3E73A

Crystal structure of human lancl1 complexed with gsh
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
405
structure length
405
Chain Sequence
SMDIEFMAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LanC-like protein 1
publication title Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 143
structure length 405
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05147 LANC_like Lanthionine synthetase C-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3e73A00
3QG0A 3A3VA 5DGQA 4CE7A 3S4DA 2YIKA 1NXCA 1V7XA 1ULVA 3RX8A 5DGRA 3GZKA 3PMMA 1IA6A 3VW5A 3W5NA 3QT9A 2DRQA 3AFJA 3WIRA 1VD5A 1L1YA 3ON6A 1XWTA 1V5DA 4WVAA 1DOGA 1KRFA 1NC5A 5M7YA 1KWFA 2A8ZA 3WIQA 4J5TA 1AGMA 1WU6A 3W7WA 2FUZA 1KSCA 1DL2A 1V7VA 3QFZA 1KFGA 1GAHA 4Z4LA 3W5MA 2JJBA 1KREA 3P2CA 1H13A 4TF4A 2JF4A 2EABA 1FCEA 2FBAA 2RI9A 1V5CA 2AHGA 3D3IA 5E2JA 4AYQA 1HCUA 2F6DA 4KTRA 1G87A 4TXTA 1FBOA 3T33A 3ANKA 1LF9A 1WZZA 2EACA 4WVCA 1L2AA 1XWQA 3QXFA 1KKTA 4EL8A 2AHFA 4FUSA 3RX7A 5CA3A 2D8LA 1UG9A 2DRSA 5GY3A 3S4BA 3WKIA 2CQSA 1X9DA 1RQ5A 4Q2BA 3E6UA 2ZBLA 1F9DA 3H3KA 1H12A 5GW7A 1FO3A 1FBWA 3QSPA 3S4AA 3WKHA 3W7UA 3H7LA 4L0GA 1K72A 1KSDA 1FAEA 1KS8A 2D5JA 3RSYA 1FP3A 1WU4A 3W7XA 2JG0A 2FV0A 3RRSA 3QFYA 2B4FA 2QNOA 3VXDA 1FO2A 1V7WA 3QXQA 1IS9A 3EZ8A 4CJ0A 4AYRA 3QRYA 3WKGA 4KTPA 1LF6A 4CJ1A 2DRRA 2CQTA 2RGKA 1FMIA 3QWTA 4XUVA 1JS4A 2EAEA 4DOEA 2AFAA 2Z07A 5CZLA 1AYXA 1H14A 4AYPA 1G9JA 1IA7A 4L6XA 3ANIA 2OKXA 3WKFA 4ZG8A 2GH4A 2EADA 3X17A 5MEHA 3QPFA 3W7TA 3ANJA 4WU0A 5KKBA 3ACTA 3WC3A 3E73A 2VN7A 3GT5A 4ZH5A 2NVPA 1CLCA 2GZ6A 3K11A 3ACSA 4Q88A 1GLMA 2VN4A 5CD2A 2WYNA 3RX5A 4WVBA 1UT9A 4DODA 1GAIA 3TF4A 1F9OA 3WUXA 3GLYA 2FV1A 1G6IA 3QDEA 1WU5A 3RENA 3QT3A 3W7SA 5M7IA 4JJJA 4Z4JA 2P0VA 3S4CA 1H54A 3EQAA 3WIWA 1GA2A 3CIHA 2RI8A 4AYOA 1G9GA 2ZZRA 2DROA 1XW2A 3H2WA 1CEMA 1TF4A 2XFGA
chains in the Genus database with same CATH superfamily
3A3VA 4D94A 3DPYB 2YIKA 2WCOA 1N4SB 5FO8B 3G4FA 5ILYA 1J0NA 3PYAA 1IA6A 1LD8B 1O1SB 5IL3A 2H6IB 3WIRA 3M01A 4GTOB 4D4AA 1HMWA 1N1BA 1NC5A 1AGMA 3W7WA 1GXOA 1GSZA 2FUZA 1X1IA 1V7VA 5AGDA 1GAHA 1HM3A 1N7QA 1GXMA 1C82A 2JJBA 3P2CA 1H3AA 3EUVB 2JF4A 1FCEA 2FBAA 2RI9A 2F6DA 4V1SA 1RWAA 3VSMA 1FBOA 1HXAA 1QSJA 2IEJB 2Q1FA 4D4BA 1L2AA 1TNUB 1KKTA 2AHFA 2V8IA 1HV6A 1KZOB 2ZBLA 1N7OA 3HXCB 5DHKA 3NFVA 5GW7A 3QSPA 4KKJA 3W7UA 3H7LA 4QT9A 1S64B 1KSDA 1KS8A 1LXMA 1SQCA 2D5JA 2XWJB 3PZ4B 3RRSA 1H3BA 4D4CA 2FUTA 2QNOA 3VXDA 5ILIA 1HX9A 4FXKB 3QRYA 3WKGA 1H3CA 4LNVA 5DHIA 2AFAA 4GTTB 4AYPA 4L6XA 3ANIA 3WKFA 2PN5A 1N7RA 4MMIA 5MEHA 3W7TA 3ANJA 3ACTA 3WC3A 3K7XA 2VN7A 4ZH5A 2NVPA 2ONGA 4FNVA 1GLMA 5CD2A 3RX5A 1JCQB 5EASA 3DSUB 3NNBA 1N4PB 3QDEA 3SDVA 4RNQA 4Z4JA 2V8JA 4LNBB 2ZISB 1GA2A 4AYOA 2G02A 2DROA 5CZLA 3DSVB 2XFGA 5DGQA 3S4DA 4BOKA 1N23A 1V7XA 3DSXB 2BBCA 3RX8A 5ILKA 1R76A 1X1JA 4F13A 3SDUA 3QT9A 2DRQA 2XQWA 3AFJA 4YCRA 1L1YA 3ON6A 1V5DA 3Q78B 4WVAA 1DCEB 3S9VA 1N4QB 3E32B 1KWFA 3SAEA 1MZCB 3PYBA 1LXKA 1TN8B 1DL2A 4BOJA 1KFGA 3Q75B 3M78A 4Z4LA 3G6JB 4ZH1A 4L9PB 2ZIRB 1NI1B 4MU9A 4YDOB 1H13A 2V8KA 1V5CA 5FO7B 3D3IA 1SA4B 4TXTA 3E34B 2A73B 1N7PA 4V1RA 1TNBB 3T33A 1LF9A 1N95B 1F1SA 2H6GB 4WVCA 1HXCA 4C1SA 4EL8A 3D5SA 3S4BA 2CQSA 1N20A 1O6HA 1TNYB 2ONHA 3H3KA 1H12A 1FBWA 5C05A 1QBQB 3RSYA 4ZRQA 1FAEA 3E30B 2I07B 5ILHA 1FP3A 3W7XA 2FV0A 2G0DA 1UMPA 3QFYA 4M76A 1FO2A 2FUQA 1IS9A 4NEIA 3DSTB 4GTSB 4AYRA 1CB8A 2H6HB 3OEDA 1LF6A 2F0YB 1J0MA 3M02A 3N0FA 2EAEA 2Z07A 1IA7A 2OKXA 2EADA 4OK4A 3X17A 2E22A 4WU0A 3SDTA 1N22A 3DSWB 1D8DB 1OJNA 2BB5A 1UT9A 3TF4A 3SFYB 5ILDA 1F9OA 4GAXA 3WUXA 5JPNB 3RJ3A 1JCSB 1LTXB 3RENA 1HXGA 3QT3A 3W7SA 1N9AB 1GXNA 4GTRB 1RWHA 5IK6A 2P0VA 2WDAA 3EQAA 3CIHA 2RI8A 1G9GA 4GTVB 1XW2A 1CEMA 3G4DA 4CE7A 1NXCA 1ULVA 3PMMA 3PZ3B 3W5NA 3Q79B 1W3YA 1VD5A 1XWTA 2BEDB 1FT2B 2BRWA 5M7YA 1GHQA 4J5TA 1WU6A 5FOBB 3Q73B 4F10A 3M7EA 2V3PA 5EAUA 3DSSB 4OZWA 3Q7FB 1HMUA 1N1ZA 2EABA 3SDRA 2AHGA 2WINB 4AYQA 1HCUA 1RWGA 1RW9A 3E7JA 3ANKA 2BRVX 1JCRB 1RWCA 4OK2A 1N24A 1XWQA 3EU5B 1O79A 1N94B 3P5PA 4FUSA 5IL8A 2D8LA 5IK0A 2DRSA 4ZRPA 5GY3A 3HXDB 5IM1A 3M75A 1N7NA 4YDEB 3E6UA 1S63B 1N21A 3P5RA 1H39A 1H37A 4L0GA 2XWBB 5EATA 1N4RB 1D8EB 1O6RA 4EHMB 4KTPA 4GTQB 1X1HA 5JMDA 2RGKA 3QWTA 4XUVA 3VSNA 1JS4A 4DOEA 1HZFA 5FO9B 1AYXA 3AFLA 3M7BA 3C72B 2GH4A 3E80A 4ZG8A 3QPFA 5KKBA 4LNGB 3SQCA 3EU8A 3GT5A 2WY7A 1CLCA 2GZ6A 3K11A 3PZ2B 1KZPB 3PZ1B 2J5CA 2VN4A 2WYNA 3DRAB 1HM2A 4D4DA 3GLYA 2BB6A 2FV1A 1QQFA 3HXFB 1TN6B 1WU5A 1O5MB 1W6JA 5ILZA 3M73A 1TN7B 3S4CA 1C3DA 4E1YA 4DI5A 1SA5B 2ZZRA 1TF4A 3QG0A 1H35A 3M77A 2E24A 3M00A 5DGRA 3GZKA 1LD7B 3D5RA 4LIXA 5IKHA 1H36A 3VW5A 2R2LB 3E33B 5IKAA 3HXBB 1NL4B 3SFXB 1TNOB 1DOGA 1KRFA 4MBGB 3WIQA 2A8ZA 2PMVA 3M72A 3CU7A 1KSCA 1O1RB 2H6FB 2GOXA 3QFZA 1X81B 3N0GA 3SDQA 3KQ4A 3W5MA 1KREA 2BRPA 4TF4A 5E2JA 3M71A 1G87A 1FPPB 4KTRA 1EGUA 3KSLB 5GZKA 4OJZA 3M76A 2EACA 1WZZA 2V3NA 1W6KA 3KLSA 4MMHA 3QXFA 2SQCA 3M74A 4OZVA 3RX7A 4GL3A 5CA3A 1UG9A 3WKIA 1I8QA 1X9DA 1RQ5A 4Q2BA 1F9DA 3WKHA 1FO3A 2WY8A 3S4AA 3OXUA 1K72A 3E37B 1WU4A 2JG0A 1LOHA 2B4FA 1O1TB 4KKIA 1HN0A 1V7WA 3QXQA 4GTPB 3EZ8A 4CJ0A 2NOJA 1QAZA 4CJ1A 2DRRA 2CQTA 5IK9A 1FMIA 5JPMB 1OJPA 1RWFA 3A0OA 2X03A 1OJMA 4FXGB 1FT1B 1H14A 1G9JA 3Q7AB 4GTMB 3KSQB 3M7LA 3E73A 4FJQA 1TNZB 3LZ9A 1O6QA 3ACSA 4Q88A 4ONTA 4WVBA 4DODA 5JMFA 1GAIA 2B39A 5ILJA 1G6IA 1OJOA 3HXEB 1F9GA 5M7IA 4JJJA 2WIIB 1H54A 3WIWA 3M7CA 3H2WA
chains in the Genus database with same CATH topology
3A3VA 4D94A 3DPYB 2YIKA 1N4SB 5FO8B 3PYAA 1IA6A 1LD8B 1O1SB 2H6IB 3WIRA 4GTOB 4D4AA 1NC5A 1AGMA 3W7WA 1GXOA 1GSZA 2FUZA 1V7VA 5AGDA 1GAHA 1GXMA 2JJBA 3P2CA 1H3AA 3EUVB 2JF4A 1FCEA 2FBAA 2RI9A 2F6DA 4V1SA 1FBOA 1QSJA 2IEJB 4D4BA 1L2AA 1TNUB 1KKTA 2AHFA 2V8IA 1KZOB 2ZBLA 3HXCB 5GW7A 3QSPA 4KKJA 3W7UA 3H7LA 4QT9A 1S64B 1KSDA 1KS8A 1SQCA 2D5JA 2XWJB 3PZ4B 3RRSA 1H3BA 4D4CA 2QNOA 3VXDA 4FXKB 3QRYA 3WKGA 1H3CA 4LNVA 2AFAA 4GTTB 4AYPA 4L6XA 3ANIA 3WKFA 2PN5A 5MEHA 3W7TA 3ANJA 3ACTA 3WC3A 3K7XA 2VN7A 4ZH5A 2NVPA 1GLMA 5CD2A 3RX5A 1JCQB 3DSUB 1N4PB 3QDEA 3SDVA 4Z4JA 2V8JA 4LNBB 2ZISB 1GA2A 4AYOA 2G02A 2DROA 5CZLA 3DSVB 2XFGA 5DGQA 3S4DA 4BOKA 1V7XA 3DSXB 2BBCA 3RX8A 1R76A 3SDUA 3QT9A 2DRQA 2XQWA 3AFJA 4YCRA 1L1YA 3ON6A 1V5DA 3Q78B 4WVAA 1DCEB 3S9VA 1N4QB 3E32B 1KWFA 3SAEA 1MZCB 3PYBA 1TN8B 1DL2A 4BOJA 1KFGA 3Q75B 3M78A 4Z4LA 3G6JB 4ZH1A 4L9PB 2ZIRB 1NI1B 4MU9A 4YDOB 1H13A 2V8KA 1V5CA 5FO7B 3D3IA 1SA4B 4TXTA 3E34B 2A73B 4V1RA 1TNBB 3T33A 1LF9A 1N95B 2H6GB 4WVCA 4C1SA 4EL8A 3D5SA 3S4BA 2CQSA 1O6HA 1TNYB 3H3KA 1H12A 1FBWA 1QBQB 3RSYA 4ZRQA 1FAEA 3E30B 2I07B 1FP3A 3W7XA 2FV0A 2G0DA 1UMPA 3QFYA 4M76A 1FO2A 1IS9A 3DSTB 4GTSB 4AYRA 2H6HB 3OEDA 1LF6A 2F0YB 2EAEA 2Z07A 1IA7A 2OKXA 2EADA 3X17A 4WU0A 3SDTA 3DSWB 1D8DB 2BB5A 1UT9A 3TF4A 3SFYB 1F9OA 3WUXA 5JPNB 3RJ3A 1JCSB 1LTXB 3RENA 3QT3A 3W7SA 1N9AB 1GXNA 4GTRB 2P0VA 3EQAA 3CIHA 2RI8A 1G9GA 4GTVB 1XW2A 1CEMA 4CE7A 1NXCA 1ULVA 3PMMA 3PZ3B 3W5NA 3Q79B 1VD5A 1XWTA 2BEDB 1FT2B 5M7YA 1GHQA 4J5TA 1WU6A 5FOBB 3Q73B 3M7EA 2V3PA 3DSSB 3Q7FB 2EABA 3SDRA 2AHGA 2WINB 4AYQA 1HCUA 3ANKA 1JCRB 1XWQA 3EU5B 1O79A 1N94B 3P5PA 4FUSA 2D8LA 2DRSA 4ZRPA 5GY3A 3HXDB 3M75A 4YDEB 3E6UA 1S63B 3P5RA 1H39A 1H37A 4L0GA 2XWBB 1N4RB 1D8EB 1O6RA 4EHMB 4KTPA 4GTQB 2RGKA 3QWTA 4XUVA 1JS4A 4DOEA 1HZFA 5FO9B 1AYXA 3M7BA 4ZG8A 3C72B 2GH4A 3QPFA 5KKBA 4LNGB 3SQCA 3EU8A 3GT5A 2WY7A 1CLCA 2GZ6A 3K11A 3PZ2B 1KZPB 3PZ1B 2VN4A 2WYNA 3DRAB 4D4DA 3GLYA 2BB6A 2FV1A 1QQFA 3HXFB 1TN6B 1WU5A 1O5MB 1W6JA 3M73A 1TN7B 3S4CA 1C3DA 1SA5B 2ZZRA 1TF4A 3QG0A 1H35A 3M77A 5DGRA 3GZKA 1LD7B 3D5RA 4LIXA 1H36A 3VW5A 2R2LB 3E33B 3HXBB 1NL4B 3SFXB 1TNOB 1DOGA 1KRFA 4MBGB 3WIQA 2A8ZA 2PMVA 3M72A 3CU7A 1KSCA 1O1RB 2H6FB 2GOXA 3QFZA 1X81B 3SDQA 3KQ4A 3W5MA 1KREA 4TF4A 5E2JA 3M71A 1G87A 1FPPB 4KTRA 3KSLB 5GZKA 3M76A 1WZZA 2EACA 2V3NA 1W6KA 3KLSA 3QXFA 2SQCA 3M74A 3RX7A 4GL3A 5CA3A 1UG9A 3WKIA 1X9DA 1RQ5A 4Q2BA 1F9DA 3WKHA 1FO3A 2WY8A 3S4AA 3OXUA 1K72A 3E37B 1WU4A 2JG0A 2B4FA 1O1TB 4KKIA 1V7WA 3QXQA 4GTPB 3EZ8A 4CJ0A 2NOJA 4CJ1A 2DRRA 2CQTA 1FMIA 5JPMB 4FXGB 1FT1B 1H14A 1G9JA 3Q7AB 4GTMB 3KSQB 3M7LA 3E73A 1TNZB 1O6QA 3ACSA 4Q88A 4ONTA 4WVBA 4DODA 1GAIA 2B39A 1G6IA 3HXEB 5M7IA 4JJJA 2WIIB 1H54A 3WIWA 3M7CA 3H2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QG0 A;  3A3V A;  5DGQ A;  4CE7 A;  3S4D A;  2YIK A;  1NXC A;  1V7X A;  1ULV A;  3RX8 A;  5DGR A;  3GZK A;  3PMM A;  1IA6 A;  3VW5 A;  3W5N A;  3QT9 A;  2DRQ A;  3AFJ A;  3WIR A;  1VD5 A;  1L1Y A;  3ON6 A;  1XWT A;  1V5D A;  4WVA A;  1DOG A;  1KRF A;  1NC5 A;  5M7Y A;  1KWF A;  2A8Z A;  3WIQ A;  4J5T A;  1AGM A;  1WU6 A;  3W7W A;  2FUZ A;  1KSC A;  1DL2 A;  1V7V A;  3QFZ A;  1KFG A;  1GAH A;  4Z4L A;  3W5M A;  2JJB A;  1KRE A;  3P2C A;  1H13 A;  4TF4 A;  2JF4 A;  2EAB A;  1FCE A;  2FBA A;  2RI9 A;  1V5C A;  2AHG A;  3D3I A;  5E2J A;  4AYQ A;  1HCU A;  2F6D A;  4KTR A;  1G87 A;  4TXT A;  1FBO A;  3T33 A;  3ANK A;  1LF9 A;  1WZZ A;  2EAC A;  4WVC A;  1L2A A;  1XWQ A;  3QXF A;  1KKT A;  4EL8 A;  2AHF A;  4FUS A;  3RX7 A;  5CA3 A;  2D8L A;  1UG9 A;  2DRS A;  5GY3 A;  3S4B A;  3WKI A;  2CQS A;  1X9D A;  1RQ5 A;  4Q2B A;  3E6U A;  2ZBL A;  1F9D A;  3H3K A;  1H12 A;  5GW7 A;  1FO3 A;  1FBW A;  3QSP A;  3S4A A;  3WKH A;  3W7U A;  3H7L A;  4L0G A;  1K72 A;  1KSD A;  1FAE A;  1KS8 A;  2D5J A;  3RSY A;  1FP3 A;  1WU4 A;  3W7X A;  2JG0 A;  2FV0 A;  3RRS A;  3QFY A;  2B4F A;  2QNO A;  3VXD A;  1FO2 A;  1V7W A;  3QXQ A;  1IS9 A;  3EZ8 A;  4CJ0 A;  4AYR A;  3QRY A;  3WKG A;  4KTP A;  1LF6 A;  4CJ1 A;  2DRR A;  2CQT A;  2RGK A;  1FMI A;  3QWT A;  4XUV A;  1JS4 A;  2EAE A;  4DOE A;  2AFA A;  2Z07 A;  5CZL A;  1AYX A;  1H14 A;  4AYP A;  1G9J A;  1IA7 A;  4L6X A;  3ANI A;  2OKX A;  3WKF A;  4ZG8 A;  2GH4 A;  2EAD A;  3X17 A;  5MEH A;  3QPF A;  3W7T A;  3ANJ A;  4WU0 A;  5KKB A;  3ACT A;  3WC3 A;  3E73 A;  2VN7 A;  3GT5 A;  4ZH5 A;  2NVP A;  1CLC A;  2GZ6 A;  3K11 A;  3ACS A;  4Q88 A;  1GLM A;  2VN4 A;  5CD2 A;  2WYN A;  3RX5 A;  4WVB A;  1UT9 A;  4DOD A;  1GAI A;  3TF4 A;  1F9O A;  3WUX A;  3GLY A;  2FV1 A;  1G6I A;  3QDE A;  1WU5 A;  3REN A;  3QT3 A;  3W7S A;  5M7I A;  4JJJ A;  4Z4J A;  2P0V A;  3S4C A;  1H54 A;  3EQA A;  3WIW A;  1GA2 A;  3CIH A;  2RI8 A;  4AYO A;  1G9G A;  2ZZR A;  2DRO A;  1XW2 A;  3H2W A;  1CEM A;  1TF4 A;  2XFG A; 
#chains in the Genus database with same CATH topology
 3A3V A;  4D94 A;  3DPY B;  2YIK A;  2WCO A;  1N4S B;  5FO8 B;  3G4F A;  5ILY A;  1J0N A;  3PYA A;  1IA6 A;  1LD8 B;  1O1S B;  5IL3 A;  2H6I B;  3WIR A;  3M01 A;  4GTO B;  4D4A A;  1HMW A;  1N1B A;  1NC5 A;  1AGM A;  3W7W A;  1GXO A;  1GSZ A;  2FUZ A;  1X1I A;  1V7V A;  5AGD A;  1GAH A;  1HM3 A;  1N7Q A;  1GXM A;  1C82 A;  2JJB A;  3P2C A;  1H3A A;  3EUV B;  2JF4 A;  1FCE A;  2FBA A;  2RI9 A;  2F6D A;  4V1S A;  1RWA A;  3VSM A;  1FBO A;  1HXA A;  1QSJ A;  2IEJ B;  2Q1F A;  4D4B A;  1L2A A;  1TNU B;  1KKT A;  2AHF A;  2V8I A;  1HV6 A;  1KZO B;  2ZBL A;  1N7O A;  3HXC B;  5DHK A;  3NFV A;  5GW7 A;  3QSP A;  4KKJ A;  3W7U A;  3H7L A;  4QT9 A;  1S64 B;  1KSD A;  1KS8 A;  1LXM A;  1SQC A;  2D5J A;  2XWJ B;  3PZ4 B;  3RRS A;  1H3B A;  4D4C A;  2FUT A;  2QNO A;  3VXD A;  5ILI A;  1HX9 A;  4FXK B;  3QRY A;  3WKG A;  1H3C A;  4LNV A;  5DHI A;  2AFA A;  4GTT B;  4AYP A;  4L6X A;  3ANI A;  3WKF A;  2PN5 A;  1N7R A;  4MMI A;  5MEH A;  3W7T A;  3ANJ A;  3ACT A;  3WC3 A;  3K7X A;  2VN7 A;  4ZH5 A;  2NVP A;  2ONG A;  4FNV A;  1GLM A;  5CD2 A;  3RX5 A;  1JCQ B;  5EAS A;  3DSU B;  3NNB A;  1N4P B;  3QDE A;  3SDV A;  4RNQ A;  4Z4J A;  2V8J A;  4LNB B;  2ZIS B;  1GA2 A;  4AYO A;  2G02 A;  2DRO A;  5CZL A;  3DSV B;  2XFG A;  5DGQ A;  3S4D A;  4BOK A;  1N23 A;  1V7X A;  3DSX B;  2BBC A;  3RX8 A;  5ILK A;  1R76 A;  1X1J A;  4F13 A;  3SDU A;  3QT9 A;  2DRQ A;  2XQW A;  3AFJ A;  4YCR A;  1L1Y A;  3ON6 A;  1V5D A;  3Q78 B;  4WVA A;  1DCE B;  3S9V A;  1N4Q B;  3E32 B;  1KWF A;  3SAE A;  1MZC B;  3PYB A;  1LXK A;  1TN8 B;  1DL2 A;  4BOJ A;  1KFG A;  3Q75 B;  3M78 A;  4Z4L A;  3G6J B;  4ZH1 A;  4L9P B;  2ZIR B;  1NI1 B;  4MU9 A;  4YDO B;  1H13 A;  2V8K A;  1V5C A;  5FO7 B;  3D3I A;  1SA4 B;  4TXT A;  3E34 B;  2A73 B;  1N7P A;  4V1R A;  1TNB B;  3T33 A;  1LF9 A;  1N95 B;  1F1S A;  2H6G B;  4WVC A;  1HXC A;  4C1S A;  4EL8 A;  3D5S A;  3S4B A;  2CQS A;  1N20 A;  1O6H A;  1TNY B;  2ONH A;  3H3K A;  1H12 A;  1FBW A;  5C05 A;  1QBQ B;  3RSY A;  4ZRQ A;  1FAE A;  3E30 B;  2I07 B;  5ILH A;  1FP3 A;  3W7X A;  2FV0 A;  2G0D A;  1UMP A;  3QFY A;  4M76 A;  1FO2 A;  2FUQ A;  1IS9 A;  4NEI A;  3DST B;  4GTS B;  4AYR A;  1CB8 A;  2H6H B;  3OED A;  1LF6 A;  2F0Y B;  1J0M A;  3M02 A;  3N0F A;  2EAE A;  2Z07 A;  1IA7 A;  2OKX A;  2EAD A;  4OK4 A;  3X17 A;  2E22 A;  4WU0 A;  3SDT A;  1N22 A;  3DSW B;  1D8D B;  1OJN A;  2BB5 A;  1UT9 A;  3TF4 A;  3SFY B;  5ILD A;  1F9O A;  4GAX A;  3WUX A;  5JPN B;  3RJ3 A;  1JCS B;  1LTX B;  3REN A;  1HXG A;  3QT3 A;  3W7S A;  1N9A B;  1GXN A;  4GTR B;  1RWH A;  5IK6 A;  2P0V A;  2WDA A;  3EQA A;  3CIH A;  2RI8 A;  1G9G A;  4GTV B;  1XW2 A;  1CEM A;  3G4D A;  4CE7 A;  1NXC A;  1ULV A;  3PMM A;  3PZ3 B;  3W5N A;  3Q79 B;  1W3Y A;  1VD5 A;  1XWT A;  2BED B;  1FT2 B;  2BRW A;  5M7Y A;  1GHQ A;  4J5T A;  1WU6 A;  5FOB B;  3Q73 B;  4F10 A;  3M7E A;  2V3P A;  5EAU A;  3DSS B;  4OZW A;  3Q7F B;  1HMU A;  1N1Z A;  2EAB A;  3SDR A;  2AHG A;  2WIN B;  4AYQ A;  1HCU A;  1RWG A;  1RW9 A;  3E7J A;  3ANK A;  2BRV X;  1JCR B;  1RWC A;  4OK2 A;  1N24 A;  1XWQ A;  3EU5 B;  1O79 A;  1N94 B;  3P5P A;  4FUS A;  5IL8 A;  2D8L A;  5IK0 A;  2DRS A;  4ZRP A;  5GY3 A;  3HXD B;  5IM1 A;  3M75 A;  1N7N A;  4YDE B;  3E6U A;  1S63 B;  1N21 A;  3P5R A;  1H39 A;  1H37 A;  4L0G A;  2XWB B;  5EAT A;  1N4R B;  1D8E B;  1O6R A;  4EHM B;  4KTP A;  4GTQ B;  1X1H A;  5JMD A;  2RGK A;  3QWT A;  4XUV A;  3VSN A;  1JS4 A;  4DOE A;  1HZF A;  5FO9 B;  1AYX A;  3AFL A;  3M7B A;  3C72 B;  2GH4 A;  3E80 A;  4ZG8 A;  3QPF A;  5KKB A;  4LNG B;  3SQC A;  3EU8 A;  3GT5 A;  2WY7 A;  1CLC A;  2GZ6 A;  3K11 A;  3PZ2 B;  1KZP B;  3PZ1 B;  2J5C A;  2VN4 A;  2WYN A;  3DRA B;  1HM2 A;  4D4D A;  3GLY A;  2BB6 A;  2FV1 A;  1QQF A;  3HXF B;  1TN6 B;  1WU5 A;  1O5M B;  1W6J A;  5ILZ A;  3M73 A;  1TN7 B;  3S4C A;  1C3D A;  4E1Y A;  4DI5 A;  1SA5 B;  2ZZR A;  1TF4 A;  3QG0 A;  1H35 A;  3M77 A;  2E24 A;  3M00 A;  5DGR A;  3GZK A;  1LD7 B;  3D5R A;  4LIX A;  5IKH A;  1H36 A;  3VW5 A;  2R2L B;  3E33 B;  5IKA A;  3HXB B;  1NL4 B;  3SFX B;  1TNO B;  1DOG A;  1KRF A;  4MBG B;  3WIQ A;  2A8Z A;  2PMV A;  3M72 A;  3CU7 A;  1KSC A;  1O1R B;  2H6F B;  2GOX A;  3QFZ A;  1X81 B;  3N0G A;  3SDQ A;  3KQ4 A;  3W5M A;  1KRE A;  2BRP A;  4TF4 A;  5E2J A;  3M71 A;  1G87 A;  1FPP B;  4KTR A;  1EGU A;  3KSL B;  5GZK A;  4OJZ A;  3M76 A;  2EAC A;  1WZZ A;  2V3N A;  1W6K A;  3KLS A;  4MMH A;  3QXF A;  2SQC A;  3M74 A;  4OZV A;  3RX7 A;  4GL3 A;  5CA3 A;  1UG9 A;  3WKI A;  1I8Q A;  1X9D A;  1RQ5 A;  4Q2B A;  1F9D A;  3WKH A;  1FO3 A;  2WY8 A;  3S4A A;  3OXU A;  1K72 A;  3E37 B;  1WU4 A;  2JG0 A;  1LOH A;  2B4F A;  1O1T B;  4KKI A;  1HN0 A;  1V7W A;  3QXQ A;  4GTP B;  3EZ8 A;  4CJ0 A;  2NOJ A;  1QAZ A;  4CJ1 A;  2DRR A;  2CQT A;  5IK9 A;  1FMI A;  5JPM B;  1OJP A;  1RWF A;  3A0O A;  2X03 A;  1OJM A;  4FXG B;  1FT1 B;  1H14 A;  1G9J A;  3Q7A B;  4GTM B;  3KSQ B;  3M7L A;  3E73 A;  4FJQ A;  1TNZ B;  3LZ9 A;  1O6Q A;  3ACS A;  4Q88 A;  4ONT A;  4WVB A;  4DOD A;  5JMF A;  1GAI A;  2B39 A;  5ILJ A;  1G6I A;  1OJO A;  3HXE B;  1F9G A;  5M7I A;  4JJJ A;  2WII B;  1H54 A;  3WIW A;  3M7C A;  3H2W A; 
#chains in the Genus database with same CATH homology
 3A3V A;  4D94 A;  3DPY B;  2YIK A;  1N4S B;  5FO8 B;  3PYA A;  1IA6 A;  1LD8 B;  1O1S B;  2H6I B;  3WIR A;  4GTO B;  4D4A A;  1NC5 A;  1AGM A;  3W7W A;  1GXO A;  1GSZ A;  2FUZ A;  1V7V A;  5AGD A;  1GAH A;  1GXM A;  2JJB A;  3P2C A;  1H3A A;  3EUV B;  2JF4 A;  1FCE A;  2FBA A;  2RI9 A;  2F6D A;  4V1S A;  1FBO A;  1QSJ A;  2IEJ B;  4D4B A;  1L2A A;  1TNU B;  1KKT A;  2AHF A;  2V8I A;  1KZO B;  2ZBL A;  3HXC B;  5GW7 A;  3QSP A;  4KKJ A;  3W7U A;  3H7L A;  4QT9 A;  1S64 B;  1KSD A;  1KS8 A;  1SQC A;  2D5J A;  2XWJ B;  3PZ4 B;  3RRS A;  1H3B A;  4D4C A;  2QNO A;  3VXD A;  4FXK B;  3QRY A;  3WKG A;  1H3C A;  4LNV A;  2AFA A;  4GTT B;  4AYP A;  4L6X A;  3ANI A;  3WKF A;  2PN5 A;  5MEH A;  3W7T A;  3ANJ A;  3ACT A;  3WC3 A;  3K7X A;  2VN7 A;  4ZH5 A;  2NVP A;  1GLM A;  5CD2 A;  3RX5 A;  1JCQ B;  3DSU B;  1N4P B;  3QDE A;  3SDV A;  4Z4J A;  2V8J A;  4LNB B;  2ZIS B;  1GA2 A;  4AYO A;  2G02 A;  2DRO A;  5CZL A;  3DSV B;  2XFG A;  5DGQ A;  3S4D A;  4BOK A;  1V7X A;  3DSX B;  2BBC A;  3RX8 A;  1R76 A;  3SDU A;  3QT9 A;  2DRQ A;  2XQW A;  3AFJ A;  4YCR A;  1L1Y A;  3ON6 A;  1V5D A;  3Q78 B;  4WVA A;  1DCE B;  3S9V A;  1N4Q B;  3E32 B;  1KWF A;  3SAE A;  1MZC B;  3PYB A;  1TN8 B;  1DL2 A;  4BOJ A;  1KFG A;  3Q75 B;  3M78 A;  4Z4L A;  3G6J B;  4ZH1 A;  4L9P B;  2ZIR B;  1NI1 B;  4MU9 A;  4YDO B;  1H13 A;  2V8K A;  1V5C A;  5FO7 B;  3D3I A;  1SA4 B;  4TXT A;  3E34 B;  2A73 B;  4V1R A;  1TNB B;  3T33 A;  1LF9 A;  1N95 B;  2H6G B;  4WVC A;  4C1S A;  4EL8 A;  3D5S A;  3S4B A;  2CQS A;  1O6H A;  1TNY B;  3H3K A;  1H12 A;  1FBW A;  1QBQ B;  3RSY A;  4ZRQ A;  1FAE A;  3E30 B;  2I07 B;  1FP3 A;  3W7X A;  2FV0 A;  2G0D A;  1UMP A;  3QFY A;  4M76 A;  1FO2 A;  1IS9 A;  3DST B;  4GTS B;  4AYR A;  2H6H B;  3OED A;  1LF6 A;  2F0Y B;  2EAE A;  2Z07 A;  1IA7 A;  2OKX A;  2EAD A;  3X17 A;  4WU0 A;  3SDT A;  3DSW B;  1D8D B;  2BB5 A;  1UT9 A;  3TF4 A;  3SFY B;  1F9O A;  3WUX A;  5JPN B;  3RJ3 A;  1JCS B;  1LTX B;  3REN A;  3QT3 A;  3W7S A;  1N9A B;  1GXN A;  4GTR B;  2P0V A;  3EQA A;  3CIH A;  2RI8 A;  1G9G A;  4GTV B;  1XW2 A;  1CEM A;  4CE7 A;  1NXC A;  1ULV A;  3PMM A;  3PZ3 B;  3W5N A;  3Q79 B;  1VD5 A;  1XWT A;  2BED B;  1FT2 B;  5M7Y A;  1GHQ A;  4J5T A;  1WU6 A;  5FOB B;  3Q73 B;  3M7E A;  2V3P A;  3DSS B;  3Q7F B;  2EAB A;  3SDR A;  2AHG A;  2WIN B;  4AYQ A;  1HCU A;  3ANK A;  1JCR B;  1XWQ A;  3EU5 B;  1O79 A;  1N94 B;  3P5P A;  4FUS A;  2D8L A;  2DRS A;  4ZRP A;  5GY3 A;  3HXD B;  3M75 A;  4YDE B;  3E6U A;  1S63 B;  3P5R A;  1H39 A;  1H37 A;  4L0G A;  2XWB B;  1N4R B;  1D8E B;  1O6R A;  4EHM B;  4KTP A;  4GTQ B;  2RGK A;  3QWT A;  4XUV A;  1JS4 A;  4DOE A;  1HZF A;  5FO9 B;  1AYX A;  3M7B A;  4ZG8 A;  3C72 B;  2GH4 A;  3QPF A;  5KKB A;  4LNG B;  3SQC A;  3EU8 A;  3GT5 A;  2WY7 A;  1CLC A;  2GZ6 A;  3K11 A;  3PZ2 B;  1KZP B;  3PZ1 B;  2VN4 A;  2WYN A;  3DRA B;  4D4D A;  3GLY A;  2BB6 A;  2FV1 A;  1QQF A;  3HXF B;  1TN6 B;  1WU5 A;  1O5M B;  1W6J A;  3M73 A;  1TN7 B;  3S4C A;  1C3D A;  1SA5 B;  2ZZR A;  1TF4 A;  3QG0 A;  1H35 A;  3M77 A;  5DGR A;  3GZK A;  1LD7 B;  3D5R A;  4LIX A;  1H36 A;  3VW5 A;  2R2L B;  3E33 B;  3HXB B;  1NL4 B;  3SFX B;  1TNO B;  1DOG A;  1KRF A;  4MBG B;  3WIQ A;  2A8Z A;  2PMV A;  3M72 A;  3CU7 A;  1KSC A;  1O1R B;  2H6F B;  2GOX A;  3QFZ A;  1X81 B;  3SDQ A;  3KQ4 A;  3W5M A;  1KRE A;  4TF4 A;  5E2J A;  3M71 A;  1G87 A;  1FPP B;  4KTR A;  3KSL B;  5GZK A;  3M76 A;  1WZZ A;  2EAC A;  2V3N A;  1W6K A;  3KLS A;  3QXF A;  2SQC A;  3M74 A;  3RX7 A;  4GL3 A;  5CA3 A;  1UG9 A;  3WKI A;  1X9D A;  1RQ5 A;  4Q2B A;  1F9D A;  3WKH A;  1FO3 A;  2WY8 A;  3S4A A;  3OXU A;  1K72 A;  3E37 B;  1WU4 A;  2JG0 A;  2B4F A;  1O1T B;  4KKI A;  1V7W A;  3QXQ A;  4GTP B;  3EZ8 A;  4CJ0 A;  2NOJ A;  4CJ1 A;  2DRR A;  2CQT A;  1FMI A;  5JPM B;  4FXG B;  1FT1 B;  1H14 A;  1G9J A;  3Q7A B;  4GTM B;  3KSQ B;  3M7L A;  3E73 A;  1TNZ B;  1O6Q A;  3ACS A;  4Q88 A;  4ONT A;  4WVB A;  4DOD A;  1GAI A;  2B39 A;  1G6I A;  3HXE B;  5M7I A;  4JJJ A;  2WII B;  1H54 A;  3WIW A;  3M7C A;  3H2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...