4D4AA

Structure of the catalytic domain (bcgh76) of the bacillus circulans gh76 alpha mannanase, aman6.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
337
structure length
334
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHQNSDHIVDGNWAGQGTYESWSSAAAVQALNGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-1,6-MANNANASE
publication title Evidence for a Boat Conformation at the Transition State of Gh76 Alpha-1,6-Mannanases- Key Enzymes in Bacterial and Fungal Mannoprotein Metabolism
pubmed doi rcsb
source organism Bacillus circulans
total genus 138
structure length 334
sequence length 337
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4d4aA00
3SQCA 1GHQA 2I07B 3E30B 2WY8A 1TN6B 1N4PB 1TNYB 3DSSB 1S63B 4ZRPA 5FO9B 3E34B 1TNOB 4M76A 1D8DB 2BB5A 3DRAB 3Q7AB 4D4BA 4KKJA 1FPPB 2G0DA 1TN8B 2A73B 4LNBB 1QBQB 1H3CA 2H6GB 2ZISB 2XWJB 2V3PA 5FO7B 4YDEB 1HZFA 2ZIRB 4GTMB 4FXGB 1QQFA 3K7XA 4GTPB 4D94A 5FO8B 3G6JB 1LD8B 2BEDB 4BOKA 4GTQB 3OXUA 2NOJA 4ZRQA 3DSXB 1TN7B 1MZCB 1JCQB 1KZOB 3EU5B 3Q75B 3DSWB 3PZ3B 3SFYB 4D4CA 1H36A 4GTSB 1SA4B 2H6IB 3KSLB 1H35A 2BBCA 3EUVB 4D4DA 3PZ2B 4GTTB 1O6QA 2BB6A 1W6JA 4ONTA 1GXOA 1O1SB 4KKIA 4EHMB 2PMVA 3KSQB 1LD7B 4V1SA 2F0YB 2V8IA 1N95B 4FXKB 3RJ3A 4GTVB 1H39A 3KLSA 1H37A 4MBGB 3C72B 2H6FB 4ZH1A 4GTRB 3SFXB 2H6HB 1N4RB 2SQCA 1GSZA 1R76A 1NI1B 5AGDA 1O6HA 1X81B 2PN5A 3OEDA 3DSUB 4LNGB 3D5SA 1TNBB 3E37B 3DPYB 4V1RA 4D4AA 2G02A 4BOJA 1NL4B 4L9PB 2V8KA 1DCEB 3DSVB 1TNZB 2WIIB 1FT1B 1SQCA 1GXMA 2XWBB 1N4QB 5FOBB 1N94B 2R2LB 4YDOB 1GXNA 3Q79B 3HXCB 1LTXB 3D5RA 1SA5B 1C3DA 1O5MB 2XQWA 1W6KA 1S64B 1UMPA 3E33B 1JCSB 1H3BA 1D8EB 1N9AB 3KQ4A 4LNVA 1H3AA 2GOXA 5JPNB 3HXDB 5JPMB 3HXFB 2B39A 2WY7A 4C1SA 3E32B 1TNUB 2V8JA 3Q7FB 1O79A 2IEJB 3DSTB 3HXBB 4GTOB 3HXEB 4MU9A 3CU7A 1FT2B 1O6RA 1O1TB 1QSJA 3PZ1B 3PZ4B 1JCRB 3Q78B 1KZPB 2V3NA 1O1RB 2WINB 3Q73B 1N4SB
chains in the Genus database with same CATH superfamily
1HXCA 2I07B 2A8ZA 1TNYB 4WU0A 3DSSB 1S63B 2BRWA 4Z4LA 3E34B 1TNOB 3EZ8A 4M76A 1D8DB 1ULVA 1N7QA 1XWTA 2DRSA 3RRSA 2G0DA 1CLCA 4LNBB 1H3CA 1HMWA 4FNVA 3GLYA 1V7XA 1KRFA 1HZFA 4GTMB 2FBAA 2P0VA 4FXGB 1N1BA 2F6DA 3M7BA 1G9JA 1N7RA 2ONHA 1JCQB 3M71A 3SFYB 1GAIA 1H36A 1LF9A 1L2AA 1X1HA 1H35A 3P5PA 2FUZA 2BB6A 4KKIA 4EHMB 4V1SA 2XFGA 3D3IA 3H3KA 4OK4A 5IKHA 3C72B 2H6FB 3M74A 3QFZA 2SQCA 1C82A 3NFVA 4V1RA 4L9PB 2DROA 5ILZA 1DCEB 2FUQA 3E6UA 3M00A 3TF4A 1SQCA 1GAHA 1IA7A 2E22A 4Q2BA 1GXNA 3HXCB 3M75A 5IL8A 4XUVA 1O5MB 1W6KA 1LXKA 3WIRA 4KTPA 1NC5A 1D8EB 1FP3A 3QT3A 4AYRA 4L0GA 1CEMA 2JJBA 5ILHA 1KREA 3E32B 2QNOA 3QWTA 4MMIA 1F9DA 1J0NA 2AHFA 1NXCA 1IA6A 2X03A 3ANJA 1QSJA 1DOGA 3W7UA 1HMUA 5M7YA 1JCRB 3Q78B 3X17A 1O1RB 1LF6A 3M72A 1N4SB 1N7PA 3SQCA 1GHQA 4OK2A 4OJZA 3E7JA 3P2CA 1VD5A 1N4PB 5EASA 1JS4A 4ZRPA 1I8QA 4WVCA 1TN8B 4QT9A 2A73B 4E1YA 1UG9A 1N22A 3W5MA 1HXAA 2H6GB 2ZISB 1WZZA 5EATA 2RGKA 2XWJB 3S9VA 2VN7A 2WDAA 5GZKA 5DGQA 5GY3A 3ACSA 1QAZA 3N0GA 4GTPB 3QPFA 5FO8B 1LD8B 3H7LA 1G9GA 3WIQA 4ZRQA 1TN7B 1KS8A 3NNBA 3W5NA 3PYAA 4ZG8A 4GTSB 5ILYA 3QRYA 1V5CA 3WKGA 5ILDA 3PZ2B 3VSNA 1CB8A 1W6JA 1X9DA 3M78A 2F0YB 2D5JA 3S4AA 4FXKB 4AYOA 2FV1A 4GTVB 1HXGA 3KLSA 3CIHA 3M73A 2E24A 4MBGB 4ZH1A 1N4RB 3GZKA 1GSZA 1NI1B 3DSUB 3G4FA 3M01A 4LNGB 1G6IA 2OKXA 2G02A 2Q1FA 3A0OA 1XWQA 1NL4B 5C05A 1FCEA 3RX7A 2BRPA 1OJOA 1AGMA 2WIIB 1DL2A 4WVAA 1V7WA 1H14A 2XWBB 5FOBB 3RX8A 4NEIA 3Q79B 4YDOB 2RI9A 3S4BA 2EAEA 1L1YA 3E33B 1S64B 3P5RA 3SDVA 5IM1A 1H3BA 3E73A 1RQ5A 1LXMA 1H3AA 2GOXA 2FV0A 3ACTA 3LZ9A 1RWGA 2WY7A 4C1SA 3S4DA 4DOEA 1TNUB 3Q7FB 1O79A 2IEJB 3DSTB 4CE7A 3W7SA 2WYNA 4MU9A 2VN4A 1O1TB 3PZ1B 1H12A 2FUTA 1KZPB 2WINB 3M76A 3WUXA 2WY8A 1TN6B 2AHGA 3AFJA 3ON6A 3VW5A 1HM3A 5IK9A 5MEHA 1KSCA 1N7NA 2BB5A 3Q7AB 4D4BA 1FPPB 5JMFA 1RWAA 1FMIA 4LIXA 1V5DA 5FO7B 4YDEB 4ZH5A 3SDUA 3N0FA 1G87A 1QQFA 3K7XA 1HM2A 4D94A 3G6JB 2BEDB 5CD2A 1FBOA 4GTQB 3OXUA 1LOHA 2NOJA 4BOKA 2DRQA 3WC3A 1F9GA 3PYBA 1KZOB 2NVPA 1AYXA 4D4CA 1N1ZA 3G4DA 2H6IB 3KSLB 3QXQA 4D4DA 1KKTA 4GTTB 1O6QA 4ONTA 5ILIA 1GXOA 1O1SB 3W7WA 3W7TA 2PMVA 1EGUA 1N21A 1H13A 1OJNA 4EL8A 4F10A 3QXFA 2J5CA 1UT9A 1H39A 1FBWA 4L6XA 1HX9A 3QDEA 1FAEA 1H37A 3VSMA 2EACA 4GTRB 3SFXB 2CQSA 3SDTA 3M7CA 1R76A 1IS9A 1O6HA 3QG0A 2EADA 2PN5A 1F9OA 4WVBA 1TNBB 3E37B 2JG0A 3DPYB 4D4AA 1N7OA 1GA2A 4RNQA 1N24A 2V8KA 3DSVB 1FT1B 1F1SA 1RWCA 5EAUA 1GXMA 1N94B 2R2LB 3EQAA 1HCUA 4KTRA 4TF4A 5JMDA 1XW2A 1UMPA 1N9AB 1WU6A 3KQ4A 5M7IA 3WKIA 1TF4A 5JPNB 3HXDB 5JPMB 3H2WA 3HXFB 2GH4A 2V8JA 3HXEB 1H54A 1O6RA 4CJ1A 2ZBLA 1WU5A 4F13A 4Z4JA 4AYQA 3PZ4B 1J0MA 3A3VA 2AFAA 5KKBA 4Q88A 3E30B 1RWFA 4YCRA 3WKHA 1WU4A 5FO9B 3QFYA 3SDRA 3GT5A 3DRAB 4KKJA 2RI8A 3AFLA 4GAXA 1QBQB 3EU8A 4DI5A 5DGRA 3RENA 2V3PA 5DHIA 2ONGA 2ZIRB 3PMMA 4JJJA 3SDQA 5ILKA 1HV6A 1W3YA 2CQTA 3DSXB 3WKFA 5ILJA 1MZCB 3EU5B 3Q75B 1N23A 3ANKA 3DSWB 3PZ3B 2ZZRA 3M7EA 5IL3A 3QT9A 1KFGA 1KWFA 1SA4B 1FO2A 4FUSA 2BBCA 2JF4A 1K72A 3EUVB 4GL3A 3SAEA 3KSQB 1LD7B 2V8IA 1N95B 3RJ3A 1OJPA 3ANIA 3E80A 1X1IA 5IK0A 4OZVA 2YIKA 1OJMA 3M77A 5IKAA 2D8LA 3VXDA 2H6HB 4TXTA 3RX5A 1RWHA 1KSDA 5CZLA 5E2JA 5AGDA 1X81B 3OEDA 4OZWA 3WIWA 3D5SA 4DODA 3M7LA 1GLMA 4BOJA 1N20A 5IK6A 2B4FA 4AYPA 3RSYA 1TNZB 5CA3A 4J5TA 1V7VA 1N4QB 4FJQA 1LTXB 3D5RA 1C3DA 1SA5B 2XQWA 2DRRA 2EABA 2WCOA 2GZ6A 3T33A 1RW9A 1JCSB 2BRVX 3K11A 4LNVA 3W7XA 1HN0A 2Z07A 3M02A 4MMHA 1X1JA 1FO3A 2B39A 5DHKA 3HXBB 4GTOB 3CU7A 1FT2B 3QSPA 4CJ0A 2V3NA 5GW7A 3Q73B 3S4CA
chains in the Genus database with same CATH topology
2I07B 2A8ZA 1TNYB 4WU0A 3DSSB 1S63B 4Z4LA 3E34B 1TNOB 3EZ8A 4M76A 1D8DB 1ULVA 1XWTA 2DRSA 3RRSA 2G0DA 1CLCA 4LNBB 1H3CA 3GLYA 1V7XA 1KRFA 1HZFA 4GTMB 2FBAA 2P0VA 4FXGB 2F6DA 3M7BA 1G9JA 1JCQB 3M71A 3SFYB 1GAIA 1H36A 1LF9A 1L2AA 1H35A 3P5PA 2FUZA 2BB6A 4KKIA 4EHMB 4V1SA 2XFGA 3D3IA 3H3KA 3C72B 2H6FB 3M74A 3QFZA 2SQCA 4V1RA 4L9PB 2DROA 1DCEB 3E6UA 3TF4A 1SQCA 1GAHA 1IA7A 4Q2BA 1GXNA 3M75A 3HXCB 4XUVA 1O5MB 1W6KA 3WIRA 4KTPA 1NC5A 1D8EB 1FP3A 3QT3A 4AYRA 4L0GA 1CEMA 2JJBA 1KREA 3E32B 2QNOA 3QWTA 1F9DA 2AHFA 1NXCA 1IA6A 3ANJA 1QSJA 1DOGA 3W7UA 5M7YA 1JCRB 3Q78B 3X17A 1O1RB 1LF6A 3M72A 1N4SB 3SQCA 1GHQA 3P2CA 1VD5A 1N4PB 1JS4A 4ZRPA 4WVCA 1TN8B 4QT9A 2A73B 1UG9A 3W5MA 2H6GB 2ZISB 1WZZA 2RGKA 2XWJB 3S9VA 2VN7A 5GZKA 5DGQA 5GY3A 3ACSA 4GTPB 3QPFA 5FO8B 1LD8B 3H7LA 1G9GA 3WIQA 4ZRQA 1TN7B 1KS8A 3W5NA 3PYAA 4ZG8A 4GTSB 3QRYA 1V5CA 3WKGA 3PZ2B 1W6JA 1X9DA 3M78A 2F0YB 2D5JA 3S4AA 4FXKB 4AYOA 2FV1A 4GTVB 3KLSA 3CIHA 3M73A 4MBGB 4ZH1A 1N4RB 3GZKA 1GSZA 1NI1B 3DSUB 4LNGB 1G6IA 2OKXA 2G02A 1XWQA 1NL4B 1FCEA 3RX7A 1AGMA 2WIIB 1DL2A 4WVAA 1V7WA 1H14A 2XWBB 5FOBB 3RX8A 4YDOB 3Q79B 2RI9A 3S4BA 2EAEA 1L1YA 3E33B 1S64B 3P5RA 3SDVA 1H3BA 3E73A 1RQ5A 1H3AA 2GOXA 2FV0A 3ACTA 2WY7A 4C1SA 3S4DA 4DOEA 1TNUB 3Q7FB 1O79A 2IEJB 3DSTB 4CE7A 3W7SA 2WYNA 4MU9A 2VN4A 1O1TB 3PZ1B 1H12A 1KZPB 2WINB 3M76A 3WUXA 2WY8A 1TN6B 2AHGA 3AFJA 3ON6A 3VW5A 5MEHA 1KSCA 2BB5A 3Q7AB 4D4BA 1FPPB 1FMIA 4LIXA 1V5DA 5FO7B 4YDEB 4ZH5A 3SDUA 1G87A 1QQFA 3K7XA 4D94A 3G6JB 2BEDB 5CD2A 1FBOA 4GTQB 3OXUA 2NOJA 4BOKA 2DRQA 3WC3A 3PYBA 1KZOB 2NVPA 1AYXA 4D4CA 2H6IB 3KSLB 3QXQA 4D4DA 1KKTA 4GTTB 1O6QA 4ONTA 1GXOA 1O1SB 3W7WA 3W7TA 2PMVA 1H13A 4EL8A 3QXFA 1UT9A 1H39A 1FBWA 4L6XA 3QDEA 1FAEA 1H37A 2EACA 4GTRB 3SFXB 2CQSA 3SDTA 3M7CA 1R76A 1IS9A 1O6HA 3QG0A 2EADA 2PN5A 1F9OA 4WVBA 1TNBB 3E37B 2JG0A 3DPYB 4D4AA 1GA2A 2V8KA 3DSVB 1FT1B 1GXMA 1N94B 2R2LB 3EQAA 1HCUA 4KTRA 4TF4A 1XW2A 1UMPA 1N9AB 1WU6A 3KQ4A 5M7IA 3WKIA 1TF4A 5JPNB 3HXDB 5JPMB 3H2WA 3HXFB 2GH4A 2V8JA 3HXEB 1H54A 1O6RA 4CJ1A 2ZBLA 1WU5A 4Z4JA 4AYQA 3PZ4B 3A3VA 2AFAA 5KKBA 4Q88A 3E30B 4YCRA 3WKHA 1WU4A 5FO9B 3QFYA 3SDRA 3GT5A 3DRAB 4KKJA 2RI8A 1QBQB 3EU8A 5DGRA 3RENA 2V3PA 2ZIRB 3PMMA 4JJJA 3SDQA 2CQTA 3WKFA 3DSXB 1MZCB 3EU5B 3Q75B 3ANKA 3DSWB 3PZ3B 2ZZRA 3M7EA 3QT9A 1KFGA 1KWFA 1SA4B 1FO2A 4FUSA 2BBCA 2JF4A 1K72A 3EUVB 4GL3A 3SAEA 3KSQB 1LD7B 2V8IA 1N95B 3RJ3A 3ANIA 2YIKA 3M77A 2D8LA 3VXDA 2H6HB 4TXTA 3RX5A 1KSDA 5CZLA 5E2JA 5AGDA 1X81B 3OEDA 3WIWA 3D5SA 4DODA 3M7LA 1GLMA 4BOJA 2B4FA 4AYPA 3RSYA 1TNZB 5CA3A 4J5TA 1V7VA 1N4QB 1LTXB 3D5RA 1C3DA 1SA5B 2XQWA 2DRRA 2EABA 2GZ6A 3T33A 1JCSB 3K11A 4LNVA 3W7XA 2Z07A 1FO3A 2B39A 3HXBB 4GTOB 3CU7A 1FT2B 3QSPA 4CJ0A 2V3NA 5GW7A 3Q73B 3S4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQC A;  1GHQ A;  2I07 B;  3E30 B;  2WY8 A;  1TN6 B;  1N4P B;  1TNY B;  3DSS B;  1S63 B;  4ZRP A;  5FO9 B;  3E34 B;  1TNO B;  4M76 A;  1D8D B;  2BB5 A;  3DRA B;  3Q7A B;  4D4B A;  4KKJ A;  1FPP B;  2G0D A;  1TN8 B;  2A73 B;  4LNB B;  1QBQ B;  1H3C A;  2H6G B;  2ZIS B;  2XWJ B;  2V3P A;  5FO7 B;  4YDE B;  1HZF A;  2ZIR B;  4GTM B;  4FXG B;  1QQF A;  3K7X A;  4GTP B;  4D94 A;  5FO8 B;  3G6J B;  1LD8 B;  2BED B;  4BOK A;  4GTQ B;  3OXU A;  2NOJ A;  4ZRQ A;  3DSX B;  1TN7 B;  1MZC B;  1JCQ B;  1KZO B;  3EU5 B;  3Q75 B;  3DSW B;  3PZ3 B;  3SFY B;  4D4C A;  1H36 A;  4GTS B;  1SA4 B;  2H6I B;  3KSL B;  1H35 A;  2BBC A;  3EUV B;  4D4D A;  3PZ2 B;  4GTT B;  1O6Q A;  2BB6 A;  1W6J A;  4ONT A;  1GXO A;  1O1S B;  4KKI A;  4EHM B;  2PMV A;  3KSQ B;  1LD7 B;  4V1S A;  2F0Y B;  2V8I A;  1N95 B;  4FXK B;  3RJ3 A;  4GTV B;  1H39 A;  3KLS A;  1H37 A;  4MBG B;  3C72 B;  2H6F B;  4ZH1 A;  4GTR B;  3SFX B;  2H6H B;  1N4R B;  2SQC A;  1GSZ A;  1R76 A;  1NI1 B;  5AGD A;  1O6H A;  1X81 B;  2PN5 A;  3OED A;  3DSU B;  4LNG B;  3D5S A;  1TNB B;  3E37 B;  3DPY B;  4V1R A;  4D4A A;  2G02 A;  4BOJ A;  1NL4 B;  4L9P B;  2V8K A;  1DCE B;  3DSV B;  1TNZ B;  2WII B;  1FT1 B;  1SQC A;  1GXM A;  2XWB B;  1N4Q B;  5FOB B;  1N94 B;  2R2L B;  4YDO B;  1GXN A;  3Q79 B;  3HXC B;  1LTX B;  3D5R A;  1SA5 B;  1C3D A;  1O5M B;  2XQW A;  1W6K A;  1S64 B;  1UMP A;  3E33 B;  1JCS B;  1H3B A;  1D8E B;  1N9A B;  3KQ4 A;  4LNV A;  1H3A A;  2GOX A;  5JPN B;  3HXD B;  5JPM B;  3HXF B;  2B39 A;  2WY7 A;  4C1S A;  3E32 B;  1TNU B;  2V8J A;  3Q7F B;  1O79 A;  2IEJ B;  3DST B;  3HXB B;  4GTO B;  3HXE B;  4MU9 A;  3CU7 A;  1FT2 B;  1O6R A;  1O1T B;  1QSJ A;  3PZ1 B;  3PZ4 B;  1JCR B;  3Q78 B;  1KZP B;  2V3N A;  1O1R B;  2WIN B;  3Q73 B;  1N4S B; 
#chains in the Genus database with same CATH topology
 1HXC A;  2I07 B;  2A8Z A;  1TNY B;  4WU0 A;  3DSS B;  1S63 B;  2BRW A;  4Z4L A;  3E34 B;  1TNO B;  3EZ8 A;  4M76 A;  1D8D B;  1ULV A;  1N7Q A;  1XWT A;  2DRS A;  3RRS A;  2G0D A;  1CLC A;  4LNB B;  1H3C A;  1HMW A;  4FNV A;  3GLY A;  1V7X A;  1KRF A;  1HZF A;  4GTM B;  2FBA A;  2P0V A;  4FXG B;  1N1B A;  2F6D A;  3M7B A;  1G9J A;  1N7R A;  2ONH A;  1JCQ B;  3M71 A;  3SFY B;  1GAI A;  1H36 A;  1LF9 A;  1L2A A;  1X1H A;  1H35 A;  3P5P A;  2FUZ A;  2BB6 A;  4KKI A;  4EHM B;  4V1S A;  2XFG A;  3D3I A;  3H3K A;  4OK4 A;  5IKH A;  3C72 B;  2H6F B;  3M74 A;  3QFZ A;  2SQC A;  1C82 A;  3NFV A;  4V1R A;  4L9P B;  2DRO A;  5ILZ A;  1DCE B;  2FUQ A;  3E6U A;  3M00 A;  3TF4 A;  1SQC A;  1GAH A;  1IA7 A;  2E22 A;  4Q2B A;  1GXN A;  3HXC B;  3M75 A;  5IL8 A;  4XUV A;  1O5M B;  1W6K A;  1LXK A;  3WIR A;  4KTP A;  1NC5 A;  1D8E B;  1FP3 A;  3QT3 A;  4AYR A;  4L0G A;  1CEM A;  2JJB A;  5ILH A;  1KRE A;  3E32 B;  2QNO A;  3QWT A;  4MMI A;  1F9D A;  1J0N A;  2AHF A;  1NXC A;  1IA6 A;  2X03 A;  3ANJ A;  1QSJ A;  1DOG A;  3W7U A;  1HMU A;  5M7Y A;  1JCR B;  3Q78 B;  3X17 A;  1O1R B;  1LF6 A;  3M72 A;  1N4S B;  1N7P A;  3SQC A;  1GHQ A;  4OK2 A;  4OJZ A;  3E7J A;  3P2C A;  1VD5 A;  1N4P B;  5EAS A;  1JS4 A;  4ZRP A;  1I8Q A;  4WVC A;  1TN8 B;  4QT9 A;  2A73 B;  4E1Y A;  1UG9 A;  1N22 A;  3W5M A;  1HXA A;  2H6G B;  2ZIS B;  1WZZ A;  5EAT A;  2RGK A;  2XWJ B;  3S9V A;  2VN7 A;  2WDA A;  5GZK A;  5DGQ A;  5GY3 A;  3ACS A;  1QAZ A;  3N0G A;  4GTP B;  3QPF A;  5FO8 B;  1LD8 B;  3H7L A;  1G9G A;  3WIQ A;  4ZRQ A;  1TN7 B;  1KS8 A;  3NNB A;  3W5N A;  3PYA A;  4ZG8 A;  4GTS B;  5ILY A;  3QRY A;  1V5C A;  3WKG A;  5ILD A;  3PZ2 B;  3VSN A;  1CB8 A;  1W6J A;  1X9D A;  3M78 A;  2F0Y B;  2D5J A;  3S4A A;  4FXK B;  4AYO A;  2FV1 A;  4GTV B;  1HXG A;  3KLS A;  3CIH A;  3M73 A;  2E24 A;  4MBG B;  4ZH1 A;  1N4R B;  3GZK A;  1GSZ A;  1NI1 B;  3DSU B;  3G4F A;  3M01 A;  4LNG B;  1G6I A;  2OKX A;  2G02 A;  2Q1F A;  3A0O A;  1XWQ A;  1NL4 B;  5C05 A;  1FCE A;  3RX7 A;  2BRP A;  1OJO A;  1AGM A;  2WII B;  1DL2 A;  4WVA A;  1V7W A;  1H14 A;  2XWB B;  5FOB B;  3RX8 A;  4NEI A;  3Q79 B;  4YDO B;  2RI9 A;  3S4B A;  2EAE A;  1L1Y A;  3E33 B;  1S64 B;  3P5R A;  3SDV A;  5IM1 A;  1H3B A;  3E73 A;  1RQ5 A;  1LXM A;  1H3A A;  2GOX A;  2FV0 A;  3ACT A;  3LZ9 A;  1RWG A;  2WY7 A;  4C1S A;  3S4D A;  4DOE A;  1TNU B;  3Q7F B;  1O79 A;  2IEJ B;  3DST B;  4CE7 A;  3W7S A;  2WYN A;  4MU9 A;  2VN4 A;  1O1T B;  3PZ1 B;  1H12 A;  2FUT A;  1KZP B;  2WIN B;  3M76 A;  3WUX A;  2WY8 A;  1TN6 B;  2AHG A;  3AFJ A;  3ON6 A;  3VW5 A;  1HM3 A;  5IK9 A;  5MEH A;  1KSC A;  1N7N A;  2BB5 A;  3Q7A B;  4D4B A;  1FPP B;  5JMF A;  1RWA A;  1FMI A;  4LIX A;  1V5D A;  5FO7 B;  4YDE B;  4ZH5 A;  3SDU A;  3N0F A;  1G87 A;  1QQF A;  3K7X A;  1HM2 A;  4D94 A;  3G6J B;  2BED B;  5CD2 A;  1FBO A;  4GTQ B;  3OXU A;  1LOH A;  2NOJ A;  4BOK A;  2DRQ A;  3WC3 A;  1F9G A;  3PYB A;  1KZO B;  2NVP A;  1AYX A;  4D4C A;  1N1Z A;  3G4D A;  2H6I B;  3KSL B;  3QXQ A;  4D4D A;  1KKT A;  4GTT B;  1O6Q A;  4ONT A;  5ILI A;  1GXO A;  1O1S B;  3W7W A;  3W7T A;  2PMV A;  1EGU A;  1N21 A;  1H13 A;  1OJN A;  4EL8 A;  4F10 A;  3QXF A;  2J5C A;  1UT9 A;  1H39 A;  1FBW A;  4L6X A;  1HX9 A;  3QDE A;  1FAE A;  1H37 A;  3VSM A;  2EAC A;  4GTR B;  3SFX B;  2CQS A;  3SDT A;  3M7C A;  1R76 A;  1IS9 A;  1O6H A;  3QG0 A;  2EAD A;  2PN5 A;  1F9O A;  4WVB A;  1TNB B;  3E37 B;  2JG0 A;  3DPY B;  4D4A A;  1N7O A;  1GA2 A;  4RNQ A;  1N24 A;  2V8K A;  3DSV B;  1FT1 B;  1F1S A;  1RWC A;  5EAU A;  1GXM A;  1N94 B;  2R2L B;  3EQA A;  1HCU A;  4KTR A;  4TF4 A;  5JMD A;  1XW2 A;  1UMP A;  1N9A B;  1WU6 A;  3KQ4 A;  5M7I A;  3WKI A;  1TF4 A;  5JPN B;  3HXD B;  5JPM B;  3H2W A;  3HXF B;  2GH4 A;  2V8J A;  3HXE B;  1H54 A;  1O6R A;  4CJ1 A;  2ZBL A;  1WU5 A;  4F13 A;  4Z4J A;  4AYQ A;  3PZ4 B;  1J0M A;  3A3V A;  2AFA A;  5KKB A;  4Q88 A;  3E30 B;  1RWF A;  4YCR A;  3WKH A;  1WU4 A;  5FO9 B;  3QFY A;  3SDR A;  3GT5 A;  3DRA B;  4KKJ A;  2RI8 A;  3AFL A;  4GAX A;  1QBQ B;  3EU8 A;  4DI5 A;  5DGR A;  3REN A;  2V3P A;  5DHI A;  2ONG A;  2ZIR B;  3PMM A;  4JJJ A;  3SDQ A;  5ILK A;  1HV6 A;  1W3Y A;  2CQT A;  3DSX B;  3WKF A;  5ILJ A;  1MZC B;  3EU5 B;  3Q75 B;  1N23 A;  3ANK A;  3DSW B;  3PZ3 B;  2ZZR A;  3M7E A;  5IL3 A;  3QT9 A;  1KFG A;  1KWF A;  1SA4 B;  1FO2 A;  4FUS A;  2BBC A;  2JF4 A;  1K72 A;  3EUV B;  4GL3 A;  3SAE A;  3KSQ B;  1LD7 B;  2V8I A;  1N95 B;  3RJ3 A;  1OJP A;  3ANI A;  3E80 A;  1X1I A;  5IK0 A;  4OZV A;  2YIK A;  1OJM A;  3M77 A;  5IKA A;  2D8L A;  3VXD A;  2H6H B;  4TXT A;  3RX5 A;  1RWH A;  1KSD A;  5CZL A;  5E2J A;  5AGD A;  1X81 B;  3OED A;  4OZW A;  3WIW A;  3D5S A;  4DOD A;  3M7L A;  1GLM A;  4BOJ A;  1N20 A;  5IK6 A;  2B4F A;  4AYP A;  3RSY A;  1TNZ B;  5CA3 A;  4J5T A;  1V7V A;  1N4Q B;  4FJQ A;  1LTX B;  3D5R A;  1C3D A;  1SA5 B;  2XQW A;  2DRR A;  2EAB A;  2WCO A;  2GZ6 A;  3T33 A;  1RW9 A;  1JCS B;  2BRV X;  3K11 A;  4LNV A;  3W7X A;  1HN0 A;  2Z07 A;  3M02 A;  4MMH A;  1X1J A;  1FO3 A;  2B39 A;  5DHK A;  3HXB B;  4GTO B;  3CU7 A;  1FT2 B;  3QSP A;  4CJ0 A;  2V3N A;  5GW7 A;  3Q73 B;  3S4C A; 
#chains in the Genus database with same CATH homology
 2I07 B;  2A8Z A;  1TNY B;  4WU0 A;  3DSS B;  1S63 B;  4Z4L A;  3E34 B;  1TNO B;  3EZ8 A;  4M76 A;  1D8D B;  1ULV A;  1XWT A;  2DRS A;  3RRS A;  2G0D A;  1CLC A;  4LNB B;  1H3C A;  3GLY A;  1V7X A;  1KRF A;  1HZF A;  4GTM B;  2FBA A;  2P0V A;  4FXG B;  2F6D A;  3M7B A;  1G9J A;  1JCQ B;  3M71 A;  3SFY B;  1GAI A;  1H36 A;  1LF9 A;  1L2A A;  1H35 A;  3P5P A;  2FUZ A;  2BB6 A;  4KKI A;  4EHM B;  4V1S A;  2XFG A;  3D3I A;  3H3K A;  3C72 B;  2H6F B;  3M74 A;  3QFZ A;  2SQC A;  4V1R A;  4L9P B;  2DRO A;  1DCE B;  3E6U A;  3TF4 A;  1SQC A;  1GAH A;  1IA7 A;  4Q2B A;  1GXN A;  3M75 A;  3HXC B;  4XUV A;  1O5M B;  1W6K A;  3WIR A;  4KTP A;  1NC5 A;  1D8E B;  1FP3 A;  3QT3 A;  4AYR A;  4L0G A;  1CEM A;  2JJB A;  1KRE A;  3E32 B;  2QNO A;  3QWT A;  1F9D A;  2AHF A;  1NXC A;  1IA6 A;  3ANJ A;  1QSJ A;  1DOG A;  3W7U A;  5M7Y A;  1JCR B;  3Q78 B;  3X17 A;  1O1R B;  1LF6 A;  3M72 A;  1N4S B;  3SQC A;  1GHQ A;  3P2C A;  1VD5 A;  1N4P B;  1JS4 A;  4ZRP A;  4WVC A;  1TN8 B;  4QT9 A;  2A73 B;  1UG9 A;  3W5M A;  2H6G B;  2ZIS B;  1WZZ A;  2RGK A;  2XWJ B;  3S9V A;  2VN7 A;  5GZK A;  5DGQ A;  5GY3 A;  3ACS A;  4GTP B;  3QPF A;  5FO8 B;  1LD8 B;  3H7L A;  1G9G A;  3WIQ A;  4ZRQ A;  1TN7 B;  1KS8 A;  3W5N A;  3PYA A;  4ZG8 A;  4GTS B;  3QRY A;  1V5C A;  3WKG A;  3PZ2 B;  1W6J A;  1X9D A;  3M78 A;  2F0Y B;  2D5J A;  3S4A A;  4FXK B;  4AYO A;  2FV1 A;  4GTV B;  3KLS A;  3CIH A;  3M73 A;  4MBG B;  4ZH1 A;  1N4R B;  3GZK A;  1GSZ A;  1NI1 B;  3DSU B;  4LNG B;  1G6I A;  2OKX A;  2G02 A;  1XWQ A;  1NL4 B;  1FCE A;  3RX7 A;  1AGM A;  2WII B;  1DL2 A;  4WVA A;  1V7W A;  1H14 A;  2XWB B;  5FOB B;  3RX8 A;  4YDO B;  3Q79 B;  2RI9 A;  3S4B A;  2EAE A;  1L1Y A;  3E33 B;  1S64 B;  3P5R A;  3SDV A;  1H3B A;  3E73 A;  1RQ5 A;  1H3A A;  2GOX A;  2FV0 A;  3ACT A;  2WY7 A;  4C1S A;  3S4D A;  4DOE A;  1TNU B;  3Q7F B;  1O79 A;  2IEJ B;  3DST B;  4CE7 A;  3W7S A;  2WYN A;  4MU9 A;  2VN4 A;  1O1T B;  3PZ1 B;  1H12 A;  1KZP B;  2WIN B;  3M76 A;  3WUX A;  2WY8 A;  1TN6 B;  2AHG A;  3AFJ A;  3ON6 A;  3VW5 A;  5MEH A;  1KSC A;  2BB5 A;  3Q7A B;  4D4B A;  1FPP B;  1FMI A;  4LIX A;  1V5D A;  5FO7 B;  4YDE B;  4ZH5 A;  3SDU A;  1G87 A;  1QQF A;  3K7X A;  4D94 A;  3G6J B;  2BED B;  5CD2 A;  1FBO A;  4GTQ B;  3OXU A;  2NOJ A;  4BOK A;  2DRQ A;  3WC3 A;  3PYB A;  1KZO B;  2NVP A;  1AYX A;  4D4C A;  2H6I B;  3KSL B;  3QXQ A;  4D4D A;  1KKT A;  4GTT B;  1O6Q A;  4ONT A;  1GXO A;  1O1S B;  3W7W A;  3W7T A;  2PMV A;  1H13 A;  4EL8 A;  3QXF A;  1UT9 A;  1H39 A;  1FBW A;  4L6X A;  3QDE A;  1FAE A;  1H37 A;  2EAC A;  4GTR B;  3SFX B;  2CQS A;  3SDT A;  3M7C A;  1R76 A;  1IS9 A;  1O6H A;  3QG0 A;  2EAD A;  2PN5 A;  1F9O A;  4WVB A;  1TNB B;  3E37 B;  2JG0 A;  3DPY B;  4D4A A;  1GA2 A;  2V8K A;  3DSV B;  1FT1 B;  1GXM A;  1N94 B;  2R2L B;  3EQA A;  1HCU A;  4KTR A;  4TF4 A;  1XW2 A;  1UMP A;  1N9A B;  1WU6 A;  3KQ4 A;  5M7I A;  3WKI A;  1TF4 A;  5JPN B;  3HXD B;  5JPM B;  3H2W A;  3HXF B;  2GH4 A;  2V8J A;  3HXE B;  1H54 A;  1O6R A;  4CJ1 A;  2ZBL A;  1WU5 A;  4Z4J A;  4AYQ A;  3PZ4 B;  3A3V A;  2AFA A;  5KKB A;  4Q88 A;  3E30 B;  4YCR A;  3WKH A;  1WU4 A;  5FO9 B;  3QFY A;  3SDR A;  3GT5 A;  3DRA B;  4KKJ A;  2RI8 A;  1QBQ B;  3EU8 A;  5DGR A;  3REN A;  2V3P A;  2ZIR B;  3PMM A;  4JJJ A;  3SDQ A;  2CQT A;  3WKF A;  3DSX B;  1MZC B;  3EU5 B;  3Q75 B;  3ANK A;  3DSW B;  3PZ3 B;  2ZZR A;  3M7E A;  3QT9 A;  1KFG A;  1KWF A;  1SA4 B;  1FO2 A;  4FUS A;  2BBC A;  2JF4 A;  1K72 A;  3EUV B;  4GL3 A;  3SAE A;  3KSQ B;  1LD7 B;  2V8I A;  1N95 B;  3RJ3 A;  3ANI A;  2YIK A;  3M77 A;  2D8L A;  3VXD A;  2H6H B;  4TXT A;  3RX5 A;  1KSD A;  5CZL A;  5E2J A;  5AGD A;  1X81 B;  3OED A;  3WIW A;  3D5S A;  4DOD A;  3M7L A;  1GLM A;  4BOJ A;  2B4F A;  4AYP A;  3RSY A;  1TNZ B;  5CA3 A;  4J5T A;  1V7V A;  1N4Q B;  1LTX B;  3D5R A;  1C3D A;  1SA5 B;  2XQW A;  2DRR A;  2EAB A;  2GZ6 A;  3T33 A;  1JCS B;  3K11 A;  4LNV A;  3W7X A;  2Z07 A;  1FO3 A;  2B39 A;  3HXB B;  4GTO B;  3CU7 A;  1FT2 B;  3QSP A;  4CJ0 A;  2V3N A;  5GW7 A;  3Q73 B;  3S4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...