3DSWB

Crystal structure of rabggtase(delta lrr; delta ig)in complex with mono-prenylated peptide ser-cys(gg)-ser-cys derivated from rab7
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
325
Chain Sequence
b'QKDVTIKSDAPDTLLLEKHADYIASYGSKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 121
structure length 325
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dswB00
3DSUB 1S63B 3KQ4A 2G0DA 1H37A 3E37B 4C1SA 4EHMB 4M76A 1W6KA 1H35A 2BEDB 1NL4B 2F0YB 2B39A 1H3CA 1X81B 4GTOB 1SA5B 4GTMB 1KZOB 2BBCA 3E30B 1LD7B 4YDEB 2GOXA 3C72B 3D5SA 1QSJA 4MU9A 1N4QB 1QQFA 3PZ1B 1C3DA 2V3PA 4GTQB 3Q7AB 3DSTB 2BB5A 1TN8B 4LNGB 1S64B 4BOKA 4KKIA 2R2LB 1MZCB 2PMVA 4YDOB 4D4BA 3HXBB 3PZ2B 4GTPB 1N4SB 4FXKB 1D8EB 4GTVB 1TNZB 2PN5A 3HXCB 1QBQB 2XWBB 2IEJB 4ONTA 2XWJB 3PZ4B 3Q73B 3E33B 4MBGB 1TNOB 1H3AA 1TNUB 4ZRQA 5JPMB 2H6IB 5FOBB 1JCSB 1SA4B 4ZH1A 3HXDB 3SFYB 3EU5B 1N94B 3HXEB 4LNVA 1O5MB 1GXOA 2WIIB 1H36A 3KLSA 3OEDA 4GTSB 5FO7B 2NOJA 1LTXB 1TNBB 1O1RB 1NI1B 3D5RA 4V1SA 1O1TB 1GXMA 2G02A 1H39A 1DCEB 2I07B 4GTTB 1LD8B 1O6QA 1O6HA 3DRAB 3CU7A 4D94A 1O1SB 1W6JA 4L9PB 1GSZA 1R76A 2WY7A 3K7XA 4D4CA 5FO8B 1D8DB 1HZFA 3SQCA 2WINB 3Q79B 3DSXB 1H3BA 3SFXB 4D4DA 1N4RB 1N95B 2ZIRB 4KKJA 3DSSB 4V1RA 1FT2B 1TN7B 2ZISB 1N4PB 1TN6B 1FT1B 2WY8A 2V8KA 3Q7FB 1TNYB 3DSVB 3HXFB 3OXUA 3Q75B 5JPNB 1KZPB 2H6FB 3DSWB 1JCQB 4FXGB 1JCRB 4D4AA 2A73B 2BB6A 3E32B 1UMPA 2H6GB 2V8IA 3PZ3B 4BOJA 3E34B 3DPYB 3KSLB 5AGDA 2V3NA 3KSQB 2XQWA 1N9AB 2H6HB 1O6RA 1GXNA 1O79A 4ZRPA 3EUVB 4LNBB 5FO9B 3G6JB 1GHQA 1FPPB 1SQCA 2SQCA 3Q78B 3RJ3A 4GTRB 2V8JA
chains in the Genus database with same CATH superfamily
1N7NA 2VN4A 2RI9A 2G0DA 1H37A 1FP3A 2BRPA 4DODA 4M76A 1W6KA 2NVPA 1N7RA 2DRSA 3RRSA 3E30B 1G9GA 5E2JA 2YIKA 3ON6A 4MU9A 4CE7A 4WVBA 5IL8A 1FO3A 1QQFA 1H13A 3NFVA 1JS4A 3PZ1B 2V3PA 3W7TA 1OJNA 2OKXA 2BB5A 3H3KA 3W7XA 1HV6A 1FAEA 3M00A 4FNVA 4MMIA 3PYBA 4AYRA 2E24A 4YDOB 4GTPB 4LIXA 4JJJA 2WCOA 1D8EB 3HXCB 2FV0A 1QBQB 4ONTA 2IEJB 3S4AA 3VSMA 2XWJB 2B4FA 5JMDA 3AFLA 3E33B 3P2CA 4ZRQA 2DROA 2H6IB 1SA4B 1OJPA 2WYNA 3EU5B 3QFZA 1W3YA 1N21A 1LOHA 1HMUA 1LTXB 2P0VA 1O1RB 2J5CA 2A8ZA 1RWCA 3M71A 1N20A 1O1TB 3QT9A 1RWHA 3X17A 1DCEB 1GAIA 1O6HA 5DHIA 1N7OA 3CU7A 3K11A 1W6JA 3ACTA 1R76A 4E1YA 5FO8B 1HZFA 1HX9A 3QSPA 5JMFA 3RX7A 1N22A 3SFXB 1N4RB 1LXMA 2WDAA 4V1RA 1KSDA 2V8KA 3WC3A 1LXKA 1UT9A 2JG0A 3Q75B 3M02A 1GAHA 2FUQA 3SAEA 3SDUA 3LZ9A 3E34B 3DPYB 3EZ8A 2FBAA 4NEIA 1N9AB 5GY3A 1O6RA 1HCUA 5IL3A 1FCEA 4AYQA 1J0MA 1NC5A 3EUVB 3E73A 5FO9B 1SQCA 3PMMA 3WUXA 1S63B 3M77A 1N23A 1X1JA 1N24A 1ULVA 2BEDB 1N7QA 1H12A 1NL4B 1RQ5A 2GZ6A 1FMIA 1KZOB 2JJBA 3P5RA 2BBCA 4YDEB 4AYPA 1LF9A 5ILYA 1WU6A 2EAEA 1J0NA 3RX8A 3WKIA 4AYOA 4WVAA 3GT5A 1AYXA 4GTQB 3N0FA 3Q7AB 3DSTB 4GAXA 1DOGA 4LNGB 3QG0A 1IA7A 4KKIA 3HXBB 4Q2BA 2X03A 1OJOA 1N4SB 4GTVB 1KWFA 5ILJA 1X9DA 4ZG8A 3Q73B 5IK6A 1XWQA 1TNOB 4MBGB 1WZZA 3M7CA 3QDEA 1O5MB 5ILDA 1CLCA 5FO7B 3WIQA 2NOJA 5CA3A 2D8LA 1NI1B 4YCRA 4V1SA 3G4DA 2DRQA 4XUVA 5DGQA 1H39A 3GZKA 4GTTB 5CZLA 2FUZA 4DI5A 3W5MA 1LD8B 3DRAB 1OJMA 4L9PB 2ONHA 4D4CA 1D8DB 5M7YA 2WINB 4KTPA 1H3BA 4D4DA 1I8QA 4QT9A 5IK0A 2ZISB 3QXQA 1FT1B 3DSVB 3OXUA 4OK2A 2H6FB 3DSWB 1JCQB 1XWTA 1G87A 4KTRA 3D3IA 1JCRB 2RI8A 5MEHA 2BB6A 2F6DA 3VSNA 2V8IA 2CQTA 4BOJA 3KSLB 5DHKA 2V3NA 4OJZA 3KSQB 3M76A 3W7SA 3M72A 1O79A 3CIHA 1C82A 3M7LA 1HMWA 1GLMA 1X1IA 3WIWA 1FPPB 2SQCA 3Q78B 3RJ3A 3WKFA 5M7IA 3DSXB 2V8JA 1V7VA 4TF4A 2AHFA 3KQ4A 2AFAA 3QWTA 3SDQA 1KREA 3M73A 4CJ1A 2F0YB 3M74A 1LD7B 3QRYA 3C72B 1FO2A 1N4QB 5EAUA 3TF4A 1KFGA 2GH4A 2DRRA 1HXGA 3W5NA 5GZKA 3PYAA 1S64B 5ILKA 4BOKA 1MZCB 1TF4A 2Z07A 3ACSA 5DGRA 4D4BA 1HXCA 3PZ2B 4FXKB 4Z4JA 3T33A 1TNZB 1EGUA 2XWBB 4F10A 1N7PA 1H3AA 1TNUB 2AHGA 3VXDA 1CB8A 2E22A 3GLYA 5ILIA 5EASA 3RSYA 4F13A 1N94B 5KKBA 4LNVA 1F9GA 3ANKA 1GXOA 2WIIB 1H36A 4WU0A 3OEDA 4GTSB 1TNBB 3SDVA 1DL2A 1GXMA 5ILHA 2I07B 4OZVA 1O6QA 1K72A 1WU5A 3EU8A 3WKGA 3ANJA 4D94A 4Q88A 1GSZA 3K7XA 3SQCA 3H2WA 3AFJA 1L2AA 1V5CA 3S9VA 2QNOA 2ZIRB 1H54A 1F9DA 3P5PA 1HM3A 1N1BA 2ZBLA 3A0OA 3E80A 1IA6A 2BRVX 1TN6B 2VN7A 3M75A 2CQSA 1KZPB 1FBWA 1L1YA 4L0GA 1V5DA 1KRFA 2A73B 3G4FA 3E32B 1RWAA 1UMPA 4EL8A 2H6GB 3RENA 2BRWA 4WVCA 2FUTA 5AGDA 1HXAA 3M01A 2H6HB 1GXNA 5C05A 1KSCA 4ZRPA 3RX5A 5EATA 3G6JB 4RNQA 2RGKA 4GTRB 1H14A 3DSUB 4OZWA 1LF6A 4OK4A 1AGMA 1RWGA 2XFGA 3E37B 2EABA 3QPFA 4C1SA 4EHMB 1H35A 5CD2A 2B39A 4DOEA 1H3CA 1X81B 2FV1A 1SA5B 4GTMB 4GTOB 1WU4A 5IKHA 1NXCA 3NNBA 2GOXA 3E6UA 2Q1FA 1X1HA 3D5SA 1QSJA 1RWFA 1VD5A 1V7WA 3A3VA 3M78A 1RW9A 1C3DA 3S4DA 1FBOA 1IS9A 3QXFA 3QT3A 1TN8B 5IK9A 2EACA 4MMHA 1F9OA 2PMVA 2R2LB 3S4BA 4CJ0A 2PN5A 4GL3A 3W7UA 3PZ4B 3S4CA 4ZH5A 1GA2A 5JPMB 5FOBB 3SDTA 1JCSB 4J5TA 4ZH1A 3HXDB 3SFYB 4L6XA 3HXEB 3KLSA 1N1ZA 3M7BA 5GW7A 3D5RA 2ONGA 2G02A 3ANIA 1KS8A 3WKHA 1HN0A 4Z4LA 1O1SB 2WY7A 2JF4A 1UG9A 1G6IA 3Q79B 1V7XA 1N95B 1KKTA 4KKJA 3DSSB 1G9JA 1FT2B 1TN7B 1N4PB 3M7EA 3N0GA 2WY8A 3Q7FB 1CEMA 1TNYB 3HXFB 5IM1A 5JPNB 2D5JA 5IKAA 2EADA 4FXGB 3QFYA 4FUSA 4D4AA 3W7WA 3SDRA 1QAZA 3VW5A 3PZ3B 5ILZA 1F1SA 4FJQA 1HM2A 2XQWA 3H7LA 1XW2A 3E7JA 4TXTA 3WIRA 4LNBB 2ZZRA 1GHQA 3EQAA
chains in the Genus database with same CATH topology
2VN4A 2RI9A 2G0DA 1H37A 1FP3A 4DODA 4M76A 1W6KA 2NVPA 2DRSA 3RRSA 3E30B 1G9GA 5E2JA 2YIKA 3ON6A 4MU9A 4CE7A 4WVBA 1FO3A 1QQFA 1H13A 1JS4A 3PZ1B 2V3PA 3W7TA 2OKXA 2BB5A 3H3KA 3W7XA 1FAEA 3PYBA 4AYRA 4YDOB 4GTPB 4LIXA 4JJJA 1D8EB 3HXCB 2FV0A 1QBQB 4ONTA 2IEJB 3S4AA 2XWJB 2B4FA 3E33B 3P2CA 4ZRQA 2DROA 2H6IB 1SA4B 2WYNA 3EU5B 3QFZA 1LTXB 2P0VA 1O1RB 2A8ZA 3M71A 1O1TB 3QT9A 3X17A 1DCEB 1GAIA 1O6HA 3CU7A 3K11A 1W6JA 3ACTA 1R76A 5FO8B 1HZFA 3QSPA 3RX7A 3SFXB 1N4RB 4V1RA 1KSDA 2V8KA 3WC3A 1UT9A 2JG0A 3Q75B 1GAHA 3SAEA 3SDUA 3E34B 3DPYB 3EZ8A 2FBAA 1N9AB 5GY3A 1O6RA 1HCUA 1FCEA 4AYQA 1NC5A 3EUVB 3E73A 5FO9B 1SQCA 3PMMA 3WUXA 1S63B 3M77A 1ULVA 2BEDB 1H12A 1NL4B 1RQ5A 2GZ6A 1FMIA 1KZOB 2JJBA 3P5RA 2BBCA 4YDEB 4AYPA 1LF9A 1WU6A 2EAEA 3WKIA 3RX8A 4AYOA 4WVAA 3GT5A 1AYXA 4GTQB 3Q7AB 3DSTB 1DOGA 4LNGB 3QG0A 1IA7A 4KKIA 3HXBB 4Q2BA 1N4SB 4GTVB 1KWFA 1X9DA 4ZG8A 3Q73B 1XWQA 1TNOB 4MBGB 1WZZA 3M7CA 3QDEA 1O5MB 1CLCA 5FO7B 3WIQA 2NOJA 5CA3A 2D8LA 1NI1B 4YCRA 4V1SA 2DRQA 4XUVA 5DGQA 1H39A 3GZKA 4GTTB 5CZLA 2FUZA 3W5MA 1LD8B 3DRAB 4L9PB 4D4CA 1D8DB 5M7YA 2WINB 4KTPA 1H3BA 4D4DA 4QT9A 2ZISB 3QXQA 1FT1B 3DSVB 3OXUA 2H6FB 3DSWB 1JCQB 1XWTA 1G87A 4KTRA 3D3IA 1JCRB 2RI8A 5MEHA 2BB6A 2F6DA 2V8IA 2CQTA 4BOJA 3KSLB 2V3NA 3KSQB 3M76A 3W7SA 3M72A 1O79A 3CIHA 3M7LA 1GLMA 3WIWA 1FPPB 2SQCA 3Q78B 3RJ3A 3WKFA 5M7IA 3DSXB 2V8JA 1V7VA 4TF4A 2AHFA 3KQ4A 2AFAA 3QWTA 3SDQA 1KREA 3M73A 4CJ1A 2F0YB 3M74A 1LD7B 3QRYA 3C72B 1FO2A 1N4QB 3TF4A 1KFGA 2GH4A 2DRRA 3W5NA 5GZKA 3PYAA 1S64B 4BOKA 1MZCB 1TF4A 2Z07A 3ACSA 5DGRA 4D4BA 3PZ2B 4FXKB 4Z4JA 3T33A 1TNZB 2XWBB 1H3AA 1TNUB 2AHGA 3VXDA 3GLYA 3RSYA 5KKBA 1N94B 4LNVA 3ANKA 1GXOA 2WIIB 1H36A 4WU0A 3OEDA 4GTSB 1TNBB 3SDVA 1DL2A 1GXMA 2I07B 1O6QA 1K72A 1WU5A 3EU8A 3WKGA 3ANJA 4D94A 4Q88A 1GSZA 3K7XA 3SQCA 3H2WA 3AFJA 1L2AA 1V5CA 3S9VA 2QNOA 2ZIRB 1H54A 1F9DA 3P5PA 2ZBLA 1IA6A 1TN6B 2VN7A 3M75A 2CQSA 1KZPB 1FBWA 1L1YA 4L0GA 1V5DA 1KRFA 2A73B 3E32B 4EL8A 1UMPA 2H6GB 3RENA 4WVCA 5AGDA 2H6HB 1GXNA 1KSCA 4ZRPA 3RX5A 3G6JB 2RGKA 4GTRB 1H14A 3DSUB 1LF6A 1AGMA 2XFGA 3E37B 2EABA 3QPFA 4C1SA 4EHMB 1H35A 5CD2A 2B39A 4DOEA 1H3CA 1X81B 2FV1A 1SA5B 4GTMB 4GTOB 1WU4A 1NXCA 2GOXA 3E6UA 3D5SA 1QSJA 3A3VA 1VD5A 1V7WA 3M78A 1C3DA 3S4DA 1FBOA 1IS9A 3QXFA 3QT3A 1TN8B 2EACA 1F9OA 2PMVA 2R2LB 3S4BA 4CJ0A 2PN5A 4GL3A 3W7UA 3PZ4B 3S4CA 4ZH5A 1GA2A 5JPMB 5FOBB 3SDTA 1JCSB 4J5TA 4ZH1A 3HXDB 3SFYB 4L6XA 3HXEB 3KLSA 3M7BA 5GW7A 3D5RA 2G02A 3ANIA 1KS8A 3WKHA 4Z4LA 1O1SB 2WY7A 2JF4A 1UG9A 1G6IA 3Q79B 1V7XA 1N95B 1KKTA 4KKJA 3DSSB 1G9JA 1FT2B 1TN7B 1N4PB 3M7EA 2WY8A 3Q7FB 1CEMA 1TNYB 3HXFB 5JPNB 2D5JA 2EADA 4FXGB 3QFYA 4FUSA 4D4AA 3W7WA 3SDRA 3VW5A 3PZ3B 2XQWA 3H7LA 1XW2A 4TXTA 3WIRA 4LNBB 2ZZRA 1GHQA 3EQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSU B;  1S63 B;  3KQ4 A;  2G0D A;  1H37 A;  3E37 B;  4C1S A;  4EHM B;  4M76 A;  1W6K A;  1H35 A;  2BED B;  1NL4 B;  2F0Y B;  2B39 A;  1H3C A;  1X81 B;  4GTO B;  1SA5 B;  4GTM B;  1KZO B;  2BBC A;  3E30 B;  1LD7 B;  4YDE B;  2GOX A;  3C72 B;  3D5S A;  1QSJ A;  4MU9 A;  1N4Q B;  1QQF A;  3PZ1 B;  1C3D A;  2V3P A;  4GTQ B;  3Q7A B;  3DST B;  2BB5 A;  1TN8 B;  4LNG B;  1S64 B;  4BOK A;  4KKI A;  2R2L B;  1MZC B;  2PMV A;  4YDO B;  4D4B A;  3HXB B;  3PZ2 B;  4GTP B;  1N4S B;  4FXK B;  1D8E B;  4GTV B;  1TNZ B;  2PN5 A;  3HXC B;  1QBQ B;  2XWB B;  2IEJ B;  4ONT A;  2XWJ B;  3PZ4 B;  3Q73 B;  3E33 B;  4MBG B;  1TNO B;  1H3A A;  1TNU B;  4ZRQ A;  5JPM B;  2H6I B;  5FOB B;  1JCS B;  1SA4 B;  4ZH1 A;  3HXD B;  3SFY B;  3EU5 B;  1N94 B;  3HXE B;  4LNV A;  1O5M B;  1GXO A;  2WII B;  1H36 A;  3KLS A;  3OED A;  4GTS B;  5FO7 B;  2NOJ A;  1LTX B;  1TNB B;  1O1R B;  1NI1 B;  3D5R A;  4V1S A;  1O1T B;  1GXM A;  2G02 A;  1H39 A;  1DCE B;  2I07 B;  4GTT B;  1LD8 B;  1O6Q A;  1O6H A;  3DRA B;  3CU7 A;  4D94 A;  1O1S B;  1W6J A;  4L9P B;  1GSZ A;  1R76 A;  2WY7 A;  3K7X A;  4D4C A;  5FO8 B;  1D8D B;  1HZF A;  3SQC A;  2WIN B;  3Q79 B;  3DSX B;  1H3B A;  3SFX B;  4D4D A;  1N4R B;  1N95 B;  2ZIR B;  4KKJ A;  3DSS B;  4V1R A;  1FT2 B;  1TN7 B;  2ZIS B;  1N4P B;  1TN6 B;  1FT1 B;  2WY8 A;  2V8K A;  3Q7F B;  1TNY B;  3DSV B;  3HXF B;  3OXU A;  3Q75 B;  5JPN B;  1KZP B;  2H6F B;  3DSW B;  1JCQ B;  4FXG B;  1JCR B;  4D4A A;  2A73 B;  2BB6 A;  3E32 B;  1UMP A;  2H6G B;  2V8I A;  3PZ3 B;  4BOJ A;  3E34 B;  3DPY B;  3KSL B;  5AGD A;  2V3N A;  3KSQ B;  2XQW A;  1N9A B;  2H6H B;  1O6R A;  1GXN A;  1O79 A;  4ZRP A;  3EUV B;  4LNB B;  5FO9 B;  3G6J B;  1GHQ A;  1FPP B;  1SQC A;  2SQC A;  3Q78 B;  3RJ3 A;  4GTR B;  2V8J A; 
#chains in the Genus database with same CATH topology
 1N7N A;  2VN4 A;  2RI9 A;  2G0D A;  1H37 A;  1FP3 A;  2BRP A;  4DOD A;  4M76 A;  1W6K A;  2NVP A;  1N7R A;  2DRS A;  3RRS A;  3E30 B;  1G9G A;  5E2J A;  2YIK A;  3ON6 A;  4MU9 A;  4CE7 A;  4WVB A;  5IL8 A;  1FO3 A;  1QQF A;  1H13 A;  3NFV A;  1JS4 A;  3PZ1 B;  2V3P A;  3W7T A;  1OJN A;  2OKX A;  2BB5 A;  3H3K A;  3W7X A;  1HV6 A;  1FAE A;  3M00 A;  4FNV A;  4MMI A;  3PYB A;  4AYR A;  2E24 A;  4YDO B;  4GTP B;  4LIX A;  4JJJ A;  2WCO A;  1D8E B;  3HXC B;  2FV0 A;  1QBQ B;  4ONT A;  2IEJ B;  3S4A A;  3VSM A;  2XWJ B;  2B4F A;  5JMD A;  3AFL A;  3E33 B;  3P2C A;  4ZRQ A;  2DRO A;  2H6I B;  1SA4 B;  1OJP A;  2WYN A;  3EU5 B;  3QFZ A;  1W3Y A;  1N21 A;  1LOH A;  1HMU A;  1LTX B;  2P0V A;  1O1R B;  2J5C A;  2A8Z A;  1RWC A;  3M71 A;  1N20 A;  1O1T B;  3QT9 A;  1RWH A;  3X17 A;  1DCE B;  1GAI A;  1O6H A;  5DHI A;  1N7O A;  3CU7 A;  3K11 A;  1W6J A;  3ACT A;  1R76 A;  4E1Y A;  5FO8 B;  1HZF A;  1HX9 A;  3QSP A;  5JMF A;  3RX7 A;  1N22 A;  3SFX B;  1N4R B;  1LXM A;  2WDA A;  4V1R A;  1KSD A;  2V8K A;  3WC3 A;  1LXK A;  1UT9 A;  2JG0 A;  3Q75 B;  3M02 A;  1GAH A;  2FUQ A;  3SAE A;  3SDU A;  3LZ9 A;  3E34 B;  3DPY B;  3EZ8 A;  2FBA A;  4NEI A;  1N9A B;  5GY3 A;  1O6R A;  1HCU A;  5IL3 A;  1FCE A;  4AYQ A;  1J0M A;  1NC5 A;  3EUV B;  3E73 A;  5FO9 B;  1SQC A;  3PMM A;  3WUX A;  1S63 B;  3M77 A;  1N23 A;  1X1J A;  1N24 A;  1ULV A;  2BED B;  1N7Q A;  1H12 A;  1NL4 B;  1RQ5 A;  2GZ6 A;  1FMI A;  1KZO B;  2JJB A;  3P5R A;  2BBC A;  4YDE B;  4AYP A;  1LF9 A;  5ILY A;  1WU6 A;  2EAE A;  1J0N A;  3RX8 A;  3WKI A;  4AYO A;  4WVA A;  3GT5 A;  1AYX A;  4GTQ B;  3N0F A;  3Q7A B;  3DST B;  4GAX A;  1DOG A;  4LNG B;  3QG0 A;  1IA7 A;  4KKI A;  3HXB B;  4Q2B A;  2X03 A;  1OJO A;  1N4S B;  4GTV B;  1KWF A;  5ILJ A;  1X9D A;  4ZG8 A;  3Q73 B;  5IK6 A;  1XWQ A;  1TNO B;  4MBG B;  1WZZ A;  3M7C A;  3QDE A;  1O5M B;  5ILD A;  1CLC A;  5FO7 B;  3WIQ A;  2NOJ A;  5CA3 A;  2D8L A;  1NI1 B;  4YCR A;  4V1S A;  3G4D A;  2DRQ A;  4XUV A;  5DGQ A;  1H39 A;  3GZK A;  4GTT B;  5CZL A;  2FUZ A;  4DI5 A;  3W5M A;  1LD8 B;  3DRA B;  1OJM A;  4L9P B;  2ONH A;  4D4C A;  1D8D B;  5M7Y A;  2WIN B;  4KTP A;  1H3B A;  4D4D A;  1I8Q A;  4QT9 A;  5IK0 A;  2ZIS B;  3QXQ A;  1FT1 B;  3DSV B;  3OXU A;  4OK2 A;  2H6F B;  3DSW B;  1JCQ B;  1XWT A;  1G87 A;  4KTR A;  3D3I A;  1JCR B;  2RI8 A;  5MEH A;  2BB6 A;  2F6D A;  3VSN A;  2V8I A;  2CQT A;  4BOJ A;  3KSL B;  5DHK A;  2V3N A;  4OJZ A;  3KSQ B;  3M76 A;  3W7S A;  3M72 A;  1O79 A;  3CIH A;  1C82 A;  3M7L A;  1HMW A;  1GLM A;  1X1I A;  3WIW A;  1FPP B;  2SQC A;  3Q78 B;  3RJ3 A;  3WKF A;  5M7I A;  3DSX B;  2V8J A;  1V7V A;  4TF4 A;  2AHF A;  3KQ4 A;  2AFA A;  3QWT A;  3SDQ A;  1KRE A;  3M73 A;  4CJ1 A;  2F0Y B;  3M74 A;  1LD7 B;  3QRY A;  3C72 B;  1FO2 A;  1N4Q B;  5EAU A;  3TF4 A;  1KFG A;  2GH4 A;  2DRR A;  1HXG A;  3W5N A;  5GZK A;  3PYA A;  1S64 B;  5ILK A;  4BOK A;  1MZC B;  1TF4 A;  2Z07 A;  3ACS A;  5DGR A;  4D4B A;  1HXC A;  3PZ2 B;  4FXK B;  4Z4J A;  3T33 A;  1TNZ B;  1EGU A;  2XWB B;  4F10 A;  1N7P A;  1H3A A;  1TNU B;  2AHG A;  3VXD A;  1CB8 A;  2E22 A;  3GLY A;  5ILI A;  5EAS A;  3RSY A;  4F13 A;  1N94 B;  5KKB A;  4LNV A;  1F9G A;  3ANK A;  1GXO A;  2WII B;  1H36 A;  4WU0 A;  3OED A;  4GTS B;  1TNB B;  3SDV A;  1DL2 A;  1GXM A;  5ILH A;  2I07 B;  4OZV A;  1O6Q A;  1K72 A;  1WU5 A;  3EU8 A;  3WKG A;  3ANJ A;  4D94 A;  4Q88 A;  1GSZ A;  3K7X A;  3SQC A;  3H2W A;  3AFJ A;  1L2A A;  1V5C A;  3S9V A;  2QNO A;  2ZIR B;  1H54 A;  1F9D A;  3P5P A;  1HM3 A;  1N1B A;  2ZBL A;  3A0O A;  3E80 A;  1IA6 A;  2BRV X;  1TN6 B;  2VN7 A;  3M75 A;  2CQS A;  1KZP B;  1FBW A;  1L1Y A;  4L0G A;  1V5D A;  1KRF A;  2A73 B;  3G4F A;  3E32 B;  1RWA A;  1UMP A;  4EL8 A;  2H6G B;  3REN A;  2BRW A;  4WVC A;  2FUT A;  5AGD A;  1HXA A;  3M01 A;  2H6H B;  1GXN A;  5C05 A;  1KSC A;  4ZRP A;  3RX5 A;  5EAT A;  3G6J B;  4RNQ A;  2RGK A;  4GTR B;  1H14 A;  3DSU B;  4OZW A;  1LF6 A;  4OK4 A;  1AGM A;  1RWG A;  2XFG A;  3E37 B;  2EAB A;  3QPF A;  4C1S A;  4EHM B;  1H35 A;  5CD2 A;  2B39 A;  4DOE A;  1H3C A;  1X81 B;  2FV1 A;  1SA5 B;  4GTM B;  4GTO B;  1WU4 A;  5IKH A;  1NXC A;  3NNB A;  2GOX A;  3E6U A;  2Q1F A;  1X1H A;  3D5S A;  1QSJ A;  1RWF A;  1VD5 A;  1V7W A;  3A3V A;  3M78 A;  1RW9 A;  1C3D A;  3S4D A;  1FBO A;  1IS9 A;  3QXF A;  3QT3 A;  1TN8 B;  5IK9 A;  2EAC A;  4MMH A;  1F9O A;  2PMV A;  2R2L B;  3S4B A;  4CJ0 A;  2PN5 A;  4GL3 A;  3W7U A;  3PZ4 B;  3S4C A;  4ZH5 A;  1GA2 A;  5JPM B;  5FOB B;  3SDT A;  1JCS B;  4J5T A;  4ZH1 A;  3HXD B;  3SFY B;  4L6X A;  3HXE B;  3KLS A;  1N1Z A;  3M7B A;  5GW7 A;  3D5R A;  2ONG A;  2G02 A;  3ANI A;  1KS8 A;  3WKH A;  1HN0 A;  4Z4L A;  1O1S B;  2WY7 A;  2JF4 A;  1UG9 A;  1G6I A;  3Q79 B;  1V7X A;  1N95 B;  1KKT A;  4KKJ A;  3DSS B;  1G9J A;  1FT2 B;  1TN7 B;  1N4P B;  3M7E A;  3N0G A;  2WY8 A;  3Q7F B;  1CEM A;  1TNY B;  3HXF B;  5IM1 A;  5JPN B;  2D5J A;  5IKA A;  2EAD A;  4FXG B;  3QFY A;  4FUS A;  4D4A A;  3W7W A;  3SDR A;  1QAZ A;  3VW5 A;  3PZ3 B;  5ILZ A;  1F1S A;  4FJQ A;  1HM2 A;  2XQW A;  3H7L A;  1XW2 A;  3E7J A;  4TXT A;  3WIR A;  4LNB B;  2ZZR A;  1GHQ A;  3EQA A; 
#chains in the Genus database with same CATH homology
 2VN4 A;  2RI9 A;  2G0D A;  1H37 A;  1FP3 A;  4DOD A;  4M76 A;  1W6K A;  2NVP A;  2DRS A;  3RRS A;  3E30 B;  1G9G A;  5E2J A;  2YIK A;  3ON6 A;  4MU9 A;  4CE7 A;  4WVB A;  1FO3 A;  1QQF A;  1H13 A;  1JS4 A;  3PZ1 B;  2V3P A;  3W7T A;  2OKX A;  2BB5 A;  3H3K A;  3W7X A;  1FAE A;  3PYB A;  4AYR A;  4YDO B;  4GTP B;  4LIX A;  4JJJ A;  1D8E B;  3HXC B;  2FV0 A;  1QBQ B;  4ONT A;  2IEJ B;  3S4A A;  2XWJ B;  2B4F A;  3E33 B;  3P2C A;  4ZRQ A;  2DRO A;  2H6I B;  1SA4 B;  2WYN A;  3EU5 B;  3QFZ A;  1LTX B;  2P0V A;  1O1R B;  2A8Z A;  3M71 A;  1O1T B;  3QT9 A;  3X17 A;  1DCE B;  1GAI A;  1O6H A;  3CU7 A;  3K11 A;  1W6J A;  3ACT A;  1R76 A;  5FO8 B;  1HZF A;  3QSP A;  3RX7 A;  3SFX B;  1N4R B;  4V1R A;  1KSD A;  2V8K A;  3WC3 A;  1UT9 A;  2JG0 A;  3Q75 B;  1GAH A;  3SAE A;  3SDU A;  3E34 B;  3DPY B;  3EZ8 A;  2FBA A;  1N9A B;  5GY3 A;  1O6R A;  1HCU A;  1FCE A;  4AYQ A;  1NC5 A;  3EUV B;  3E73 A;  5FO9 B;  1SQC A;  3PMM A;  3WUX A;  1S63 B;  3M77 A;  1ULV A;  2BED B;  1H12 A;  1NL4 B;  1RQ5 A;  2GZ6 A;  1FMI A;  1KZO B;  2JJB A;  3P5R A;  2BBC A;  4YDE B;  4AYP A;  1LF9 A;  1WU6 A;  2EAE A;  3WKI A;  3RX8 A;  4AYO A;  4WVA A;  3GT5 A;  1AYX A;  4GTQ B;  3Q7A B;  3DST B;  1DOG A;  4LNG B;  3QG0 A;  1IA7 A;  4KKI A;  3HXB B;  4Q2B A;  1N4S B;  4GTV B;  1KWF A;  1X9D A;  4ZG8 A;  3Q73 B;  1XWQ A;  1TNO B;  4MBG B;  1WZZ A;  3M7C A;  3QDE A;  1O5M B;  1CLC A;  5FO7 B;  3WIQ A;  2NOJ A;  5CA3 A;  2D8L A;  1NI1 B;  4YCR A;  4V1S A;  2DRQ A;  4XUV A;  5DGQ A;  1H39 A;  3GZK A;  4GTT B;  5CZL A;  2FUZ A;  3W5M A;  1LD8 B;  3DRA B;  4L9P B;  4D4C A;  1D8D B;  5M7Y A;  2WIN B;  4KTP A;  1H3B A;  4D4D A;  4QT9 A;  2ZIS B;  3QXQ A;  1FT1 B;  3DSV B;  3OXU A;  2H6F B;  3DSW B;  1JCQ B;  1XWT A;  1G87 A;  4KTR A;  3D3I A;  1JCR B;  2RI8 A;  5MEH A;  2BB6 A;  2F6D A;  2V8I A;  2CQT A;  4BOJ A;  3KSL B;  2V3N A;  3KSQ B;  3M76 A;  3W7S A;  3M72 A;  1O79 A;  3CIH A;  3M7L A;  1GLM A;  3WIW A;  1FPP B;  2SQC A;  3Q78 B;  3RJ3 A;  3WKF A;  5M7I A;  3DSX B;  2V8J A;  1V7V A;  4TF4 A;  2AHF A;  3KQ4 A;  2AFA A;  3QWT A;  3SDQ A;  1KRE A;  3M73 A;  4CJ1 A;  2F0Y B;  3M74 A;  1LD7 B;  3QRY A;  3C72 B;  1FO2 A;  1N4Q B;  3TF4 A;  1KFG A;  2GH4 A;  2DRR A;  3W5N A;  5GZK A;  3PYA A;  1S64 B;  4BOK A;  1MZC B;  1TF4 A;  2Z07 A;  3ACS A;  5DGR A;  4D4B A;  3PZ2 B;  4FXK B;  4Z4J A;  3T33 A;  1TNZ B;  2XWB B;  1H3A A;  1TNU B;  2AHG A;  3VXD A;  3GLY A;  3RSY A;  5KKB A;  1N94 B;  4LNV A;  3ANK A;  1GXO A;  2WII B;  1H36 A;  4WU0 A;  3OED A;  4GTS B;  1TNB B;  3SDV A;  1DL2 A;  1GXM A;  2I07 B;  1O6Q A;  1K72 A;  1WU5 A;  3EU8 A;  3WKG A;  3ANJ A;  4D94 A;  4Q88 A;  1GSZ A;  3K7X A;  3SQC A;  3H2W A;  3AFJ A;  1L2A A;  1V5C A;  3S9V A;  2QNO A;  2ZIR B;  1H54 A;  1F9D A;  3P5P A;  2ZBL A;  1IA6 A;  1TN6 B;  2VN7 A;  3M75 A;  2CQS A;  1KZP B;  1FBW A;  1L1Y A;  4L0G A;  1V5D A;  1KRF A;  2A73 B;  3E32 B;  4EL8 A;  1UMP A;  2H6G B;  3REN A;  4WVC A;  5AGD A;  2H6H B;  1GXN A;  1KSC A;  4ZRP A;  3RX5 A;  3G6J B;  2RGK A;  4GTR B;  1H14 A;  3DSU B;  1LF6 A;  1AGM A;  2XFG A;  3E37 B;  2EAB A;  3QPF A;  4C1S A;  4EHM B;  1H35 A;  5CD2 A;  2B39 A;  4DOE A;  1H3C A;  1X81 B;  2FV1 A;  1SA5 B;  4GTM B;  4GTO B;  1WU4 A;  1NXC A;  2GOX A;  3E6U A;  3D5S A;  1QSJ A;  3A3V A;  1VD5 A;  1V7W A;  3M78 A;  1C3D A;  3S4D A;  1FBO A;  1IS9 A;  3QXF A;  3QT3 A;  1TN8 B;  2EAC A;  1F9O A;  2PMV A;  2R2L B;  3S4B A;  4CJ0 A;  2PN5 A;  4GL3 A;  3W7U A;  3PZ4 B;  3S4C A;  4ZH5 A;  1GA2 A;  5JPM B;  5FOB B;  3SDT A;  1JCS B;  4J5T A;  4ZH1 A;  3HXD B;  3SFY B;  4L6X A;  3HXE B;  3KLS A;  3M7B A;  5GW7 A;  3D5R A;  2G02 A;  3ANI A;  1KS8 A;  3WKH A;  4Z4L A;  1O1S B;  2WY7 A;  2JF4 A;  1UG9 A;  1G6I A;  3Q79 B;  1V7X A;  1N95 B;  1KKT A;  4KKJ A;  3DSS B;  1G9J A;  1FT2 B;  1TN7 B;  1N4P B;  3M7E A;  2WY8 A;  3Q7F B;  1CEM A;  1TNY B;  3HXF B;  5JPN B;  2D5J A;  2EAD A;  4FXG B;  3QFY A;  4FUS A;  4D4A A;  3W7W A;  3SDR A;  3VW5 A;  3PZ3 B;  2XQW A;  3H7L A;  1XW2 A;  4TXT A;  3WIR A;  4LNB B;  2ZZR A;  1GHQ A;  3EQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...