1HV6A

Crystal structure of alginate lyase a1-iii complexed with trisaccharide product.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
351
structure length
351
Chain Sequence
GSHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNHSYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHYQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ALGINATE LYASE
publication title Crystal structure of alginate lyase A1-III complexed with trisaccharide product at 2.0 A resolution.
pubmed doi rcsb
source organism Sphingomonas sp.
total genus 131
structure length 351
sequence length 351
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2001-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 1hv6A00
1OJOA 4OZVA 1J0MA 1OJNA 5JMDA 1N7NA 1RWAA 1HMUA 2BRPA 4NEIA 1HV6A 1F9GA 5JMFA 1LXKA 1EGUA 4OK4A 1LXMA 4MMIA 1HM3A 1OJMA 3NNBA 1F1SA 1HM2A 1QAZA 2E22A 2Q1FA 1C82A 1HN0A 1W3YA 1X1IA 1X1HA 1J0NA 1N7OA 1OJPA 4OK2A 4OJZA 2X03A 4F13A 1N7QA 1X1JA 2WDAA 1RWFA 1N7RA 1CB8A 1N7PA 4E1YA 2FUTA 2FUQA 2E24A 2BRVX 1RWCA 1RWHA 3AFLA 3E7JA 3NFVA 4F10A 1HMWA 2BRWA 4FNVA 3E80A 1LOHA 1RW9A 1RWGA 3A0OA 3VSNA 4OZWA 2WCOA 4MMHA 1I8QA 3VSMA
chains in the Genus database with same CATH superfamily
4OZVA 2V8KA 1OJNA 1X9DA 2EACA 4C1SA 3KSLB 3W7TA 3SDUA 1OJMA 3N0FA 1GSZA 1O5MB 1FT1B 1X1HA 1KWFA 1JS4A 1RQ5A 1N7PA 1O6HA 3HXEB 4LIXA 4GTPB 1N94B 3W5MA 3EU5B 3W7XA 3QWTA 3EZ8A 4EL8A 1RWGA 5ILJA 3E73A 2WCOA 1N4RB 1DCEB 1HXGA 2DROA 4M76A 1NI1B 5ILKA 4RNQA 2BB6A 2DRRA 2H6GB 4ONTA 2GOXA 1QSJA 4WVBA 2E22A 1C82A 2I07B 3QDEA 5DGQA 2G0DA 4WVAA 4V1RA 1X81B 1RWFA 5AGDA 2FUTA 3RX7A 3VXDA 3PYAA 3EUVB 1FPPB 3E80A 4MU9A 3SDTA 3M7EA 3DSTB 2GZ6A 3DSWB 1CEMA 5IK0A 1CLCA 1GA2A 3OEDA 1LXMA 3X17A 1H35A 2ZBLA 3SFYB 1TN7B 5MEHA 1J0NA 5KKBA 2B39A 4D4BA 1FBWA 1FCEA 1FMIA 4ZRPA 3QPFA 1JCQB 1N24A 3SFXB 2BEDB 4Z4LA 3A3VA 2AFAA 2P0VA 3SQCA 3M00A 3S4AA 3S4BA 3Q79B 3RJ3A 1TN6B 3M02A 1O1TB 4OK4A 2PN5A 4GAXA 2F6DA 2RI8A 3W7UA 2VN4A 1X1JA 1CB8A 3WKIA 2D8LA 2ONHA 2XFGA 3SDQA 5GZKA 1RW9A 1N4QB 1L2AA 2V3NA 1G6IA 1HCUA 3M72A 3RSYA 4ZG8A 2A73B 2H6IB 1H37A 1LD8B 4MBGB 3TF4A 3HXDB 3WUXA 3Q78B 4GTOB 1H36A 4KTRA 1N7OA 1S63B 4FXGB 2FUQA 1LD7B 3DRAB 3AFLA 3S4CA 4FNVA 1GAHA 1KZPB 4OZWA 1WU4A 1O6RA 1SA4B 3OXUA 3WIRA 4KTPA 3WKHA 3H7LA 3E33B 3WKGA 3M71A 4V1SA 1HV6A 2WIIB 1FO2A 1UMPA 1V7WA 2EADA 2QNOA 1MZCB 3KSQB 4QT9A 4GTSB 1LTXB 4ZH5A 1HXAA 1N1ZA 1X1IA 3Q7AB 4D4AA 3RX8A 5ILIA 4CE7A 3ANKA 1NXCA 2AHFA 3S9VA 3WC3A 1FO3A 1RWCA 2GH4A 3M7CA 1SA5B 3Q75B 1IA6A 3CU7A 1FP3A 1F9DA 1OJOA 1V7XA 3SDVA 1F9OA 2D5JA 5JPNB 3PZ1B 4DOEA 1F9GA 5JMFA 5IL3A 5IM1A 1KS8A 1WU6A 1N4SB 1V5DA 1TNYB 1HN0A 1ULVA 4OJZA 2X03A 3H3KA 3QFZA 5FO9B 2H6FB 2WINB 1JCRB 2F0YB 4AYQA 2SQCA 2RGKA 5FO8B 1W6KA 3GT5A 5IK9A 3VSMA 2WY7A 1TF4A 3W7WA 4Q2BA 1RWAA 4DODA 2XQWA 1N20A 5DGRA 3Q7FB 2VN7A 2JG0A 3E37B 2FV1A 1QAZA 1W3YA 3M01A 1JCSB 3CIHA 2FBAA 2G02A 3E7JA 3VW5A 3AFJA 5M7IA 1KREA 3P5RA 1AYXA 2V8JA 3M74A 1I8QA 3QT9A 4MMHA 3E34B 3K11A 1H54A 3DSUB 3Q73B 1H14A 1XWQA 4LNVA 3GZKA 1FAEA 1O1RB 3DSVB 4GTMB 5CZLA 3S4DA 2R2LB 1GXMA 3NNBA 5IKAA 4L6XA 3HXCB 2CQSA 1WZZA 4F10A 3DSSB 1KZOB 3ON6A 1HXCA 4GTQB 1KKTA 1G87A 3H2WA 1GAIA 1DOGA 1AGMA 1HMUA 1QQFA 1O1SB 2WYNA 1N1BA 1TN8B 1G9JA 2J5CA 3SDRA 2E24A 5IK6A 3G4FA 2DRSA 3DSXB 1LOHA 2V8IA 1D8DB 1V7VA 1IA7A 1XWTA 2WY8A 3QSPA 3P2CA 1H3CA 3M7BA 2ZZRA 5GY3A 4YCRA 3M77A 4GTVB 1S64B 3E6UA 3QXQA 4AYRA 1DL2A 4AYPA 1N7QA 5FOBB 4CJ1A 2WDAA 1TNOB 5M7YA 5GW7A 1HZFA 2EABA 1H13A 3D5SA 4JJJA 3PMMA 1UG9A 2FUZA 2IEJB 1OJPA 1QBQB 1N21A 2RI9A 3E32B 2NOJA 4Z4JA 2Z07A 3C72B 5DHIA 1HM2A 2FV0A 2JF4A 4DI5A 1UT9A 3QFYA 5CA3A 3K7XA 3WIWA 3M75A 1NC5A 3D5RA 3PZ4B 4D4CA 3RX5A 1NL4B 3P5PA 1O6QA 2B4FA 1R76A 3KLSA 5IKHA 5JPMB 4GTRB 1H39A 1O79A 2XWJB 1LXKA 1EGUA 1N9AB 4WVCA 1VD5A 3DPYB 2NVPA 1V5CA 4LNGB 4BOKA 1GXOA 1WU5A 2AHGA 1IS9A 4WU0A 2H6HB 3WKFA 2XWBB 3E30B 2BRWA 5ILDA 4L0GA 1C3DA 4L9PB 4FXKB 3VSNA 1KFGA 2JJBA 3ACTA 4TXTA 3EU8A 1J0MA 2ONGA 3RENA 1N7NA 1GLMA 3ANJA 2BRPA 4NEIA 4CJ0A 2A8ZA 1HX9A 3W7SA 1KSCA 1FBOA 1G9GA 1F1SA 2DRQA 4YDOB 4F13A 1FT2B 3QRYA 4OK2A 4EHMB 2EAEA 5EAUA 4KKIA 4GL3A 5ILZA 1D8EB 1GHQA 3M7LA 2BRVX 2V3PA 4YDEB 1W6JA 3PYBA 3N0GA 5ILHA 3GLYA 4XUVA 5CD2A 1N4PB 2ZIRB 5FO7B 4J5TA 3ACSA 3G4DA 2ZISB 4BOJA 2CQTA 2BBCA 5JMDA 5IL8A 5DHKA 3T33A 5E2JA 3PZ2B 1KSDA 1LF9A 2YIKA 3ANIA 4MMIA 4ZRQA 3EQAA 1TNZB 1N23A 1XW2A 5ILYA 3M73A 1L1YA 1KRFA 3NFVA 3M76A 3LZ9A 4D4DA 2PMVA 3A0OA 4FJQA 1H3AA 1N95B 4KKJA 1H12A 1H3BA 3W5NA 1K72A 3PZ3B 5C05A 4GTTB 3RRSA 4TF4A 4Q88A 1N22A 3SAEA 1LF6A 1TNBB 4AYOA 1HM3A 3WIQA 4D94A 2Q1FA 5EASA 4LNBB 3M78A 3KQ4A 4FUSA 1TNUB 1N7RA 4ZH1A 3QT3A 4E1YA 3HXBB 1RWHA 1GXNA 1HMWA 3HXFB 1SQCA 2OKXA 2BB5A 5EATA 3QXFA 3G6JB 3QG0A 3D3IA
chains in the Genus database with same CATH topology
1OJOA 4OZVA 1J0MA 1OJNA 5JMDA 1N7NA 1RWAA 1HMUA 2BRPA 4NEIA 1HV6A 1F9GA 5JMFA 1LXKA 1EGUA 4OK4A 1LXMA 4MMIA 1HM3A 1OJMA 3NNBA 1F1SA 1HM2A 1QAZA 2E22A 2Q1FA 1C82A 1HN0A 1W3YA 1X1IA 1X1HA 1J0NA 1N7OA 1OJPA 4OK2A 4OJZA 2X03A 4F13A 1N7QA 1X1JA 2WDAA 1RWFA 1N7RA 1CB8A 1N7PA 4E1YA 2FUTA 2FUQA 2E24A 2BRVX 1RWCA 1RWHA 3AFLA 3E7JA 3NFVA 4F10A 1HMWA 2BRWA 4FNVA 3E80A 1LOHA 1RW9A 1RWGA 3A0OA 3VSNA 4OZWA 2WCOA 4MMHA 1I8QA 3VSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJO A;  4OZV A;  1J0M A;  1OJN A;  5JMD A;  1N7N A;  1RWA A;  1HMU A;  2BRP A;  4NEI A;  1HV6 A;  1F9G A;  5JMF A;  1LXK A;  1EGU A;  4OK4 A;  1LXM A;  4MMI A;  1HM3 A;  1OJM A;  3NNB A;  1F1S A;  1HM2 A;  1QAZ A;  2E22 A;  2Q1F A;  1C82 A;  1HN0 A;  1W3Y A;  1X1I A;  1X1H A;  1J0N A;  1N7O A;  1OJP A;  4OK2 A;  4OJZ A;  2X03 A;  4F13 A;  1N7Q A;  1X1J A;  2WDA A;  1RWF A;  1N7R A;  1CB8 A;  1N7P A;  4E1Y A;  2FUT A;  2FUQ A;  2E24 A;  2BRV X;  1RWC A;  1RWH A;  3AFL A;  3E7J A;  3NFV A;  4F10 A;  1HMW A;  2BRW A;  4FNV A;  3E80 A;  1LOH A;  1RW9 A;  1RWG A;  3A0O A;  3VSN A;  4OZW A;  2WCO A;  4MMH A;  1I8Q A;  3VSM A; 
#chains in the Genus database with same CATH topology
 4OZV A;  2V8K A;  1OJN A;  1X9D A;  2EAC A;  4C1S A;  3KSL B;  3W7T A;  3SDU A;  1OJM A;  3N0F A;  1GSZ A;  1O5M B;  1FT1 B;  1X1H A;  1KWF A;  1JS4 A;  1RQ5 A;  1N7P A;  1O6H A;  3HXE B;  4LIX A;  4GTP B;  1N94 B;  3W5M A;  3EU5 B;  3W7X A;  3QWT A;  3EZ8 A;  4EL8 A;  1RWG A;  5ILJ A;  3E73 A;  2WCO A;  1N4R B;  1DCE B;  1HXG A;  2DRO A;  4M76 A;  1NI1 B;  5ILK A;  4RNQ A;  2BB6 A;  2DRR A;  2H6G B;  4ONT A;  2GOX A;  1QSJ A;  4WVB A;  2E22 A;  1C82 A;  2I07 B;  3QDE A;  5DGQ A;  2G0D A;  4WVA A;  4V1R A;  1X81 B;  1RWF A;  5AGD A;  2FUT A;  3RX7 A;  3VXD A;  3PYA A;  3EUV B;  1FPP B;  3E80 A;  4MU9 A;  3SDT A;  3M7E A;  3DST B;  2GZ6 A;  3DSW B;  1CEM A;  5IK0 A;  1CLC A;  1GA2 A;  3OED A;  1LXM A;  3X17 A;  1H35 A;  2ZBL A;  3SFY B;  1TN7 B;  5MEH A;  1J0N A;  5KKB A;  2B39 A;  4D4B A;  1FBW A;  1FCE A;  1FMI A;  4ZRP A;  3QPF A;  1JCQ B;  1N24 A;  3SFX B;  2BED B;  4Z4L A;  3A3V A;  2AFA A;  2P0V A;  3SQC A;  3M00 A;  3S4A A;  3S4B A;  3Q79 B;  3RJ3 A;  1TN6 B;  3M02 A;  1O1T B;  4OK4 A;  2PN5 A;  4GAX A;  2F6D A;  2RI8 A;  3W7U A;  2VN4 A;  1X1J A;  1CB8 A;  3WKI A;  2D8L A;  2ONH A;  2XFG A;  3SDQ A;  5GZK A;  1RW9 A;  1N4Q B;  1L2A A;  2V3N A;  1G6I A;  1HCU A;  3M72 A;  3RSY A;  4ZG8 A;  2A73 B;  2H6I B;  1H37 A;  1LD8 B;  4MBG B;  3TF4 A;  3HXD B;  3WUX A;  3Q78 B;  4GTO B;  1H36 A;  4KTR A;  1N7O A;  1S63 B;  4FXG B;  2FUQ A;  1LD7 B;  3DRA B;  3AFL A;  3S4C A;  4FNV A;  1GAH A;  1KZP B;  4OZW A;  1WU4 A;  1O6R A;  1SA4 B;  3OXU A;  3WIR A;  4KTP A;  3WKH A;  3H7L A;  3E33 B;  3WKG A;  3M71 A;  4V1S A;  1HV6 A;  2WII B;  1FO2 A;  1UMP A;  1V7W A;  2EAD A;  2QNO A;  1MZC B;  3KSQ B;  4QT9 A;  4GTS B;  1LTX B;  4ZH5 A;  1HXA A;  1N1Z A;  1X1I A;  3Q7A B;  4D4A A;  3RX8 A;  5ILI A;  4CE7 A;  3ANK A;  1NXC A;  2AHF A;  3S9V A;  3WC3 A;  1FO3 A;  1RWC A;  2GH4 A;  3M7C A;  1SA5 B;  3Q75 B;  1IA6 A;  3CU7 A;  1FP3 A;  1F9D A;  1OJO A;  1V7X A;  3SDV A;  1F9O A;  2D5J A;  5JPN B;  3PZ1 B;  4DOE A;  1F9G A;  5JMF A;  5IL3 A;  5IM1 A;  1KS8 A;  1WU6 A;  1N4S B;  1V5D A;  1TNY B;  1HN0 A;  1ULV A;  4OJZ A;  2X03 A;  3H3K A;  3QFZ A;  5FO9 B;  2H6F B;  2WIN B;  1JCR B;  2F0Y B;  4AYQ A;  2SQC A;  2RGK A;  5FO8 B;  1W6K A;  3GT5 A;  5IK9 A;  3VSM A;  2WY7 A;  1TF4 A;  3W7W A;  4Q2B A;  1RWA A;  4DOD A;  2XQW A;  1N20 A;  5DGR A;  3Q7F B;  2VN7 A;  2JG0 A;  3E37 B;  2FV1 A;  1QAZ A;  1W3Y A;  3M01 A;  1JCS B;  3CIH A;  2FBA A;  2G02 A;  3E7J A;  3VW5 A;  3AFJ A;  5M7I A;  1KRE A;  3P5R A;  1AYX A;  2V8J A;  3M74 A;  1I8Q A;  3QT9 A;  4MMH A;  3E34 B;  3K11 A;  1H54 A;  3DSU B;  3Q73 B;  1H14 A;  1XWQ A;  4LNV A;  3GZK A;  1FAE A;  1O1R B;  3DSV B;  4GTM B;  5CZL A;  3S4D A;  2R2L B;  1GXM A;  3NNB A;  5IKA A;  4L6X A;  3HXC B;  2CQS A;  1WZZ A;  4F10 A;  3DSS B;  1KZO B;  3ON6 A;  1HXC A;  4GTQ B;  1KKT A;  1G87 A;  3H2W A;  1GAI A;  1DOG A;  1AGM A;  1HMU A;  1QQF A;  1O1S B;  2WYN A;  1N1B A;  1TN8 B;  1G9J A;  2J5C A;  3SDR A;  2E24 A;  5IK6 A;  3G4F A;  2DRS A;  3DSX B;  1LOH A;  2V8I A;  1D8D B;  1V7V A;  1IA7 A;  1XWT A;  2WY8 A;  3QSP A;  3P2C A;  1H3C A;  3M7B A;  2ZZR A;  5GY3 A;  4YCR A;  3M77 A;  4GTV B;  1S64 B;  3E6U A;  3QXQ A;  4AYR A;  1DL2 A;  4AYP A;  1N7Q A;  5FOB B;  4CJ1 A;  2WDA A;  1TNO B;  5M7Y A;  5GW7 A;  1HZF A;  2EAB A;  1H13 A;  3D5S A;  4JJJ A;  3PMM A;  1UG9 A;  2FUZ A;  2IEJ B;  1OJP A;  1QBQ B;  1N21 A;  2RI9 A;  3E32 B;  2NOJ A;  4Z4J A;  2Z07 A;  3C72 B;  5DHI A;  1HM2 A;  2FV0 A;  2JF4 A;  4DI5 A;  1UT9 A;  3QFY A;  5CA3 A;  3K7X A;  3WIW A;  3M75 A;  1NC5 A;  3D5R A;  3PZ4 B;  4D4C A;  3RX5 A;  1NL4 B;  3P5P A;  1O6Q A;  2B4F A;  1R76 A;  3KLS A;  5IKH A;  5JPM B;  4GTR B;  1H39 A;  1O79 A;  2XWJ B;  1LXK A;  1EGU A;  1N9A B;  4WVC A;  1VD5 A;  3DPY B;  2NVP A;  1V5C A;  4LNG B;  4BOK A;  1GXO A;  1WU5 A;  2AHG A;  1IS9 A;  4WU0 A;  2H6H B;  3WKF A;  2XWB B;  3E30 B;  2BRW A;  5ILD A;  4L0G A;  1C3D A;  4L9P B;  4FXK B;  3VSN A;  1KFG A;  2JJB A;  3ACT A;  4TXT A;  3EU8 A;  1J0M A;  2ONG A;  3REN A;  1N7N A;  1GLM A;  3ANJ A;  2BRP A;  4NEI A;  4CJ0 A;  2A8Z A;  1HX9 A;  3W7S A;  1KSC A;  1FBO A;  1G9G A;  1F1S A;  2DRQ A;  4YDO B;  4F13 A;  1FT2 B;  3QRY A;  4OK2 A;  4EHM B;  2EAE A;  5EAU A;  4KKI A;  4GL3 A;  5ILZ A;  1D8E B;  1GHQ A;  3M7L A;  2BRV X;  2V3P A;  4YDE B;  1W6J A;  3PYB A;  3N0G A;  5ILH A;  3GLY A;  4XUV A;  5CD2 A;  1N4P B;  2ZIR B;  5FO7 B;  4J5T A;  3ACS A;  3G4D A;  2ZIS B;  4BOJ A;  2CQT A;  2BBC A;  5JMD A;  5IL8 A;  5DHK A;  3T33 A;  5E2J A;  3PZ2 B;  1KSD A;  1LF9 A;  2YIK A;  3ANI A;  4MMI A;  4ZRQ A;  3EQA A;  1TNZ B;  1N23 A;  1XW2 A;  5ILY A;  3M73 A;  1L1Y A;  1KRF A;  3NFV A;  3M76 A;  3LZ9 A;  4D4D A;  2PMV A;  3A0O A;  4FJQ A;  1H3A A;  1N95 B;  4KKJ A;  1H12 A;  1H3B A;  3W5N A;  1K72 A;  3PZ3 B;  5C05 A;  4GTT B;  3RRS A;  4TF4 A;  4Q88 A;  1N22 A;  3SAE A;  1LF6 A;  1TNB B;  4AYO A;  1HM3 A;  3WIQ A;  4D94 A;  2Q1F A;  5EAS A;  4LNB B;  3M78 A;  3KQ4 A;  4FUS A;  1TNU B;  1N7R A;  4ZH1 A;  3QT3 A;  4E1Y A;  3HXB B;  1RWH A;  1GXN A;  1HMW A;  3HXF B;  1SQC A;  2OKX A;  2BB5 A;  5EAT A;  3QXF A;  3G6J B;  3QG0 A;  3D3I A; 
#chains in the Genus database with same CATH homology
 1OJO A;  4OZV A;  1J0M A;  1OJN A;  5JMD A;  1N7N A;  1RWA A;  1HMU A;  2BRP A;  4NEI A;  1HV6 A;  1F9G A;  5JMF A;  1LXK A;  1EGU A;  4OK4 A;  1LXM A;  4MMI A;  1HM3 A;  1OJM A;  3NNB A;  1F1S A;  1HM2 A;  1QAZ A;  2E22 A;  2Q1F A;  1C82 A;  1HN0 A;  1W3Y A;  1X1I A;  1X1H A;  1J0N A;  1N7O A;  1OJP A;  4OK2 A;  4OJZ A;  2X03 A;  4F13 A;  1N7Q A;  1X1J A;  2WDA A;  1RWF A;  1N7R A;  1CB8 A;  1N7P A;  4E1Y A;  2FUT A;  2FUQ A;  2E24 A;  2BRV X;  1RWC A;  1RWH A;  3AFL A;  3E7J A;  3NFV A;  4F10 A;  1HMW A;  2BRW A;  4FNV A;  3E80 A;  1LOH A;  1RW9 A;  1RWG A;  3A0O A;  3VSN A;  4OZW A;  2WCO A;  4MMH A;  1I8Q A;  3VSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...