3E73A

Crystal structure of human lancl1 complexed with gsh
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
405
structure length
405
Chain Sequence
SMDIEFMAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LanC-like protein 1
publication title Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 143
structure length 405
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05147 LANC_like Lanthionine synthetase C-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3e73A00
2VN7A 1V7WA 5GY3A 3WIRA 1CEMA 1V7VA 3E6UA 3QT3A 3W7SA 4DOEA 3WUXA 4DODA 2FV1A 3RX7A 1KWFA 2RI9A 1NC5A 4CE7A 3H3KA 3W7XA 1DOGA 3AFJA 1XW2A 1WU4A 3QPFA 5DGQA 1NXCA 3QG0A 2OKXA 1H14A 2DRSA 3QT9A 1AGMA 2JG0A 3RENA 2Z07A 2EAEA 2EACA 1V5CA 1XWTA 3EZ8A 3GZKA 4KTRA 1KFGA 4KTPA 4Z4JA 1G87A 3S4BA 1H12A 2DROA 1UT9A 3ANJA 3QFYA 3RRSA 1L1YA 3S4CA 1FAEA 2XFGA 3QRYA 4TXTA 2JJBA 1H54A 2A8ZA 3H7LA 1JS4A 3WKGA 3ACSA 5M7IA 2FV0A 3P2CA 3GLYA 3WKFA 1V5DA 1K72A 3GT5A 3ON6A 3QWTA 1KRFA 3QDEA 3RX5A 1GA2A 3W5NA 2NVPA 1FBOA 1FO3A 3S4DA 4CJ1A 1FMIA 2FUZA 4ZH5A 1F9DA 3WIQA 1IS9A 3QSPA 2AFAA 1CLCA 4L6XA 2CQSA 2DRRA 3EQAA 5CD2A 1IA7A 3W7UA 3VXDA 4WU0A 4L0GA 4Q2BA 4J5TA 4TF4A 1GAIA 2F6DA 1G9GA 1FP3A 1TF4A 3ANKA 4XUVA 2GH4A 5E2JA 2FBAA 4WVCA 1FCEA 1FBWA 5GW7A 3WIWA 1F9OA 1UG9A 2YIKA 2B4FA 3TF4A 3D3IA 3WC3A 1XWQA 3WKHA 5MEHA 2RGKA 4ZG8A 4FUSA 4WVAA 1IA6A 2ZZRA 2D8LA 1GAHA 1H13A 4AYOA 1G6IA 4AYRA 1VD5A 1FO2A 3RX8A 4AYPA 2CQTA 4Z4LA 1GLMA 1WU5A 3QXFA 3W7WA 2RI8A 4EL8A 2VN4A 3VW5A 1V7XA 3X17A 3A3VA 3H2WA 3S4AA 4WVBA 4CJ0A 3W5MA 3W7TA 1WU6A 2EABA 2QNOA 2AHGA 1L2AA 3CIHA 2D5JA 4AYQA 1HCUA 2DRQA 1ULVA 3PMMA 5DGRA 1WZZA 4Q88A 3QXQA 2WYNA 3ANIA 1AYXA 1KKTA 2AHFA 2JF4A 1LF6A 4JJJA 5CZLA 3WKIA 5M7YA 1LF9A 3ACTA 1DL2A 2ZBLA 1G9JA 3QFZA 2P0VA 1KSCA 1KS8A 5CA3A 1X9DA 2GZ6A 1RQ5A 2EADA 3E73A 5KKBA 1KSDA 3K11A 1KREA 3T33A 3RSYA
chains in the Genus database with same CATH superfamily
1H36A 1O79A 5ILDA 4GTTB 3DSTB 4DOEA 1RWCA 4CE7A 3H3KA 1XW2A 5FOBB 5DGQA 1H14A 4KKIA 1J0NA 1TNOB 2Z07A 5FO9B 1GSZA 4L9PB 3GZKA 5GZKA 3K7XA 4MMHA 3S4BA 2ONGA 2DROA 1UT9A 1KZPB 1L1YA 1N24A 3QRYA 2WIIB 3SQCA 4OZVA 1JS4A 3M7BA 2ZISB 5M7IA 2XWJB 3WKFA 3ON6A 1OJMA 1KRFA 3EU5B 3RX5A 4GAXA 1FO3A 3N0GA 3S4DA 4CJ1A 1N7OA 4ZH5A 1F9DA 1W3YA 2WCOA 1W6KA 1LD7B 2CQSA 2DRRA 3PYAA 2H6IB 4WU0A 4L0GA 3E7JA 3KSLB 4ZRQA 1GAIA 2F6DA 1C82A 1FP3A 2FBAA 4WVCA 4YCRA 3WIWA 2PN5A 3DSSB 2YIKA 1TN7B 3WC3A 3WKHA 2RGKA 1HZFA 4FUSA 1IA6A 4F10A 2BRWA 1H13A 3PZ4B 4AYOA 1S64B 3M77A 4Z4LA 3SAEA 1TN6B 4D4AA 3M01A 5IKAA 1N4PB 1JCQB 3A3VA 3NNBA 3PZ2B 4WVBA 3W7TA 1L2AA 3CIHA 4AYQA 1W6JA 1X81B 1HXGA 4QT9A 2WDAA 2DRQA 1H35A 3S9VA 2H6GB 1WZZA 1O5MB 1N4SB 1GXMA 2F0YB 1QBQB 1GHQA 1LF6A 4JJJA 3WKIA 3D5SA 3ACTA 1DL2A 1LD8B 1HM2A 3PZ3B 4D4BA 1KSCA 5CA3A 5IK9A 3KSQB 2GZ6A 1KSDA 3T33A 3RSYA 3M7EA 2VN7A 2BRPA 4MU9A 3WIRA 3E6UA 3QT3A 4FXGB 3W7SA 4DODA 1H39A 1N95B 1N23A 1CB8A 1KWFA 1EGUA 2RI9A 3G4DA 3W7XA 3AFJA 4GTPB 1NXCA 1TN8B 2FUQA 1N22A 3OEDA 2JG0A 3N0FA 3P5PA 2EACA 4KTRA 1KFGA 3M02A 1MZCB 1G87A 3ANJA 1O6QA 4GTSB 3S4CA 1RWGA 2XFGA 2JJBA 1J0MA 5DHIA 1JCRB 3P2CA 1N1BA 2BB6A 3GT5A 4RNQA 1GA2A 2NVPA 1FBOA 1X1IA 2NOJA 3M75A 3WIQA 3QSPA 4L6XA 2V8KA 3W7UA 4MMIA 4OZWA 4Q2BA 4TF4A 1H3AA 3PYBA 4V1RA 4XUVA 2BBCA 5FO8B 5E2JA 1F9OA 3TF4A 5JMFA 3D3IA 1XWQA 4WVAA 2ZZRA 3E33B 3DSXB 1VD5A 2FUTA 3M76A 3EU8A 1SA4B 2BRVX 2B39A 3M71A 4LNBB 1N7NA 2V3PA 1WU6A 2AHGA 2D5JA 2Q1FA 2I07B 3Q79B 2WYNA 3ANIA 1AYXA 1HXCA 1LOHA 3SFXB 3M74A 1G9JA 5JMDA 3HXDB 1SQCA 4GTRB 1X9DA 3LZ9A 4GL3A 3Q7AB 3DRAB 1OJPA 1JCSB 4LIXA 1V7WA 2XWBB 3RJ3A 1O1RB 1CEMA 1H3CA 2R2LB 3Q7FB 5ILKA 3WUXA 3HXFB 2FV1A 3RX7A 1C3DA 2WY7A 3CU7A 2G0DA 1DOGA 3QPFA 1WU4A 3QG0A 3G4FA 2DRSA 2WINB 3QT9A 4MBGB 1AGMA 3PZ1B 5FO7B 3M00A 3RENA 2H6HB 1RWFA 1XWTA 4KTPA 4Z4JA 4OK2A 1H12A 3DPYB 4BOJA 3RRSA 3QFYA 3P5RA 1FAEA 2V3NA 4TXTA 1R76A 3HXBB 1N9AB 1NI1B 2FV0A 3HXEB 3GLYA 1GXOA 3VSNA 1K72A 4EHMB 3QWTA 1LXMA 3QDEA 4ZRPA 4FXKB 1N21A 1O6HA 1SA5B 4GTOB 1RW9A 1FMIA 1N4QB 2FUZA 2G02A 2IEJB 1IS9A 2BB5A 1RWHA 1CLCA 2E24A 2X03A 1LXKA 3EQAA 5CD2A 4GTQB 1TF4A 3KLSA 5GW7A 2BEDB 1UG9A 1RWAA 2B4FA 5IKHA 3NFVA 2GOXA 2H6FB 1FT2B 3AFLA 1GAHA 1O6RA 1G6IA 4AYRA 3OXUA 3M73A 1TNZB 2PMVA 1HMUA 1HM3A 1S63B 3QXFA 2RI8A 4EL8A 2VN4A 3G6JB 3E34B 1I8QA 3H2WA 3S4AA 4CJ0A 5ILHA 2QNOA 5ILJA 4OK4A 4D4DA 4NEIA 4YDOB 3PMMA 2V8IA 5IK6A 5DGRA 1OJNA 1O1TB 1N20A 3DSVB 3SDVA 1QSJA 1UMPA 2AHFA 2JF4A 2ZIRB 3SDTA 3SDQA 5ILYA 3QFZA 3KQ4A 2E22A 5DHKA 3EUVB 1RQ5A 5KKBA 1NL4B 5ILIA 5EATA 3E32B 2XQWA 1D8DB 1FT1B 5GY3A 2V8JA 1V7VA 5IK0A 5IL3A 1O1SB 4DI5A 1NC5A 1D8EB 1QQFA 2OKXA 4GTVB 4GTMB 4ONTA 1HN0A 3Q73B 2EAEA 1V5CA 3EZ8A 4V1SA 1KZOB 4M76A 5AGDA 4FJQA 1N7QA 3D5RA 5IL8A 1H54A 5EASA 2A8ZA 3H7LA 3Q75B 3M7CA 1N1ZA 4YDEB 3WKGA 1H37A 3ACSA 5EAUA 3A0OA 1V5DA 3DSUB 5JPMB 2SQCA 1X1JA 5ILZA 3W5NA 2A73B 3DSWB 2AFAA 4C1SA 4D4CA 3E30B 5IM1A 1HV6A 1HX9A 1IA7A 1H3BA 3VXDA 1N94B 4J5TA 1G9GA 4FNVA 3ANKA 3E37B 2GH4A 1FCEA 1FBWA 4LNVA 3M7LA 3M78A 1F1SA 1DCEB 1F9GA 5MEHA 4ZG8A 2D8LA 1N7RA 3C72B 1N7PA 4KKJA 1FO2A 3RX8A 4AYPA 2CQTA 1GLMA 1WU5A 3M72A 5C05A 4F13A 4E1YA 3W7WA 3SDUA 1LTXB 3Q78B 1QAZA 4OJZA 3VW5A 1V7XA 3X17A 1HXAA 3W5MA 2EABA 1TNUB 3VSMA 1HCUA 1ULVA 2ONHA 1X1HA 3E80A 1TNYB 3SDRA 3SFYB 4Q88A 3QXQA 1HMWA 4ZH1A 2WY8A 1OJOA 1KKTA 5CZLA 5M7YA 4D94A 1LF9A 4BOKA 2ZBLA 1N4RB 2P0VA 1FPPB 1GXNA 1KS8A 5JPNB 1TNBB 3HXCB 2EADA 2J5CA 3E73A 3K11A 1KREA 4LNGB
chains in the Genus database with same CATH topology
1H36A 1O79A 4GTTB 3DSTB 4DOEA 4CE7A 3H3KA 1XW2A 5FOBB 5DGQA 1H14A 4KKIA 1TNOB 2Z07A 5FO9B 1GSZA 4L9PB 3GZKA 5GZKA 3K7XA 3S4BA 2DROA 1UT9A 1KZPB 1L1YA 3QRYA 2WIIB 3SQCA 1JS4A 3M7BA 2ZISB 5M7IA 2XWJB 3WKFA 3ON6A 1KRFA 3EU5B 3RX5A 1FO3A 3S4DA 4CJ1A 4ZH5A 1F9DA 1W6KA 1LD7B 2CQSA 2DRRA 3PYAA 2H6IB 4WU0A 4L0GA 3KSLB 4ZRQA 1GAIA 2F6DA 1FP3A 2FBAA 4WVCA 4YCRA 3WIWA 2PN5A 3DSSB 2YIKA 1TN7B 3WC3A 3WKHA 2RGKA 1HZFA 4FUSA 1IA6A 1H13A 3PZ4B 4AYOA 1S64B 3M77A 4Z4LA 3SAEA 1TN6B 4D4AA 1N4PB 1JCQB 3A3VA 3PZ2B 4WVBA 3W7TA 1L2AA 3CIHA 4AYQA 1W6JA 1X81B 4QT9A 2DRQA 1H35A 3S9VA 2H6GB 1WZZA 1O5MB 1N4SB 1GXMA 2F0YB 1QBQB 1GHQA 1LF6A 4JJJA 3WKIA 3D5SA 3ACTA 3PZ3B 1DL2A 1LD8B 4D4BA 1KSCA 5CA3A 3KSQB 2GZ6A 1KSDA 3T33A 3RSYA 3M7EA 2VN7A 4MU9A 3WIRA 3E6UA 3QT3A 4FXGB 3W7SA 4DODA 1H39A 1N95B 1KWFA 2RI9A 3W7XA 3AFJA 4GTPB 1NXCA 1TN8B 3OEDA 2JG0A 3P5PA 2EACA 4KTRA 1KFGA 1MZCB 1G87A 3ANJA 1O6QA 4GTSB 3S4CA 2XFGA 2JJBA 1JCRB 3P2CA 2BB6A 3GT5A 1GA2A 2NVPA 1FBOA 2NOJA 3M75A 3WIQA 3QSPA 4L6XA 2V8KA 3W7UA 4Q2BA 4TF4A 1H3AA 3PYBA 4V1RA 4XUVA 2BBCA 5FO8B 5E2JA 1F9OA 3TF4A 3D3IA 1XWQA 4WVAA 2ZZRA 3E33B 3DSXB 1VD5A 3M76A 3EU8A 1SA4B 2B39A 3M71A 4LNBB 2V3PA 1WU6A 2AHGA 2D5JA 2I07B 3Q79B 2WYNA 3ANIA 1AYXA 3SFXB 3M74A 1G9JA 3HXDB 1SQCA 4GTRB 1X9DA 4GL3A 3Q7AB 3DRAB 1JCSB 4LIXA 1V7WA 2XWBB 3RJ3A 1O1RB 1CEMA 1H3CA 2R2LB 3Q7FB 3WUXA 3HXFB 2FV1A 3RX7A 1C3DA 2WY7A 3CU7A 2G0DA 1DOGA 3QPFA 1WU4A 3QG0A 2DRSA 2WINB 3QT9A 4MBGB 1AGMA 3PZ1B 5FO7B 3RENA 2H6HB 4KTPA 1XWTA 4Z4JA 1H12A 3DPYB 4BOJA 3RRSA 3QFYA 3P5RA 1FAEA 2V3NA 4TXTA 1R76A 3HXBB 1N9AB 1NI1B 2FV0A 3HXEB 3GLYA 1GXOA 1K72A 4EHMB 3QWTA 3QDEA 4ZRPA 4FXKB 1O6HA 1SA5B 4GTOB 1FMIA 1N4QB 2FUZA 2G02A 2IEJB 1IS9A 2BB5A 1CLCA 3EQAA 5CD2A 4GTQB 1TF4A 3KLSA 5GW7A 2BEDB 1UG9A 2B4FA 2GOXA 2H6FB 1FT2B 1GAHA 1O6RA 1G6IA 4AYRA 3OXUA 3M73A 1TNZB 2PMVA 1S63B 3QXFA 2RI8A 4EL8A 2VN4A 3G6JB 3E34B 3H2WA 3S4AA 4CJ0A 2QNOA 4D4DA 4YDOB 3PMMA 2V8IA 5DGRA 1O1TB 3DSVB 3SDVA 1QSJA 1UMPA 2AHFA 2JF4A 2ZIRB 3SDTA 3SDQA 3QFZA 3KQ4A 3EUVB 1RQ5A 5KKBA 1NL4B 3E32B 2XQWA 1D8DB 1FT1B 5GY3A 2V8JA 1V7VA 1O1SB 1NC5A 1D8EB 1QQFA 2OKXA 4GTVB 4GTMB 4ONTA 3Q73B 2EAEA 1V5CA 3EZ8A 4V1SA 1KZOB 4M76A 5AGDA 3D5RA 1H54A 2A8ZA 3H7LA 3Q75B 3M7CA 3WKGA 4YDEB 1H37A 3ACSA 1V5DA 3DSUB 5JPMB 2SQCA 3W5NA 2A73B 3DSWB 2AFAA 4C1SA 4D4CA 3E30B 1IA7A 1H3BA 3VXDA 1N94B 4J5TA 1G9GA 3ANKA 3E37B 2GH4A 1FCEA 1FBWA 4LNVA 3M7LA 3M78A 1DCEB 5MEHA 4ZG8A 2D8LA 3C72B 4KKJA 1FO2A 3RX8A 4AYPA 2CQTA 1GLMA 1WU5A 3M72A 3W7WA 3SDUA 1LTXB 3Q78B 3VW5A 1V7XA 3X17A 3W5MA 2EABA 1TNUB 1HCUA 1ULVA 1TNYB 3SDRA 3SFYB 4Q88A 3QXQA 4ZH1A 2WY8A 1KKTA 5CZLA 5M7YA 4D94A 1LF9A 4BOKA 2ZBLA 1N4RB 2P0VA 1FPPB 1GXNA 1KS8A 5JPNB 1TNBB 3HXCB 2EADA 3E73A 3K11A 1KREA 4LNGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VN7 A;  1V7W A;  5GY3 A;  3WIR A;  1CEM A;  1V7V A;  3E6U A;  3QT3 A;  3W7S A;  4DOE A;  3WUX A;  4DOD A;  2FV1 A;  3RX7 A;  1KWF A;  2RI9 A;  1NC5 A;  4CE7 A;  3H3K A;  3W7X A;  1DOG A;  3AFJ A;  1XW2 A;  1WU4 A;  3QPF A;  5DGQ A;  1NXC A;  3QG0 A;  2OKX A;  1H14 A;  2DRS A;  3QT9 A;  1AGM A;  2JG0 A;  3REN A;  2Z07 A;  2EAE A;  2EAC A;  1V5C A;  1XWT A;  3EZ8 A;  3GZK A;  4KTR A;  1KFG A;  4KTP A;  4Z4J A;  1G87 A;  3S4B A;  1H12 A;  2DRO A;  1UT9 A;  3ANJ A;  3QFY A;  3RRS A;  1L1Y A;  3S4C A;  1FAE A;  2XFG A;  3QRY A;  4TXT A;  2JJB A;  1H54 A;  2A8Z A;  3H7L A;  1JS4 A;  3WKG A;  3ACS A;  5M7I A;  2FV0 A;  3P2C A;  3GLY A;  3WKF A;  1V5D A;  1K72 A;  3GT5 A;  3ON6 A;  3QWT A;  1KRF A;  3QDE A;  3RX5 A;  1GA2 A;  3W5N A;  2NVP A;  1FBO A;  1FO3 A;  3S4D A;  4CJ1 A;  1FMI A;  2FUZ A;  4ZH5 A;  1F9D A;  3WIQ A;  1IS9 A;  3QSP A;  2AFA A;  1CLC A;  4L6X A;  2CQS A;  2DRR A;  3EQA A;  5CD2 A;  1IA7 A;  3W7U A;  3VXD A;  4WU0 A;  4L0G A;  4Q2B A;  4J5T A;  4TF4 A;  1GAI A;  2F6D A;  1G9G A;  1FP3 A;  1TF4 A;  3ANK A;  4XUV A;  2GH4 A;  5E2J A;  2FBA A;  4WVC A;  1FCE A;  1FBW A;  5GW7 A;  3WIW A;  1F9O A;  1UG9 A;  2YIK A;  2B4F A;  3TF4 A;  3D3I A;  3WC3 A;  1XWQ A;  3WKH A;  5MEH A;  2RGK A;  4ZG8 A;  4FUS A;  4WVA A;  1IA6 A;  2ZZR A;  2D8L A;  1GAH A;  1H13 A;  4AYO A;  1G6I A;  4AYR A;  1VD5 A;  1FO2 A;  3RX8 A;  4AYP A;  2CQT A;  4Z4L A;  1GLM A;  1WU5 A;  3QXF A;  3W7W A;  2RI8 A;  4EL8 A;  2VN4 A;  3VW5 A;  1V7X A;  3X17 A;  3A3V A;  3H2W A;  3S4A A;  4WVB A;  4CJ0 A;  3W5M A;  3W7T A;  1WU6 A;  2EAB A;  2QNO A;  2AHG A;  1L2A A;  3CIH A;  2D5J A;  4AYQ A;  1HCU A;  2DRQ A;  1ULV A;  3PMM A;  5DGR A;  1WZZ A;  4Q88 A;  3QXQ A;  2WYN A;  3ANI A;  1AYX A;  1KKT A;  2AHF A;  2JF4 A;  1LF6 A;  4JJJ A;  5CZL A;  3WKI A;  5M7Y A;  1LF9 A;  3ACT A;  1DL2 A;  2ZBL A;  1G9J A;  3QFZ A;  2P0V A;  1KSC A;  1KS8 A;  5CA3 A;  1X9D A;  2GZ6 A;  1RQ5 A;  2EAD A;  3E73 A;  5KKB A;  1KSD A;  3K11 A;  1KRE A;  3T33 A;  3RSY A; 
#chains in the Genus database with same CATH topology
 1H36 A;  1O79 A;  5ILD A;  4GTT B;  3DST B;  4DOE A;  1RWC A;  4CE7 A;  3H3K A;  1XW2 A;  5FOB B;  5DGQ A;  1H14 A;  4KKI A;  1J0N A;  1TNO B;  2Z07 A;  5FO9 B;  1GSZ A;  4L9P B;  3GZK A;  5GZK A;  3K7X A;  4MMH A;  3S4B A;  2ONG A;  2DRO A;  1UT9 A;  1KZP B;  1L1Y A;  1N24 A;  3QRY A;  2WII B;  3SQC A;  4OZV A;  1JS4 A;  3M7B A;  2ZIS B;  5M7I A;  2XWJ B;  3WKF A;  3ON6 A;  1OJM A;  1KRF A;  3EU5 B;  3RX5 A;  4GAX A;  1FO3 A;  3N0G A;  3S4D A;  4CJ1 A;  1N7O A;  4ZH5 A;  1F9D A;  1W3Y A;  2WCO A;  1W6K A;  1LD7 B;  2CQS A;  2DRR A;  3PYA A;  2H6I B;  4WU0 A;  4L0G A;  3E7J A;  3KSL B;  4ZRQ A;  1GAI A;  2F6D A;  1C82 A;  1FP3 A;  2FBA A;  4WVC A;  4YCR A;  3WIW A;  2PN5 A;  3DSS B;  2YIK A;  1TN7 B;  3WC3 A;  3WKH A;  2RGK A;  1HZF A;  4FUS A;  1IA6 A;  4F10 A;  2BRW A;  1H13 A;  3PZ4 B;  4AYO A;  1S64 B;  3M77 A;  4Z4L A;  3SAE A;  1TN6 B;  4D4A A;  3M01 A;  5IKA A;  1N4P B;  1JCQ B;  3A3V A;  3NNB A;  3PZ2 B;  4WVB A;  3W7T A;  1L2A A;  3CIH A;  4AYQ A;  1W6J A;  1X81 B;  1HXG A;  4QT9 A;  2WDA A;  2DRQ A;  1H35 A;  3S9V A;  2H6G B;  1WZZ A;  1O5M B;  1N4S B;  1GXM A;  2F0Y B;  1QBQ B;  1GHQ A;  1LF6 A;  4JJJ A;  3WKI A;  3D5S A;  3ACT A;  1DL2 A;  1LD8 B;  1HM2 A;  3PZ3 B;  4D4B A;  1KSC A;  5CA3 A;  5IK9 A;  3KSQ B;  2GZ6 A;  1KSD A;  3T33 A;  3RSY A;  3M7E A;  2VN7 A;  2BRP A;  4MU9 A;  3WIR A;  3E6U A;  3QT3 A;  4FXG B;  3W7S A;  4DOD A;  1H39 A;  1N95 B;  1N23 A;  1CB8 A;  1KWF A;  1EGU A;  2RI9 A;  3G4D A;  3W7X A;  3AFJ A;  4GTP B;  1NXC A;  1TN8 B;  2FUQ A;  1N22 A;  3OED A;  2JG0 A;  3N0F A;  3P5P A;  2EAC A;  4KTR A;  1KFG A;  3M02 A;  1MZC B;  1G87 A;  3ANJ A;  1O6Q A;  4GTS B;  3S4C A;  1RWG A;  2XFG A;  2JJB A;  1J0M A;  5DHI A;  1JCR B;  3P2C A;  1N1B A;  2BB6 A;  3GT5 A;  4RNQ A;  1GA2 A;  2NVP A;  1FBO A;  1X1I A;  2NOJ A;  3M75 A;  3WIQ A;  3QSP A;  4L6X A;  2V8K A;  3W7U A;  4MMI A;  4OZW A;  4Q2B A;  4TF4 A;  1H3A A;  3PYB A;  4V1R A;  4XUV A;  2BBC A;  5FO8 B;  5E2J A;  1F9O A;  3TF4 A;  5JMF A;  3D3I A;  1XWQ A;  4WVA A;  2ZZR A;  3E33 B;  3DSX B;  1VD5 A;  2FUT A;  3M76 A;  3EU8 A;  1SA4 B;  2BRV X;  2B39 A;  3M71 A;  4LNB B;  1N7N A;  2V3P A;  1WU6 A;  2AHG A;  2D5J A;  2Q1F A;  2I07 B;  3Q79 B;  2WYN A;  3ANI A;  1AYX A;  1HXC A;  1LOH A;  3SFX B;  3M74 A;  1G9J A;  5JMD A;  3HXD B;  1SQC A;  4GTR B;  1X9D A;  3LZ9 A;  4GL3 A;  3Q7A B;  3DRA B;  1OJP A;  1JCS B;  4LIX A;  1V7W A;  2XWB B;  3RJ3 A;  1O1R B;  1CEM A;  1H3C A;  2R2L B;  3Q7F B;  5ILK A;  3WUX A;  3HXF B;  2FV1 A;  3RX7 A;  1C3D A;  2WY7 A;  3CU7 A;  2G0D A;  1DOG A;  3QPF A;  1WU4 A;  3QG0 A;  3G4F A;  2DRS A;  2WIN B;  3QT9 A;  4MBG B;  1AGM A;  3PZ1 B;  5FO7 B;  3M00 A;  3REN A;  2H6H B;  1RWF A;  1XWT A;  4KTP A;  4Z4J A;  4OK2 A;  1H12 A;  3DPY B;  4BOJ A;  3RRS A;  3QFY A;  3P5R A;  1FAE A;  2V3N A;  4TXT A;  1R76 A;  3HXB B;  1N9A B;  1NI1 B;  2FV0 A;  3HXE B;  3GLY A;  1GXO A;  3VSN A;  1K72 A;  4EHM B;  3QWT A;  1LXM A;  3QDE A;  4ZRP A;  4FXK B;  1N21 A;  1O6H A;  1SA5 B;  4GTO B;  1RW9 A;  1FMI A;  1N4Q B;  2FUZ A;  2G02 A;  2IEJ B;  1IS9 A;  2BB5 A;  1RWH A;  1CLC A;  2E24 A;  2X03 A;  1LXK A;  3EQA A;  5CD2 A;  4GTQ B;  1TF4 A;  3KLS A;  5GW7 A;  2BED B;  1UG9 A;  1RWA A;  2B4F A;  5IKH A;  3NFV A;  2GOX A;  2H6F B;  1FT2 B;  3AFL A;  1GAH A;  1O6R A;  1G6I A;  4AYR A;  3OXU A;  3M73 A;  1TNZ B;  2PMV A;  1HMU A;  1HM3 A;  1S63 B;  3QXF A;  2RI8 A;  4EL8 A;  2VN4 A;  3G6J B;  3E34 B;  1I8Q A;  3H2W A;  3S4A A;  4CJ0 A;  5ILH A;  2QNO A;  5ILJ A;  4OK4 A;  4D4D A;  4NEI A;  4YDO B;  3PMM A;  2V8I A;  5IK6 A;  5DGR A;  1OJN A;  1O1T B;  1N20 A;  3DSV B;  3SDV A;  1QSJ A;  1UMP A;  2AHF A;  2JF4 A;  2ZIR B;  3SDT A;  3SDQ A;  5ILY A;  3QFZ A;  3KQ4 A;  2E22 A;  5DHK A;  3EUV B;  1RQ5 A;  5KKB A;  1NL4 B;  5ILI A;  5EAT A;  3E32 B;  2XQW A;  1D8D B;  1FT1 B;  5GY3 A;  2V8J A;  1V7V A;  5IK0 A;  5IL3 A;  1O1S B;  4DI5 A;  1NC5 A;  1D8E B;  1QQF A;  2OKX A;  4GTV B;  4GTM B;  4ONT A;  1HN0 A;  3Q73 B;  2EAE A;  1V5C A;  3EZ8 A;  4V1S A;  1KZO B;  4M76 A;  5AGD A;  4FJQ A;  1N7Q A;  3D5R A;  5IL8 A;  1H54 A;  5EAS A;  2A8Z A;  3H7L A;  3Q75 B;  3M7C A;  1N1Z A;  4YDE B;  3WKG A;  1H37 A;  3ACS A;  5EAU A;  3A0O A;  1V5D A;  3DSU B;  5JPM B;  2SQC A;  1X1J A;  5ILZ A;  3W5N A;  2A73 B;  3DSW B;  2AFA A;  4C1S A;  4D4C A;  3E30 B;  5IM1 A;  1HV6 A;  1HX9 A;  1IA7 A;  1H3B A;  3VXD A;  1N94 B;  4J5T A;  1G9G A;  4FNV A;  3ANK A;  3E37 B;  2GH4 A;  1FCE A;  1FBW A;  4LNV A;  3M7L A;  3M78 A;  1F1S A;  1DCE B;  1F9G A;  5MEH A;  4ZG8 A;  2D8L A;  1N7R A;  3C72 B;  1N7P A;  4KKJ A;  1FO2 A;  3RX8 A;  4AYP A;  2CQT A;  1GLM A;  1WU5 A;  3M72 A;  5C05 A;  4F13 A;  4E1Y A;  3W7W A;  3SDU A;  1LTX B;  3Q78 B;  1QAZ A;  4OJZ A;  3VW5 A;  1V7X A;  3X17 A;  1HXA A;  3W5M A;  2EAB A;  1TNU B;  3VSM A;  1HCU A;  1ULV A;  2ONH A;  1X1H A;  3E80 A;  1TNY B;  3SDR A;  3SFY B;  4Q88 A;  3QXQ A;  1HMW A;  4ZH1 A;  2WY8 A;  1OJO A;  1KKT A;  5CZL A;  5M7Y A;  4D94 A;  1LF9 A;  4BOK A;  2ZBL A;  1N4R B;  2P0V A;  1FPP B;  1GXN A;  1KS8 A;  5JPN B;  1TNB B;  3HXC B;  2EAD A;  2J5C A;  3E73 A;  3K11 A;  1KRE A;  4LNG B; 
#chains in the Genus database with same CATH homology
 1H36 A;  1O79 A;  4GTT B;  3DST B;  4DOE A;  4CE7 A;  3H3K A;  1XW2 A;  5FOB B;  5DGQ A;  1H14 A;  4KKI A;  1TNO B;  2Z07 A;  5FO9 B;  1GSZ A;  4L9P B;  3GZK A;  5GZK A;  3K7X A;  3S4B A;  2DRO A;  1UT9 A;  1KZP B;  1L1Y A;  3QRY A;  2WII B;  3SQC A;  1JS4 A;  3M7B A;  2ZIS B;  5M7I A;  2XWJ B;  3WKF A;  3ON6 A;  1KRF A;  3EU5 B;  3RX5 A;  1FO3 A;  3S4D A;  4CJ1 A;  4ZH5 A;  1F9D A;  1W6K A;  1LD7 B;  2CQS A;  2DRR A;  3PYA A;  2H6I B;  4WU0 A;  4L0G A;  3KSL B;  4ZRQ A;  1GAI A;  2F6D A;  1FP3 A;  2FBA A;  4WVC A;  4YCR A;  3WIW A;  2PN5 A;  3DSS B;  2YIK A;  1TN7 B;  3WC3 A;  3WKH A;  2RGK A;  1HZF A;  4FUS A;  1IA6 A;  1H13 A;  3PZ4 B;  4AYO A;  1S64 B;  3M77 A;  4Z4L A;  3SAE A;  1TN6 B;  4D4A A;  1N4P B;  1JCQ B;  3A3V A;  3PZ2 B;  4WVB A;  3W7T A;  1L2A A;  3CIH A;  4AYQ A;  1W6J A;  1X81 B;  4QT9 A;  2DRQ A;  1H35 A;  3S9V A;  2H6G B;  1WZZ A;  1O5M B;  1N4S B;  1GXM A;  2F0Y B;  1QBQ B;  1GHQ A;  1LF6 A;  4JJJ A;  3WKI A;  3D5S A;  3ACT A;  3PZ3 B;  1DL2 A;  1LD8 B;  4D4B A;  1KSC A;  5CA3 A;  3KSQ B;  2GZ6 A;  1KSD A;  3T33 A;  3RSY A;  3M7E A;  2VN7 A;  4MU9 A;  3WIR A;  3E6U A;  3QT3 A;  4FXG B;  3W7S A;  4DOD A;  1H39 A;  1N95 B;  1KWF A;  2RI9 A;  3W7X A;  3AFJ A;  4GTP B;  1NXC A;  1TN8 B;  3OED A;  2JG0 A;  3P5P A;  2EAC A;  4KTR A;  1KFG A;  1MZC B;  1G87 A;  3ANJ A;  1O6Q A;  4GTS B;  3S4C A;  2XFG A;  2JJB A;  1JCR B;  3P2C A;  2BB6 A;  3GT5 A;  1GA2 A;  2NVP A;  1FBO A;  2NOJ A;  3M75 A;  3WIQ A;  3QSP A;  4L6X A;  2V8K A;  3W7U A;  4Q2B A;  4TF4 A;  1H3A A;  3PYB A;  4V1R A;  4XUV A;  2BBC A;  5FO8 B;  5E2J A;  1F9O A;  3TF4 A;  3D3I A;  1XWQ A;  4WVA A;  2ZZR A;  3E33 B;  3DSX B;  1VD5 A;  3M76 A;  3EU8 A;  1SA4 B;  2B39 A;  3M71 A;  4LNB B;  2V3P A;  1WU6 A;  2AHG A;  2D5J A;  2I07 B;  3Q79 B;  2WYN A;  3ANI A;  1AYX A;  3SFX B;  3M74 A;  1G9J A;  3HXD B;  1SQC A;  4GTR B;  1X9D A;  4GL3 A;  3Q7A B;  3DRA B;  1JCS B;  4LIX A;  1V7W A;  2XWB B;  3RJ3 A;  1O1R B;  1CEM A;  1H3C A;  2R2L B;  3Q7F B;  3WUX A;  3HXF B;  2FV1 A;  3RX7 A;  1C3D A;  2WY7 A;  3CU7 A;  2G0D A;  1DOG A;  3QPF A;  1WU4 A;  3QG0 A;  2DRS A;  2WIN B;  3QT9 A;  4MBG B;  1AGM A;  3PZ1 B;  5FO7 B;  3REN A;  2H6H B;  4KTP A;  1XWT A;  4Z4J A;  1H12 A;  3DPY B;  4BOJ A;  3RRS A;  3QFY A;  3P5R A;  1FAE A;  2V3N A;  4TXT A;  1R76 A;  3HXB B;  1N9A B;  1NI1 B;  2FV0 A;  3HXE B;  3GLY A;  1GXO A;  1K72 A;  4EHM B;  3QWT A;  3QDE A;  4ZRP A;  4FXK B;  1O6H A;  1SA5 B;  4GTO B;  1FMI A;  1N4Q B;  2FUZ A;  2G02 A;  2IEJ B;  1IS9 A;  2BB5 A;  1CLC A;  3EQA A;  5CD2 A;  4GTQ B;  1TF4 A;  3KLS A;  5GW7 A;  2BED B;  1UG9 A;  2B4F A;  2GOX A;  2H6F B;  1FT2 B;  1GAH A;  1O6R A;  1G6I A;  4AYR A;  3OXU A;  3M73 A;  1TNZ B;  2PMV A;  1S63 B;  3QXF A;  2RI8 A;  4EL8 A;  2VN4 A;  3G6J B;  3E34 B;  3H2W A;  3S4A A;  4CJ0 A;  2QNO A;  4D4D A;  4YDO B;  3PMM A;  2V8I A;  5DGR A;  1O1T B;  3DSV B;  3SDV A;  1QSJ A;  1UMP A;  2AHF A;  2JF4 A;  2ZIR B;  3SDT A;  3SDQ A;  3QFZ A;  3KQ4 A;  3EUV B;  1RQ5 A;  5KKB A;  1NL4 B;  3E32 B;  2XQW A;  1D8D B;  1FT1 B;  5GY3 A;  2V8J A;  1V7V A;  1O1S B;  1NC5 A;  1D8E B;  1QQF A;  2OKX A;  4GTV B;  4GTM B;  4ONT A;  3Q73 B;  2EAE A;  1V5C A;  3EZ8 A;  4V1S A;  1KZO B;  4M76 A;  5AGD A;  3D5R A;  1H54 A;  2A8Z A;  3H7L A;  3Q75 B;  3M7C A;  3WKG A;  4YDE B;  1H37 A;  3ACS A;  1V5D A;  3DSU B;  5JPM B;  2SQC A;  3W5N A;  2A73 B;  3DSW B;  2AFA A;  4C1S A;  4D4C A;  3E30 B;  1IA7 A;  1H3B A;  3VXD A;  1N94 B;  4J5T A;  1G9G A;  3ANK A;  3E37 B;  2GH4 A;  1FCE A;  1FBW A;  4LNV A;  3M7L A;  3M78 A;  1DCE B;  5MEH A;  4ZG8 A;  2D8L A;  3C72 B;  4KKJ A;  1FO2 A;  3RX8 A;  4AYP A;  2CQT A;  1GLM A;  1WU5 A;  3M72 A;  3W7W A;  3SDU A;  1LTX B;  3Q78 B;  3VW5 A;  1V7X A;  3X17 A;  3W5M A;  2EAB A;  1TNU B;  1HCU A;  1ULV A;  1TNY B;  3SDR A;  3SFY B;  4Q88 A;  3QXQ A;  4ZH1 A;  2WY8 A;  1KKT A;  5CZL A;  5M7Y A;  4D94 A;  1LF9 A;  4BOK A;  2ZBL A;  1N4R B;  2P0V A;  1FPP B;  1GXN A;  1KS8 A;  5JPN B;  1TNB B;  3HXC B;  2EAD A;  3E73 A;  3K11 A;  1KRE A;  4LNG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...