  2Z07 A;  3VXD A;  1IA7 A;  2GOX A;  4CE7 A;  2V8K A;  3SQC A;  4TXT A;  1V7W A;  1LF9 A;  4WVC A;  3K11 A;  1NXC A;  2BB5 A;  1FBW A;  3HXD B;  3SFY B;  1VD5 A;  2F0Y B;  3E37 B;  3W5N A;  1GXO A;  4FUS A;  4GL3 A;  1HZF A;  1N95 B;  3M7B A;  4ZH5 A;  1FBO A;  1TN6 B;  3Q75 B;  5AGD A;  4GTM B;  4YDE B;  4EL8 A;  3DSU B;  2JF4 A;  4D4A A;  5FO9 B;  2RI8 A;  2GH4 A;  1KSC A;  1WU5 A;  3M71 A;  1KFG A;  3W7W A;  4FXK B;  3M75 A;  1FT2 B;  1FMI A;  3Q7A B;  3W7S A;  4GTT B;  3DSX B;  3D5R A;  1TN7 B;  3QXF A;  1CEM A;  5FOB B;  2SQC A;  2ZIR B;  1N4R B;  2D5J A;  2H6I B;  3S4C A;  5JPN B;  3ACT A;  3WKF A;  2JJB A;  3CU7 A;  4Q2B A;  3K7X A;  2XQW A;  4GTQ B;  1V5D A;  1XW2 A;  4WVB A;  3RRS A;  1CLC A;  4WU0 A;  4KKJ A;  5GZK A;  1S64 B;  5DGR A;  3M74 A;  4AYO A;  3PZ4 B;  2VN4 A;  1MZC B;  2BBC A;  4AYR A;  4FXG B;  4D94 A;  3ON6 A;  1FPP B;  1UMP A;  1HCU A;  3KQ4 A;  4JJJ A;  2PN5 A;  3WIR A;  1GAI A;  5M7I A;  2IEJ B;  1TNY B;  1IS9 A;  2V3N A;  5MEH A;  3DSS B;  2V8J A;  4TF4 A;  3Q78 B;  1H3C A;  1KWF A;  3QXQ A;  3SDQ A;  3QPF A;  3E32 B;  3GT5 A;  2WIN B;  1K72 A;  1F9O A;  2A73 B;  2RGK A;  2EAD A;  4C1S A;  3PYA A;  2DRS A;  5JPM B;  1H36 A;  4M76 A;  3QSP A;  2AFA A;  3M73 A;  3P5P A;  3QT9 A;  2AHF A;  2H6F B;  1D8D B;  1FAE A;  3RSY A;  3SDR A;  4GTV B;  1TNZ B;  3QDE A;  2OKX A;  2WYN A;  4GTP B;  4Q88 A;  1JCS B;  3M78 A;  2G02 A;  1WU4 A;  1G9G A;  2DRQ A;  2I07 B;  1KKT A;  3QWT A;  4KTR A;  3EU5 B;  4WVA A;  1O1T B;  2FUZ A;  1O5M B;  3H3K A;  1QSJ A;  2ZBL A;  1O79 A;  3M7L A;  3QFY A;  2VN7 A;  1FO3 A;  4BOJ A;  1N94 B;  1N4P B;  4V1S A;  3E6U A;  5DGQ A;  3S4D A;  1GXM A;  3SDU A;  1H14 A;  1TN8 B;  2NVP A;  1UT9 A;  4AYQ A;  4D4B A;  3HXF B;  2DRR A;  3DST B;  4KKI A;  1O6H A;  1JS4 A;  4LNG B;  3QFZ A;  2G0D A;  1H37 A;  1GA2 A;  4BOK A;  1FO2 A;  4ZRQ A;  1H35 A;  4KTP A;  1XWT A;  4QT9 A;  4GTR B;  1DCE B;  3WIQ A;  3PZ3 B;  4V1R A;  4ZRP A;  3E33 B;  1N4S B;  3REN A;  3HXC B;  1W6J A;  2H6H B;  3EU8 A;  3M7C A;  3RX7 A;  3WC3 A;  1FP3 A;  5FO8 B;  2B4F A;  1L1Y A;  2WY7 A;  3WKH A;  1SA4 B;  2D8L A;  2EAE A;  3M77 A;  3RX8 A;  1GHQ A;  3E30 B;  1N4Q B;  2NOJ A;  1DL2 A;  1O1R B;  3QT3 A;  1GLM A;  3EZ8 A;  2YIK A;  5CZL A;  1LF6 A;  2BB6 A;  1GAH A;  1TNO B;  2CQT A;  3D5S A;  4ONT A;  3A3V A;  1FCE A;  2ZIS B;  4D4D A;  3Q73 B;  2BED B;  1O6Q A;  3QG0 A;  3PYB A;  2JG0 A;  3P2C A;  1H3A A;  3OED A;  2XFG A;  4EHM B;  1LD8 B;  5GY3 A;  1S63 B;  1GXN A;  1KZP B;  4L6X A;  3S4B A;  3T33 A;  3W7T A;  4J5T A;  2B39 A;  3HXE B;  4Z4L A;  3KSL B;  3H2W A;  2AHG A;  3EQA A;  2XWB B;  1V5C A;  1O6R A;  1QQF A;  3GZK A;  4CJ0 A;  3G6J B;  1XWQ A;  3W7X A;  4YCR A;  1G9J A;  1X81 B;  3WUX A;  1LD7 B;  2EAB A;  3M7E A;  1V7X A;  4L0G A;  1NI1 B;  1GSZ A;  1SA5 B;  1KRE A;  2PMV A;  3PZ1 B;  1X9D A;  4LNV A;  4DOE A;  4AYP A;  1KZO B;  4D4C A;  1AYX A;  4ZG8 A;  1H13 A;  3KSQ B;  3DSV B;  3Q7F B;  1LTX B;  3PZ2 B;  1O1S B;  1QBQ B;  3H7L A;  1V7V A;  2P0V A;  3D3I A;  3DPY B;  5CA3 A;  3DRA B;  3ANJ A;  3SAE A;  5CD2 A;  4MU9 A;  1KS8 A;  4CJ1 A;  3W7U A;  2ZZR A;  2A8Z A;  1H39 A;  5E2J A;  2FV1 A;  1NC5 A;  3AFJ A;  4ZH1 A;  3ACS A;  1G87 A;  3Q79 B;  3OXU A;  3E34 B;  2F6D A;  1D8E B;  2DRO A;  4Z4J A;  4GTO B;  5KKB A;  3HXB B;  1G6I A;  3KLS A;  3M76 A;  3SDV A;  1TF4 A;  2EAC A;  1SQC A;  4L9P B;  4LNB B;  1C3D A;  1NL4 B;  1ULV A;  3SDT A;  1AGM A;  3S9V A;  2V3P A;  5M7Y A;  2FV0 A;  4MBG B;  1TNB B;  1FT1 B;  2RI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...