3E73A

Crystal structure of human lancl1 complexed with gsh
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
405
structure length
405
Chain Sequence
SMDIEFMAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LanC-like protein 1
publication title Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
pubmed doi rcsb
source organism Homo sapiens
total genus 143
structure length 405
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05147 LANC_like Lanthionine synthetase C-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3e73A00
1VD5A 1G6IA 5M7YA 3A3VA 2AFAA 4Q2BA 3ANJA 3PMMA 1RQ5A 4L0GA 1X9DA 4WVCA 5KKBA 2OKXA 3ANIA 1KKTA 2AHFA 2GZ6A 3QT9A 2EAEA 3WIWA 4EL8A 3VW5A 5DGQA 1GAIA 3H2WA 1FO3A 3E6UA 3W7TA 1NXCA 3P2CA 1V7XA 1GA2A 1XW2A 2DROA 2EADA 3S4AA 1H54A 4CJ1A 1IS9A 1DL2A 5DGRA 2RI8A 3QWTA 1NC5A 2VN4A 1JS4A 3RX8A 3W5NA 4FUSA 4XUVA 5E2JA 1GLMA 5CD2A 2NVPA 1WU5A 4Q88A 1CEMA 1FP3A 1FAEA 4ZH5A 1V5CA 1KWFA 1FO2A 1WU4A 4Z4JA 2FV1A 2P0VA 4JJJA 5CA3A 3WC3A 1TF4A 1H13A 3WKIA 4TXTA 1IA6A 1IA7A 3K11A 3WKFA 4AYOA 1F9DA 1AGMA 1CLCA 1V5DA 3QG0A 5GW7A 1KFGA 3QXQA 2RI9A 3RX7A 3WIQA 5M7IA 3H7LA 1DOGA 3WIRA 4KTRA 2CQTA 3T33A 2CQSA 1ULVA 2YIKA 1HCUA 3QSPA 1LF6A 3EQAA 2AHGA 1FBOA 3W7SA 2WYNA 3GT5A 2FUZA 1KS8A 3QT3A 4AYPA 1AYXA 2Z07A 1FBWA 1WU6A 2A8ZA 3EZ8A 3E73A 4WVAA 3RX5A 1F9OA 3AFJA 1KSCA 2EABA 3RENA 2B4FA 3TF4A 4Z4LA 1V7WA 1G9JA 1KRFA 1LF9A 4KTPA 4CE7A 2F6DA 4CJ0A 3W7XA 2RGKA 2D8LA 1FCEA 4ZG8A 1UG9A 3H3KA 3X17A 2JG0A 2DRSA 2JF4A 3QFYA 3QXFA 1L1YA 3QFZA 2QNOA 1UT9A 1GAHA 2JJBA 3GZKA 4WU0A 3W7WA 2FBAA 3WKGA 3W5MA 1G87A 1WZZA 4TF4A 2ZZRA 3ON6A 2VN7A 3QDEA 3W7UA 2FV0A 1H12A 3CIHA 4AYQA 2D5JA 3WUXA 1L2AA 1H14A 2ZBLA 3QPFA 2XFGA 1KSDA 1XWQA 2EACA 2GH4A 4J5TA 3D3IA 5CZLA 3ACTA 3S4CA 1KREA 4DODA 4WVBA 3RRSA 1V7VA 1XWTA 3S4DA 3RSYA 1FMIA 4DOEA 4L6XA 3GLYA 2DRRA 3ANKA 3S4BA 4AYRA 3VXDA 3ACSA 5GY3A 3QRYA 2DRQA 1G9GA 5MEHA 1K72A 3WKHA
chains in the Genus database with same CATH superfamily
5DHKA 1LD8B 1G6IA 3DSWB 4GAXA 4OK4A 1RQ5A 3G4DA 2F0YB 4LNVA 4D4CA 1TNBB 5KKBA 2SQCA 1X1JA 2WY8A 3M02A 2AHFA 1HZFA 2ZISB 2EAEA 4MMHA 2BRPA 1TN7B 1GAIA 2BRWA 1O79A 3PYAA 1KZOB 4V1SA 2XWBB 1H3BA 3S4AA 1QAZA 4D4DA 1IS9A 4CJ1A 1O6RA 3E30B 1GXNA 1HX9A 5E2JA 1X1IA 2A73B 4Q88A 1RWHA 3SDRA 4D94A 1CEMA 3Q7AB 1FAEA 2WDAA 4ZH5A 1NL4B 4Z4JA 2ZIRB 5JPNB 3DSVB 3M7BA 1TF4A 2NOJA 5IM1A 5FO8B 3Q7FB 3WIQA 5EAUA 3WIRA 2CQTA 3KQ4A 2CQSA 2I07B 1ULVA 1W3YA 3K7XA 1QBQB 1OJOA 4E1YA 1FBOA 3SFXB 3W7SA 1HXCA 4AYPA 1LTXB 1AYXA 4OZVA 1QSJA 1FBWA 1X81B 2A8ZA 1N7NA 4WVAA 3DSXB 2B4FA 1TN6B 1H3CA 2E24A 2B39A 5ILYA 3SQCA 4CE7A 3W7XA 1N4PB 4MMIA 2BB5A 2XQWA 2BB6A 1L1YA 5EATA 5JPMB 1UMPA 2BBCA 5FO9B 1UT9A 1GAHA 1N20A 1S64B 3N0GA 3GZKA 3W7WA 4YCRA 5ILJA 3E7JA 4EHMB 4TF4A 4RNQA 3QDEA 2FV0A 1H12A 3CIHA 4AYQA 1J0NA 4MBGB 1L2AA 2G0DA 4GL3A 5IL3A 5ILHA 1KSDA 1TNOB 1XWQA 4J5TA 5CZLA 4WVBA 3RRSA 3S4DA 1TNUB 3P5RA 4FXKB 1N4QB 3ANKA 1GSZA 4AYRA 3VXDA 1O6QA 4M76A 5DHIA 1K72A 4OK2A 3M75A 3WKHA 1H36A 1VD5A 5C05A 1HMWA 2AFAA 3A3VA 4GTQB 4OJZA 3C72B 2WIIB 3PMMA 4WVCA 3HXEB 4GTVB 4V1RA 2OKXA 3QT9A 3PZ1B 3WIWA 5IK6A 3VW5A 5DGQA 1NXCA 1F9GA 1V7XA 2EADA 3A0OA 1H54A 3EUVB 1LOHA 1HMUA 4C1SA 1NC5A 1JCSB 1JS4A 5CD2A 2NVPA 1N7RA 1C3DA 2BRVX 1D8EB 2X03A 4YDOB 1HM3A 1V5CA 1F1SA 1KWFA 1N4SB 1WU4A 2WINB 1O6HA 3WC3A 3HXCB 2H6IB 4TXTA 1IA6A 1IA7A 3K11A 1F9DA 1O1SB 1AGMA 1V5DA 3QG0A 5GW7A 1DCEB 2BEDB 1N22A 2RI9A 3QXQA 3Q73B 4BOKA 1DOGA 1LXKA 2V8KA 3T33A 1HCUA 5EASA 5IKAA 2FUZA 4MU9A 1S63B 4ZRPA 5IK0A 1N94B 1F9OA 3M73A 1G9JA 1KRFA 5JMFA 3E34B 2F6DA 3PZ4B 2D8LA 1N1ZA 4F13A 1RW9A 1RWGA 1EGUA 1UG9A 2JF4A 3QXFA 4F10A 3QFZA 2FBAA 4LNBB 2H6FB 4OZWA 3E32B 2PN5A 1N7QA 3ON6A 5GZKA 4GTSB 1N7OA 3D5SA 3E37B 3HXFB 1FPPB 3SDTA 1N21A 1JCQB 3D3IA 3S4CA 1W6KA 1JCRB 3GLYA 1H37A 3ACSA 3G6JB 1RWCA 3NFVA 2IEJB 4Q2BA 2Q1FA 5ILZA 3EU5B 1H39A 5AGDA 4L0GA 2G02A 3ANIA 1KKTA 1C82A 4FJQA 5ILDA 1HV6A 3H2WA 1FO3A 1HXAA 3SDVA 3M71A 3M72A 1MZCB 1O5MB 3SAEA 5DGRA 2RI8A 3QWTA 4NEIA 1I8QA 1X1HA 4KKIA 1N7PA 4GTMB 4LIXA 1FT1B 2FUQA 3M78A 1H3AA 1FO2A 3Q79B 1CB8A 2FV1A 5FO7B 2PMVA 4JJJA 3WKIA 3WKFA 3G4FA 2XWJB 5M7IA 1FT2B 1RWAA 1LF6A 3EQAA 1KZPB 4LNGB 4FNVA 4BOJA 2AHGA 4GTRB 3M7EA 4D4AA 3GT5A 4GTPB 1N95B 1WU6A 3DSSB 1H35A 1RWFA 3EZ8A 3RX5A 3N0FA 1KSCA 2EABA 3RENA 3TF4A 4Z4LA 1V7WA 3CU7A 3S9VA 1OJNA 3NNBA 2RGKA 1GHQA 3LZ9A 1FCEA 3H3KA 3X17A 3M7CA 4L9PB 2QNOA 1TNYB 2JJBA 3OEDA 2V3NA 3WKGA 1G87A 2E22A 2ZZRA 3DPYB 1HN0A 3W7UA 5JMDA 2D5JA 2WCOA 3PYBA 1D8DB 3WUXA 4GTOB 1H14A 2ZBLA 3QPFA 5IL8A 1R76A 2EACA 2GH4A 4DODA 1KREA 1SQCA 3Q75B 1GXOA 3RSYA 4D4BA 4QT9A 4DOEA 1N24A 2DRRA 3S4BA 1HXGA 3QRYA 3HXDB 3E33B 3M74A 3PZ3B 3VSNA 1OJMA 4ZRQA 5M7YA 3ANJA 4DI5A 2FUTA 1SA5B 1X9DA 3SDQA 1J0MA 2GZ6A 3DSUB 1N23A 4EL8A 3KSQB 2H6GB 3E6UA 2V3PA 5FOBB 3VSMA 3W7TA 3P2CA 1LD7B 1GA2A 1XW2A 2DROA 3P5PA 3DRAB 1DL2A 3RX8A 2VN4A 3W5NA 1O1RB 4FUSA 4XUVA 1GLMA 2ONGA 3M00A 1WU5A 1FP3A 1HM2A 1W6JA 3KSLB 2WY7A 3M76A 2J5CA 2P0VA 5CA3A 4ONTA 1H13A 4AYOA 2ONHA 1CLCA 1KFGA 3RX7A 2GOXA 3H7LA 3RJ3A 3M01A 4GTTB 4KTRA 2YIKA 3QSPA 1SA4B 2WYNA 3QT3A 1KS8A 2Z07A 5ILIA 1OJPA 1NI1B 3DSTB 3E73A 1LXMA 3SFYB 3AFJA 1LF9A 4KTPA 4CJ0A 5IKHA 2V8IA 4ZG8A 4KKJA 2JG0A 2DRSA 3QFYA 3PZ2B 4WU0A 4FXGB 1O1TB 3KLSA 4YDEB 1WZZA 3W5MA 2R2LB 3AFLA 2VN7A 1TNZB 1N1BA 3M7LA 1GXMA 3HXBB 3SDUA 5IK9A 1N4RB 2V8JA 3M77A 4ZH1A 2XFGA 2H6HB 3E80A 3ACTA 1V7VA 1QQFA 1TN8B 1XWTA 1FMIA 4L6XA 3OXUA 3D5RA 1N9AB 5GY3A 2DRQA 1G9GA 5MEHA 3EU8A 3Q78B 5ILKA
chains in the Genus database with same CATH topology
1LD8B 1G6IA 3DSWB 1RQ5A 2F0YB 4LNVA 4D4CA 1TNBB 5KKBA 2SQCA 2WY8A 2AHFA 1HZFA 2ZISB 2EAEA 1TN7B 1GAIA 1O79A 3PYAA 1KZOB 4V1SA 2XWBB 1H3BA 3S4AA 4D4DA 1IS9A 4CJ1A 1O6RA 3E30B 1GXNA 5E2JA 2A73B 4Q88A 3SDRA 4D94A 1CEMA 3Q7AB 1FAEA 4ZH5A 1NL4B 4Z4JA 2ZIRB 5JPNB 3DSVB 3M7BA 1TF4A 2NOJA 5FO8B 3Q7FB 3WIQA 3WIRA 2CQTA 3KQ4A 2CQSA 2I07B 1ULVA 3K7XA 1QBQB 1FBOA 3SFXB 3W7SA 4AYPA 1LTXB 1AYXA 1QSJA 1FBWA 1X81B 2A8ZA 4WVAA 3DSXB 2B4FA 1TN6B 1H3CA 2B39A 3SQCA 4CE7A 3W7XA 1N4PB 2BB5A 2XQWA 2BB6A 1L1YA 5JPMB 1UMPA 2BBCA 5FO9B 1UT9A 1GAHA 1S64B 3GZKA 3W7WA 4YCRA 4EHMB 4TF4A 3QDEA 2FV0A 1H12A 3CIHA 4AYQA 4MBGB 1L2AA 2G0DA 4GL3A 1KSDA 1TNOB 1XWQA 4J5TA 5CZLA 4WVBA 3RRSA 3S4DA 1TNUB 3P5RA 4FXKB 1N4QB 3ANKA 1GSZA 4AYRA 3VXDA 1O6QA 4M76A 1K72A 3M75A 3WKHA 1H36A 1VD5A 3A3VA 2AFAA 4GTQB 3C72B 2WIIB 3PMMA 4WVCA 3HXEB 4GTVB 4V1RA 2OKXA 3QT9A 3PZ1B 3WIWA 3VW5A 5DGQA 1NXCA 1V7XA 2EADA 1H54A 3EUVB 4C1SA 1NC5A 1JCSB 1JS4A 5CD2A 2NVPA 1C3DA 1D8EB 4YDOB 2WINB 1V5CA 1KWFA 1N4SB 1WU4A 1O6HA 3WC3A 3HXCB 2H6IB 4TXTA 1IA6A 1IA7A 3K11A 1F9DA 1O1SB 1AGMA 1V5DA 3QG0A 5GW7A 1DCEB 3QXQA 2BEDB 2RI9A 3Q73B 4BOKA 1DOGA 3T33A 2V8KA 1HCUA 2FUZA 4MU9A 1S63B 4ZRPA 1N94B 1F9OA 3M73A 1G9JA 1KRFA 3E34B 2F6DA 3PZ4B 2D8LA 1UG9A 2JF4A 3QXFA 3QFZA 2FBAA 4LNBB 2H6FB 3E32B 2PN5A 3ON6A 5GZKA 4GTSB 3D5SA 3E37B 3HXFB 1FPPB 3SDTA 1JCQB 3D3IA 3S4CA 1W6KA 1JCRB 3GLYA 1H37A 3ACSA 3G6JB 2IEJB 4Q2BA 3EU5B 1H39A 5AGDA 4L0GA 2G02A 3ANIA 1KKTA 3H2WA 1FO3A 3SDVA 3M71A 3M72A 1MZCB 1O5MB 3SAEA 5DGRA 2RI8A 3QWTA 4KKIA 4GTMB 4LIXA 1FT1B 3M78A 1H3AA 1FO2A 3Q79B 2FV1A 5FO7B 2PMVA 4JJJA 3WKIA 3WKFA 2XWJB 5M7IA 1FT2B 1LF6A 3EQAA 1KZPB 4LNGB 4BOJA 2AHGA 4GTRB 3M7EA 4D4AA 3GT5A 4GTPB 1N95B 1WU6A 3DSSB 1H35A 3EZ8A 3RX5A 1KSCA 2EABA 3RENA 3TF4A 4Z4LA 1V7WA 3CU7A 3S9VA 2RGKA 1GHQA 1FCEA 3H3KA 3X17A 3M7CA 4L9PB 2QNOA 1TNYB 2JJBA 3OEDA 2V3NA 3WKGA 1G87A 2ZZRA 3DPYB 3W7UA 2D5JA 3WUXA 3PYBA 1D8DB 4GTOB 1H14A 2ZBLA 3QPFA 1R76A 2EACA 2GH4A 4DODA 1KREA 1SQCA 3Q75B 1GXOA 3RSYA 4D4BA 4QT9A 4DOEA 2DRRA 3S4BA 3QRYA 3HXDB 3E33B 3M74A 3PZ3B 4ZRQA 5M7YA 3ANJA 1SA5B 1X9DA 3SDQA 2GZ6A 3DSUB 4EL8A 3KSQB 2H6GB 3E6UA 2V3PA 5FOBB 3W7TA 3P2CA 1LD7B 1GA2A 1XW2A 2DROA 3P5PA 3DRAB 1DL2A 3RX8A 2VN4A 3W5NA 1O1RB 4FUSA 4XUVA 1GLMA 1WU5A 1FP3A 1W6JA 3KSLB 2WY7A 3M76A 2P0VA 5CA3A 4ONTA 1H13A 4AYOA 1CLCA 1KFGA 3RX7A 2GOXA 3H7LA 3RJ3A 4GTTB 4KTRA 2YIKA 3QSPA 1SA4B 2WYNA 3QT3A 1KS8A 2Z07A 1NI1B 3DSTB 3E73A 3SFYB 3AFJA 1LF9A 4KTPA 4CJ0A 2V8IA 4ZG8A 4KKJA 2JG0A 2DRSA 3QFYA 3PZ2B 4WU0A 4FXGB 1O1TB 3KLSA 4YDEB 1WZZA 3W5MA 2R2LB 2VN7A 1TNZB 3M7LA 1GXMA 3HXBB 3SDUA 1N4RB 2V8JA 3M77A 4ZH1A 2XFGA 2H6HB 3ACTA 1V7VA 1QQFA 1TN8B 1XWTA 1FMIA 4L6XA 3OXUA 3D5RA 1N9AB 5GY3A 2DRQA 1G9GA 5MEHA 3EU8A 3Q78B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VD5 A;  1G6I A;  5M7Y A;  3A3V A;  2AFA A;  4Q2B A;  3ANJ A;  3PMM A;  1RQ5 A;  4L0G A;  1X9D A;  4WVC A;  5KKB A;  2OKX A;  3ANI A;  1KKT A;  2AHF A;  2GZ6 A;  3QT9 A;  2EAE A;  3WIW A;  4EL8 A;  3VW5 A;  5DGQ A;  1GAI A;  3H2W A;  1FO3 A;  3E6U A;  3W7T A;  1NXC A;  3P2C A;  1V7X A;  1GA2 A;  1XW2 A;  2DRO A;  2EAD A;  3S4A A;  1H54 A;  4CJ1 A;  1IS9 A;  1DL2 A;  5DGR A;  2RI8 A;  3QWT A;  1NC5 A;  2VN4 A;  1JS4 A;  3RX8 A;  3W5N A;  4FUS A;  4XUV A;  5E2J A;  1GLM A;  5CD2 A;  2NVP A;  1WU5 A;  4Q88 A;  1CEM A;  1FP3 A;  1FAE A;  4ZH5 A;  1V5C A;  1KWF A;  1FO2 A;  1WU4 A;  4Z4J A;  2FV1 A;  2P0V A;  4JJJ A;  5CA3 A;  3WC3 A;  1TF4 A;  1H13 A;  3WKI A;  4TXT A;  1IA6 A;  1IA7 A;  3K11 A;  3WKF A;  4AYO A;  1F9D A;  1AGM A;  1CLC A;  1V5D A;  3QG0 A;  5GW7 A;  1KFG A;  3QXQ A;  2RI9 A;  3RX7 A;  3WIQ A;  5M7I A;  3H7L A;  1DOG A;  3WIR A;  4KTR A;  2CQT A;  3T33 A;  2CQS A;  1ULV A;  2YIK A;  1HCU A;  3QSP A;  1LF6 A;  3EQA A;  2AHG A;  1FBO A;  3W7S A;  2WYN A;  3GT5 A;  2FUZ A;  1KS8 A;  3QT3 A;  4AYP A;  1AYX A;  2Z07 A;  1FBW A;  1WU6 A;  2A8Z A;  3EZ8 A;  3E73 A;  4WVA A;  3RX5 A;  1F9O A;  3AFJ A;  1KSC A;  2EAB A;  3REN A;  2B4F A;  3TF4 A;  4Z4L A;  1V7W A;  1G9J A;  1KRF A;  1LF9 A;  4KTP A;  4CE7 A;  2F6D A;  4CJ0 A;  3W7X A;  2RGK A;  2D8L A;  1FCE A;  4ZG8 A;  1UG9 A;  3H3K A;  3X17 A;  2JG0 A;  2DRS A;  2JF4 A;  3QFY A;  3QXF A;  1L1Y A;  3QFZ A;  2QNO A;  1UT9 A;  1GAH A;  2JJB A;  3GZK A;  4WU0 A;  3W7W A;  2FBA A;  3WKG A;  3W5M A;  1G87 A;  1WZZ A;  4TF4 A;  2ZZR A;  3ON6 A;  2VN7 A;  3QDE A;  3W7U A;  2FV0 A;  1H12 A;  3CIH A;  4AYQ A;  2D5J A;  3WUX A;  1L2A A;  1H14 A;  2ZBL A;  3QPF A;  2XFG A;  1KSD A;  1XWQ A;  2EAC A;  2GH4 A;  4J5T A;  3D3I A;  5CZL A;  3ACT A;  3S4C A;  1KRE A;  4DOD A;  4WVB A;  3RRS A;  1V7V A;  1XWT A;  3S4D A;  3RSY A;  1FMI A;  4DOE A;  4L6X A;  3GLY A;  2DRR A;  3ANK A;  3S4B A;  4AYR A;  3VXD A;  3ACS A;  5GY3 A;  3QRY A;  2DRQ A;  1G9G A;  5MEH A;  1K72 A;  3WKH A; 
#chains in the Genus database with same CATH topology
 5DHK A;  1LD8 B;  1G6I A;  3DSW B;  4GAX A;  4OK4 A;  1RQ5 A;  3G4D A;  2F0Y B;  4LNV A;  4D4C A;  1TNB B;  5KKB A;  2SQC A;  1X1J A;  2WY8 A;  3M02 A;  2AHF A;  1HZF A;  2ZIS B;  2EAE A;  4MMH A;  2BRP A;  1TN7 B;  1GAI A;  2BRW A;  1O79 A;  3PYA A;  1KZO B;  4V1S A;  2XWB B;  1H3B A;  3S4A A;  1QAZ A;  4D4D A;  1IS9 A;  4CJ1 A;  1O6R A;  3E30 B;  1GXN A;  1HX9 A;  5E2J A;  1X1I A;  2A73 B;  4Q88 A;  1RWH A;  3SDR A;  4D94 A;  1CEM A;  3Q7A B;  1FAE A;  2WDA A;  4ZH5 A;  1NL4 B;  4Z4J A;  2ZIR B;  5JPN B;  3DSV B;  3M7B A;  1TF4 A;  2NOJ A;  5IM1 A;  5FO8 B;  3Q7F B;  3WIQ A;  5EAU A;  3WIR A;  2CQT A;  3KQ4 A;  2CQS A;  2I07 B;  1ULV A;  1W3Y A;  3K7X A;  1QBQ B;  1OJO A;  4E1Y A;  1FBO A;  3SFX B;  3W7S A;  1HXC A;  4AYP A;  1LTX B;  1AYX A;  4OZV A;  1QSJ A;  1FBW A;  1X81 B;  2A8Z A;  1N7N A;  4WVA A;  3DSX B;  2B4F A;  1TN6 B;  1H3C A;  2E24 A;  2B39 A;  5ILY A;  3SQC A;  4CE7 A;  3W7X A;  1N4P B;  4MMI A;  2BB5 A;  2XQW A;  2BB6 A;  1L1Y A;  5EAT A;  5JPM B;  1UMP A;  2BBC A;  5FO9 B;  1UT9 A;  1GAH A;  1N20 A;  1S64 B;  3N0G A;  3GZK A;  3W7W A;  4YCR A;  5ILJ A;  3E7J A;  4EHM B;  4TF4 A;  4RNQ A;  3QDE A;  2FV0 A;  1H12 A;  3CIH A;  4AYQ A;  1J0N A;  4MBG B;  1L2A A;  2G0D A;  4GL3 A;  5IL3 A;  5ILH A;  1KSD A;  1TNO B;  1XWQ A;  4J5T A;  5CZL A;  4WVB A;  3RRS A;  3S4D A;  1TNU B;  3P5R A;  4FXK B;  1N4Q B;  3ANK A;  1GSZ A;  4AYR A;  3VXD A;  1O6Q A;  4M76 A;  5DHI A;  1K72 A;  4OK2 A;  3M75 A;  3WKH A;  1H36 A;  1VD5 A;  5C05 A;  1HMW A;  2AFA A;  3A3V A;  4GTQ B;  4OJZ A;  3C72 B;  2WII B;  3PMM A;  4WVC A;  3HXE B;  4GTV B;  4V1R A;  2OKX A;  3QT9 A;  3PZ1 B;  3WIW A;  5IK6 A;  3VW5 A;  5DGQ A;  1NXC A;  1F9G A;  1V7X A;  2EAD A;  3A0O A;  1H54 A;  3EUV B;  1LOH A;  1HMU A;  4C1S A;  1NC5 A;  1JCS B;  1JS4 A;  5CD2 A;  2NVP A;  1N7R A;  1C3D A;  2BRV X;  1D8E B;  2X03 A;  4YDO B;  1HM3 A;  1V5C A;  1F1S A;  1KWF A;  1N4S B;  1WU4 A;  2WIN B;  1O6H A;  3WC3 A;  3HXC B;  2H6I B;  4TXT A;  1IA6 A;  1IA7 A;  3K11 A;  1F9D A;  1O1S B;  1AGM A;  1V5D A;  3QG0 A;  5GW7 A;  1DCE B;  2BED B;  1N22 A;  2RI9 A;  3QXQ A;  3Q73 B;  4BOK A;  1DOG A;  1LXK A;  2V8K A;  3T33 A;  1HCU A;  5EAS A;  5IKA A;  2FUZ A;  4MU9 A;  1S63 B;  4ZRP A;  5IK0 A;  1N94 B;  1F9O A;  3M73 A;  1G9J A;  1KRF A;  5JMF A;  3E34 B;  2F6D A;  3PZ4 B;  2D8L A;  1N1Z A;  4F13 A;  1RW9 A;  1RWG A;  1EGU A;  1UG9 A;  2JF4 A;  3QXF A;  4F10 A;  3QFZ A;  2FBA A;  4LNB B;  2H6F B;  4OZW A;  3E32 B;  2PN5 A;  1N7Q A;  3ON6 A;  5GZK A;  4GTS B;  1N7O A;  3D5S A;  3E37 B;  3HXF B;  1FPP B;  3SDT A;  1N21 A;  1JCQ B;  3D3I A;  3S4C A;  1W6K A;  1JCR B;  3GLY A;  1H37 A;  3ACS A;  3G6J B;  1RWC A;  3NFV A;  2IEJ B;  4Q2B A;  2Q1F A;  5ILZ A;  3EU5 B;  1H39 A;  5AGD A;  4L0G A;  2G02 A;  3ANI A;  1KKT A;  1C82 A;  4FJQ A;  5ILD A;  1HV6 A;  3H2W A;  1FO3 A;  1HXA A;  3SDV A;  3M71 A;  3M72 A;  1MZC B;  1O5M B;  3SAE A;  5DGR A;  2RI8 A;  3QWT A;  4NEI A;  1I8Q A;  1X1H A;  4KKI A;  1N7P A;  4GTM B;  4LIX A;  1FT1 B;  2FUQ A;  3M78 A;  1H3A A;  1FO2 A;  3Q79 B;  1CB8 A;  2FV1 A;  5FO7 B;  2PMV A;  4JJJ A;  3WKI A;  3WKF A;  3G4F A;  2XWJ B;  5M7I A;  1FT2 B;  1RWA A;  1LF6 A;  3EQA A;  1KZP B;  4LNG B;  4FNV A;  4BOJ A;  2AHG A;  4GTR B;  3M7E A;  4D4A A;  3GT5 A;  4GTP B;  1N95 B;  1WU6 A;  3DSS B;  1H35 A;  1RWF A;  3EZ8 A;  3RX5 A;  3N0F A;  1KSC A;  2EAB A;  3REN A;  3TF4 A;  4Z4L A;  1V7W A;  3CU7 A;  3S9V A;  1OJN A;  3NNB A;  2RGK A;  1GHQ A;  3LZ9 A;  1FCE A;  3H3K A;  3X17 A;  3M7C A;  4L9P B;  2QNO A;  1TNY B;  2JJB A;  3OED A;  2V3N A;  3WKG A;  1G87 A;  2E22 A;  2ZZR A;  3DPY B;  1HN0 A;  3W7U A;  5JMD A;  2D5J A;  2WCO A;  3PYB A;  1D8D B;  3WUX A;  4GTO B;  1H14 A;  2ZBL A;  3QPF A;  5IL8 A;  1R76 A;  2EAC A;  2GH4 A;  4DOD A;  1KRE A;  1SQC A;  3Q75 B;  1GXO A;  3RSY A;  4D4B A;  4QT9 A;  4DOE A;  1N24 A;  2DRR A;  3S4B A;  1HXG A;  3QRY A;  3HXD B;  3E33 B;  3M74 A;  3PZ3 B;  3VSN A;  1OJM A;  4ZRQ A;  5M7Y A;  3ANJ A;  4DI5 A;  2FUT A;  1SA5 B;  1X9D A;  3SDQ A;  1J0M A;  2GZ6 A;  3DSU B;  1N23 A;  4EL8 A;  3KSQ B;  2H6G B;  3E6U A;  2V3P A;  5FOB B;  3VSM A;  3W7T A;  3P2C A;  1LD7 B;  1GA2 A;  1XW2 A;  2DRO A;  3P5P A;  3DRA B;  1DL2 A;  3RX8 A;  2VN4 A;  3W5N A;  1O1R B;  4FUS A;  4XUV A;  1GLM A;  2ONG A;  3M00 A;  1WU5 A;  1FP3 A;  1HM2 A;  1W6J A;  3KSL B;  2WY7 A;  3M76 A;  2J5C A;  2P0V A;  5CA3 A;  4ONT A;  1H13 A;  4AYO A;  2ONH A;  1CLC A;  1KFG A;  3RX7 A;  2GOX A;  3H7L A;  3RJ3 A;  3M01 A;  4GTT B;  4KTR A;  2YIK A;  3QSP A;  1SA4 B;  2WYN A;  3QT3 A;  1KS8 A;  2Z07 A;  5ILI A;  1OJP A;  1NI1 B;  3DST B;  3E73 A;  1LXM A;  3SFY B;  3AFJ A;  1LF9 A;  4KTP A;  4CJ0 A;  5IKH A;  2V8I A;  4ZG8 A;  4KKJ A;  2JG0 A;  2DRS A;  3QFY A;  3PZ2 B;  4WU0 A;  4FXG B;  1O1T B;  3KLS A;  4YDE B;  1WZZ A;  3W5M A;  2R2L B;  3AFL A;  2VN7 A;  1TNZ B;  1N1B A;  3M7L A;  1GXM A;  3HXB B;  3SDU A;  5IK9 A;  1N4R B;  2V8J A;  3M77 A;  4ZH1 A;  2XFG A;  2H6H B;  3E80 A;  3ACT A;  1V7V A;  1QQF A;  1TN8 B;  1XWT A;  1FMI A;  4L6X A;  3OXU A;  3D5R A;  1N9A B;  5GY3 A;  2DRQ A;  1G9G A;  5MEH A;  3EU8 A;  3Q78 B;  5ILK A; 
#chains in the Genus database with same CATH homology
 1LD8 B;  1G6I A;  3DSW B;  1RQ5 A;  2F0Y B;  4LNV A;  4D4C A;  1TNB B;  5KKB A;  2SQC A;  2WY8 A;  2AHF A;  1HZF A;  2ZIS B;  2EAE A;  1TN7 B;  1GAI A;  1O79 A;  3PYA A;  1KZO B;  4V1S A;  2XWB B;  1H3B A;  3S4A A;  4D4D A;  1IS9 A;  4CJ1 A;  1O6R A;  3E30 B;  1GXN A;  5E2J A;  2A73 B;  4Q88 A;  3SDR A;  4D94 A;  1CEM A;  3Q7A B;  1FAE A;  4ZH5 A;  1NL4 B;  4Z4J A;  2ZIR B;  5JPN B;  3DSV B;  3M7B A;  1TF4 A;  2NOJ A;  5FO8 B;  3Q7F B;  3WIQ A;  3WIR A;  2CQT A;  3KQ4 A;  2CQS A;  2I07 B;  1ULV A;  3K7X A;  1QBQ B;  1FBO A;  3SFX B;  3W7S A;  4AYP A;  1LTX B;  1AYX A;  1QSJ A;  1FBW A;  1X81 B;  2A8Z A;  4WVA A;  3DSX B;  2B4F A;  1TN6 B;  1H3C A;  2B39 A;  3SQC A;  4CE7 A;  3W7X A;  1N4P B;  2BB5 A;  2XQW A;  2BB6 A;  1L1Y A;  5JPM B;  1UMP A;  2BBC A;  5FO9 B;  1UT9 A;  1GAH A;  1S64 B;  3GZK A;  3W7W A;  4YCR A;  4EHM B;  4TF4 A;  3QDE A;  2FV0 A;  1H12 A;  3CIH A;  4AYQ A;  4MBG B;  1L2A A;  2G0D A;  4GL3 A;  1KSD A;  1TNO B;  1XWQ A;  4J5T A;  5CZL A;  4WVB A;  3RRS A;  3S4D A;  1TNU B;  3P5R A;  4FXK B;  1N4Q B;  3ANK A;  1GSZ A;  4AYR A;  3VXD A;  1O6Q A;  4M76 A;  1K72 A;  3M75 A;  3WKH A;  1H36 A;  1VD5 A;  3A3V A;  2AFA A;  4GTQ B;  3C72 B;  2WII B;  3PMM A;  4WVC A;  3HXE B;  4GTV B;  4V1R A;  2OKX A;  3QT9 A;  3PZ1 B;  3WIW A;  3VW5 A;  5DGQ A;  1NXC A;  1V7X A;  2EAD A;  1H54 A;  3EUV B;  4C1S A;  1NC5 A;  1JCS B;  1JS4 A;  5CD2 A;  2NVP A;  1C3D A;  1D8E B;  4YDO B;  2WIN B;  1V5C A;  1KWF A;  1N4S B;  1WU4 A;  1O6H A;  3WC3 A;  3HXC B;  2H6I B;  4TXT A;  1IA6 A;  1IA7 A;  3K11 A;  1F9D A;  1O1S B;  1AGM A;  1V5D A;  3QG0 A;  5GW7 A;  1DCE B;  3QXQ A;  2BED B;  2RI9 A;  3Q73 B;  4BOK A;  1DOG A;  3T33 A;  2V8K A;  1HCU A;  2FUZ A;  4MU9 A;  1S63 B;  4ZRP A;  1N94 B;  1F9O A;  3M73 A;  1G9J A;  1KRF A;  3E34 B;  2F6D A;  3PZ4 B;  2D8L A;  1UG9 A;  2JF4 A;  3QXF A;  3QFZ A;  2FBA A;  4LNB B;  2H6F B;  3E32 B;  2PN5 A;  3ON6 A;  5GZK A;  4GTS B;  3D5S A;  3E37 B;  3HXF B;  1FPP B;  3SDT A;  1JCQ B;  3D3I A;  3S4C A;  1W6K A;  1JCR B;  3GLY A;  1H37 A;  3ACS A;  3G6J B;  2IEJ B;  4Q2B A;  3EU5 B;  1H39 A;  5AGD A;  4L0G A;  2G02 A;  3ANI A;  1KKT A;  3H2W A;  1FO3 A;  3SDV A;  3M71 A;  3M72 A;  1MZC B;  1O5M B;  3SAE A;  5DGR A;  2RI8 A;  3QWT A;  4KKI A;  4GTM B;  4LIX A;  1FT1 B;  3M78 A;  1H3A A;  1FO2 A;  3Q79 B;  2FV1 A;  5FO7 B;  2PMV A;  4JJJ A;  3WKI A;  3WKF A;  2XWJ B;  5M7I A;  1FT2 B;  1LF6 A;  3EQA A;  1KZP B;  4LNG B;  4BOJ A;  2AHG A;  4GTR B;  3M7E A;  4D4A A;  3GT5 A;  4GTP B;  1N95 B;  1WU6 A;  3DSS B;  1H35 A;  3EZ8 A;  3RX5 A;  1KSC A;  2EAB A;  3REN A;  3TF4 A;  4Z4L A;  1V7W A;  3CU7 A;  3S9V A;  2RGK A;  1GHQ A;  1FCE A;  3H3K A;  3X17 A;  3M7C A;  4L9P B;  2QNO A;  1TNY B;  2JJB A;  3OED A;  2V3N A;  3WKG A;  1G87 A;  2ZZR A;  3DPY B;  3W7U A;  2D5J A;  3WUX A;  3PYB A;  1D8D B;  4GTO B;  1H14 A;  2ZBL A;  3QPF A;  1R76 A;  2EAC A;  2GH4 A;  4DOD A;  1KRE A;  1SQC A;  3Q75 B;  1GXO A;  3RSY A;  4D4B A;  4QT9 A;  4DOE A;  2DRR A;  3S4B A;  3QRY A;  3HXD B;  3E33 B;  3M74 A;  3PZ3 B;  4ZRQ A;  5M7Y A;  3ANJ A;  1SA5 B;  1X9D A;  3SDQ A;  2GZ6 A;  3DSU B;  4EL8 A;  3KSQ B;  2H6G B;  3E6U A;  2V3P A;  5FOB B;  3W7T A;  3P2C A;  1LD7 B;  1GA2 A;  1XW2 A;  2DRO A;  3P5P A;  3DRA B;  1DL2 A;  3RX8 A;  2VN4 A;  3W5N A;  1O1R B;  4FUS A;  4XUV A;  1GLM A;  1WU5 A;  1FP3 A;  1W6J A;  3KSL B;  2WY7 A;  3M76 A;  2P0V A;  5CA3 A;  4ONT A;  1H13 A;  4AYO A;  1CLC A;  1KFG A;  3RX7 A;  2GOX A;  3H7L A;  3RJ3 A;  4GTT B;  4KTR A;  2YIK A;  3QSP A;  1SA4 B;  2WYN A;  3QT3 A;  1KS8 A;  2Z07 A;  1NI1 B;  3DST B;  3E73 A;  3SFY B;  3AFJ A;  1LF9 A;  4KTP A;  4CJ0 A;  2V8I A;  4ZG8 A;  4KKJ A;  2JG0 A;  2DRS A;  3QFY A;  3PZ2 B;  4WU0 A;  4FXG B;  1O1T B;  3KLS A;  4YDE B;  1WZZ A;  3W5M A;  2R2L B;  2VN7 A;  1TNZ B;  3M7L A;  1GXM A;  3HXB B;  3SDU A;  1N4R B;  2V8J A;  3M77 A;  4ZH1 A;  2XFG A;  2H6H B;  3ACT A;  1V7V A;  1QQF A;  1TN8 B;  1XWT A;  1FMI A;  4L6X A;  3OXU A;  3D5R A;  1N9A B;  5GY3 A;  2DRQ A;  1G9G A;  5MEH A;  3EU8 A;  3Q78 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...