3DSWB

Crystal structure of rabggtase(delta lrr; delta ig)in complex with mono-prenylated peptide ser-cys(gg)-ser-cys derivated from rab7
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
325
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 121
structure length 325
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dswB00
1N4SB 1H36A 3E30B 3OXUA 2PMVA 2R2LB 2SQCA 1O1TB 2G02A 1TNZB 4D4AA 1LTXB 3C72B 4ZH1A 1H37A 3SFXB 2PN5A 4GTVB 1NL4B 3HXBB 3KQ4A 5FO9B 1D8DB 4BOJA 5FO8B 2H6FB 1H3CA 1TN8B 3DSUB 3EU5B 3Q7FB 1TNUB 2ZIRB 4KKIA 1QSJA 3KSQB 4ZRPA 3D5SA 4EHMB 2H6HB 3DPYB 1GXNA 1W6KA 3EUVB 1QQFA 1GXOA 4BOKA 4YDEB 3PZ3B 1O1RB 1N4PB 4GTOB 1O6QA 3DSTB 5JPNB 1O5MB 4GTMB 5FO7B 1R76A 1GSZA 2BB5A 2WY8A 1KZPB 3CU7A 3HXCB 1UMPA 3Q75B 3K7XA 1SA4B 3SFYB 3DSXB 1H3BA 1N95B 1KZOB 2B39A 4FXKB 4GTTB 4C1SA 2XQWA 1D8EB 4ONTA 1N94B 1SQCA 4GTPB 1H39A 5AGDA 4GTRB 1GHQA 3E33B 1DCEB 3Q79B 1FPPB 3DSVB 2F0YB 3KLSA 3PZ1B 3E34B 3OEDA 1SA5B 3RJ3A 2G0DA 1TNYB 4YDOB 4V1RA 4M76A 2A73B 2IEJB 1TN6B 3D5RA 4GTSB 3DSSB 4FXGB 1FT2B 1HZFA 3DRAB 4D4BA 4D4DA 2BBCA 1W6JA 2V8JA 2BB6A 1H3AA 3Q7AB 3E32B 4D94A 1H35A 3PZ2B 2BEDB 2V8KA 1MZCB 1O6RA 3E37B 3HXDB 1JCQB 1QBQB 2H6GB 3G6JB 5JPMB 3Q78B 1S64B 3PZ4B 2NOJA 4LNVA 1N9AB 3KSLB 2V3PA 1TN7B 1LD8B 2V8IA 4D4CA 2ZISB 1JCSB 3HXEB 1O6HA 4KKJA 4LNGB 4MBGB 1N4RB 3DSWB 1O1SB 2XWJB 1LD7B 1O79A 1TNBB 2I07B 1C3DA 2GOXA 4MU9A 1FT1B 5FOBB 2H6IB 3HXFB 4L9PB 1S63B 2WIIB 4LNBB 2XWBB 1JCRB 3Q73B 1GXMA 4V1SA 2WY7A 2WINB 4ZRQA 1X81B 3SQCA 1NI1B 1TNOB 2V3NA 4GTQB 1N4QB
chains in the Genus database with same CATH superfamily
3AFJA 2PMVA 1N7RA 3VXDA 2G02A 1G87A 4LIXA 1KRFA 3ANJA 5IK0A 1ULVA 4OK4A 4WU0A 4WVBA 1K72A 3E7JA 4OJZA 2DRSA 3E73A 1FP3A 3KQ4A 3M78A 1WU4A 1D8DB 4OZWA 2FUTA 3W7XA 1H3CA 1TN8B 3N0GA 1UT9A 4KKIA 1QSJA 3G4FA 4WVCA 1WU6A 3QSPA 5GY3A 3SDVA 3WIWA 3QWTA 3PYAA 2H6HB 3DPYB 3X17A 3GT5A 1W6KA 4TF4A 1QQFA 4YDEB 3PZ3B 1O1RB 5ILZA 2BB5A 3W7UA 2AHGA 1CB8A 1F9GA 1GA2A 2WYNA 3K7XA 1FBOA 3WIRA 2B39A 5IKAA 3H3KA 5ILKA 3QT9A 4OZVA 5CZLA 4Q88A 1H39A 3D3IA 4FNVA 3S4BA 3M73A 3SAEA 1FPPB 2F0YB 1NXCA 3KLSA 3E34B 1SA5B 4Z4JA 1DOGA 1RWHA 2G0DA 5IL3A 3G4DA 3QPFA 1LOHA 4M76A 2A73B 1LXMA 3P5RA 5GZKA 1N20A 1HZFA 3DRAB 3SDRA 5IL8A 3Q7AB 1H3AA 1FO2A 3HXDB 3S4AA 3PYBA 3H2WA 3ACTA 3RENA 1HN0A 4LNVA 2V3PA 2EAEA 1LD8B 2DRRA 1KS8A 1HMWA 1O6HA 1IS9A 1FAEA 2AHFA 4LNGB 3K11A 1O1SB 2QNOA 2FUZA 3ANKA 5EASA 1W3YA 1FT1B 1KSCA 4AYQA 2P0VA 2ONHA 1N7NA 1KSDA 1KKTA 2Q1FA 4LNBB 1N24A 2XWBB 1G9JA 2WDAA 4RNQA 4KTPA 1RWFA 1RQ5A 2JJBA 1UG9A 3ON6A 4AYPA 3E30B 1V5CA 2EADA 1TNZB 1J0NA 1VD5A 2GH4A 1LTXB 1H37A 3M74A 5DHKA 3QXFA 3HXBB 3RX5A 4OK2A 4BOJA 1EGUA 5FO8B 5EAUA 3WKHA 3Q7FB 3ANIA 2FV1A 2ZZRA 4ZRPA 2D5JA 3CIHA 3E80A 5IM1A 4EHMB 1X1HA 3WKGA 1XWQA 3NFVA 3W5NA 5DGRA 5E2JA 2XFGA 4GTOB 4FJQA 3EZ8A 5JPNB 3W7SA 3GZKA 3CU7A 3SFYB 1H54A 3LZ9A 3M7EA 2FBAA 2XQWA 1D8EB 4CJ1A 4Z4LA 1SQCA 3TF4A 1N7PA 3E33B 1DCEB 3DSVB 3RRSA 1N22A 5M7IA 1J0MA 1AGMA 3M7LA 1L2AA 1HM3A 1GAHA 3RJ3A 1G6IA 1TNYB 3EQAA 1V7WA 3M7BA 2IEJB 3VSMA 3D5RA 4FXGB 4D4DA 1C82A 2BBCA 2V8JA 4D94A 2BEDB 2V8KA 3VW5A 4NEIA 1F9DA 1QBQB 4MMHA 3Q78B 3WKIA 5GW7A 2ZISB 4KKJA 2F6DA 2A8ZA 3M7CA 2XWJB 3ACSA 2I07B 5ILJA 2GOXA 4MU9A 1WU5A 5FOBB 1X1IA 5IK6A 2FUQA 4L9PB 2WIIB 3SDTA 3AFLA 4EL8A 4AYRA 3Q73B 2EABA 2WY7A 2WINB 3RX8A 1X81B 3SQCA 1FCEA 2DRQA 2V3NA 3OXUA 4GL3A 2SQCA 1O1TB 1N23A 3S4DA 4ZH1A 2PN5A 4GTVB 1X1JA 1RWGA 4KTRA 1LF6A 1NL4B 2GZ6A 3T33A 3M02A 1IA7A 3M72A 4DOEA 3KSQB 2CQSA 3QDEA 1XW2A 3M76A 1FMIA 3EUVB 4BOKA 3VSNA 1N21A 1O5MB 1R76A 1OJMA 1KZPB 3HXCB 1DL2A 2JF4A 4GAXA 1H3BA 1XWTA 1KZOB 4GTTB 2RI9A 4ONTA 2OKXA 1N94B 2ONGA 2YIKA 5AGDA 1GHQA 1RW9A 1H12A 3Q79B 3W7WA 5ILDA 1H14A 1V7VA 3A3VA 1N1ZA 1RWAA 3PZ1B 3WIQA 5KKBA 2FV0A 5CD2A 3GLYA 2J5CA 2BRPA 2BRWA 4YDOB 5JMDA 1V7XA 3QT3A 4MMIA 4L0GA 5JMFA 1HXAA 4GTSB 1HXCA 3PMMA 3DSSB 4L6XA 1OJOA 4TXTA 2B4FA 1H35A 3E37B 1MZCB 1O6RA 5DGQA 1JCQB 3WKFA 2H6GB 3PZ4B 4J5TA 1N9AB 3KSLB 4D4CA 1TN7B 2V8IA 1HXGA 3EU8A 4YCRA 1JCSB 3HXEB 3A0OA 3M71A 5ILIA 4MBGB 1N4RB 3DSWB 1LD7B 2E22A 4JJJA 1TNBB 3WC3A 1C3DA 1HMUA 1HV6A 3HXFB 3S4CA 3S9VA 1JCRB 2BRVX 4V1SA 1I8QA 1HCUA 3P2CA 3H7LA 4ZRQA 3E6UA 1NI1B 1TNOB 2VN7A 1N4SB 1X9DA 1H36A 2R2LB 5IKHA 1HX9A 4D4AA 5EATA 3C72B 3SFXB 5IK9A 2X03A 1NC5A 3M00A 5M7YA 4ZG8A 5FO9B 1LXKA 2H6FB 1G9GA 3DSUB 3EU5B 1TNUB 4WVAA 2ZIRB 4Q2BA 2Z07A 4E1YA 4ZH5A 1IA6A 3D5SA 2JG0A 1GXNA 3M75A 3M01A 1GXOA 5DHIA 1N4PB 1O6QA 3DSTB 2NVPA 4QT9A 4GTMB 5FO7B 2VN4A 1GSZA 2WY8A 1UMPA 3Q75B 3QXQA 5ILHA 1SA4B 3DSXB 3QFYA 1N95B 1RWCA 3SDUA 4FXKB 4C1SA 1LF9A 1CLCA 3QFZA 4XUVA 2EACA 5ILYA 4GTPB 4GTRB 1L1YA 4DODA 2RGKA 2DROA 3OEDA 1FO3A 3NNBA 3P5PA 2D8LA 3WUXA 1OJNA 3QG0A 4V1RA 1V5DA 1TN6B 2E24A 2WCOA 1FT2B 1N1BA 1N7QA 4D4BA 1KWFA 1W6JA 2BB6A 3W7TA 3W5MA 3E32B 3PZ2B 1FBWA 1N7OA 3G6JB 4AYOA 1TF4A 5JPMB 4FUSA 5C05A 1S64B 2NOJA 1JS4A 4CJ0A 4DI5A 1CEMA 1F1SA 3M77A 1AYXA 4F10A 1O79A 1KFGA 1QAZA 2H6IB 3N0FA 5MEHA 1GLMA 1KREA 1S63B 1F9OA 1H13A 3SDQA 2ZBLA 4F13A 1HM2A 1WZZA 2AFAA 4CE7A 3RSYA 1GXMA 3QRYA 1GAIA 2CQTA 5CA3A 3RX7A 4GTQB 1OJPA 2RI8A 1N4QB
chains in the Genus database with same CATH topology
3AFJA 2PMVA 3VXDA 2G02A 1G87A 4LIXA 1KRFA 3ANJA 1ULVA 4WU0A 4WVBA 1K72A 2DRSA 3E73A 1FP3A 3KQ4A 3M78A 1WU4A 1D8DB 3W7XA 1H3CA 1TN8B 1UT9A 4KKIA 1QSJA 4WVCA 1WU6A 3QSPA 5GY3A 3SDVA 3WIWA 3QWTA 3PYAA 2H6HB 3DPYB 3X17A 3GT5A 1W6KA 4TF4A 1QQFA 4YDEB 3PZ3B 1O1RB 2BB5A 3W7UA 2AHGA 1GA2A 2WYNA 3K7XA 1FBOA 3WIRA 2B39A 3H3KA 3QT9A 5CZLA 4Q88A 1H39A 3D3IA 3S4BA 3M73A 3SAEA 1FPPB 2F0YB 1NXCA 3KLSA 3E34B 1SA5B 4Z4JA 1DOGA 2G0DA 3QPFA 4M76A 2A73B 3P5RA 5GZKA 3SDRA 1HZFA 3DRAB 3Q7AB 1H3AA 1FO2A 3HXDB 3S4AA 3PYBA 3H2WA 3ACTA 3RENA 4LNVA 2V3PA 2EAEA 1LD8B 2DRRA 1KS8A 1O6HA 1IS9A 1FAEA 2AHFA 4LNGB 3K11A 1O1SB 2QNOA 2FUZA 3ANKA 1FT1B 1KSCA 4AYQA 2P0VA 1KSDA 1KKTA 4LNBB 2XWBB 1G9JA 4KTPA 1RQ5A 2JJBA 1UG9A 3ON6A 4AYPA 3E30B 1V5CA 2EADA 1TNZB 1VD5A 2GH4A 1LTXB 1H37A 3M74A 3QXFA 3HXBB 3RX5A 4BOJA 5FO8B 3WKHA 3Q7FB 3ANIA 2FV1A 2ZZRA 4ZRPA 2D5JA 3CIHA 4EHMB 3WKGA 1XWQA 3W5NA 5DGRA 5E2JA 2XFGA 4GTOB 3EZ8A 5JPNB 3W7SA 3GZKA 3CU7A 3SFYB 1H54A 3M7EA 2FBAA 2XQWA 1D8EB 4CJ1A 4Z4LA 1SQCA 3TF4A 3E33B 1DCEB 3DSVB 3RRSA 5M7IA 1AGMA 3M7LA 1L2AA 1GAHA 3RJ3A 1G6IA 1TNYB 3EQAA 1V7WA 3M7BA 2IEJB 3D5RA 4FXGB 4D4DA 2BBCA 2V8JA 4D94A 2BEDB 2V8KA 3VW5A 1F9DA 1QBQB 3Q78B 3WKIA 5GW7A 2ZISB 4KKJA 2F6DA 2A8ZA 3M7CA 2XWJB 3ACSA 2I07B 2GOXA 4MU9A 1WU5A 5FOBB 4L9PB 2WIIB 3SDTA 4EL8A 4AYRA 3Q73B 2EABA 2WY7A 2WINB 3RX8A 1X81B 3SQCA 1FCEA 2DRQA 2V3NA 3OXUA 4GL3A 2SQCA 1O1TB 3S4DA 4ZH1A 2PN5A 4GTVB 4KTRA 1LF6A 1NL4B 2GZ6A 3T33A 1IA7A 3M72A 4DOEA 3KSQB 2CQSA 3QDEA 1XW2A 3M76A 1FMIA 3EUVB 4BOKA 1O5MB 1R76A 1KZPB 3HXCB 1DL2A 2JF4A 1H3BA 1XWTA 1KZOB 4GTTB 2RI9A 4ONTA 2OKXA 1N94B 2YIKA 5AGDA 1GHQA 1H12A 3Q79B 3W7WA 1H14A 1V7VA 3A3VA 3PZ1B 3WIQA 5KKBA 2FV0A 5CD2A 3GLYA 4YDOB 1V7XA 3QT3A 4L0GA 4GTSB 3PMMA 3DSSB 4L6XA 4TXTA 2B4FA 1H35A 3E37B 1MZCB 1O6RA 5DGQA 1JCQB 3WKFA 2H6GB 3PZ4B 4J5TA 1N9AB 3KSLB 4D4CA 1TN7B 2V8IA 3EU8A 4YCRA 1JCSB 3HXEB 3M71A 4MBGB 1N4RB 3DSWB 1LD7B 4JJJA 1TNBB 3WC3A 1C3DA 3HXFB 3S4CA 3S9VA 1JCRB 4V1SA 1HCUA 3P2CA 3H7LA 4ZRQA 3E6UA 1NI1B 1TNOB 2VN7A 1N4SB 1X9DA 1H36A 2R2LB 4D4AA 3C72B 3SFXB 1NC5A 5M7YA 4ZG8A 5FO9B 2H6FB 1G9GA 3DSUB 3EU5B 1TNUB 4WVAA 2ZIRB 4Q2BA 2Z07A 4ZH5A 1IA6A 3D5SA 2JG0A 1GXNA 3M75A 1GXOA 1N4PB 1O6QA 3DSTB 2NVPA 4QT9A 4GTMB 5FO7B 2VN4A 1GSZA 2WY8A 1UMPA 3Q75B 3QXQA 1SA4B 3DSXB 3QFYA 1N95B 3SDUA 4FXKB 4C1SA 1LF9A 1CLCA 3QFZA 4XUVA 2EACA 4GTPB 4GTRB 1L1YA 4DODA 2RGKA 2DROA 3OEDA 1FO3A 3P5PA 2D8LA 3WUXA 3QG0A 4V1RA 1V5DA 1TN6B 1FT2B 4D4BA 1KWFA 1W6JA 2BB6A 3W7TA 3W5MA 3E32B 3PZ2B 1FBWA 3G6JB 4AYOA 1TF4A 5JPMB 4FUSA 1S64B 2NOJA 1JS4A 4CJ0A 1CEMA 3M77A 1AYXA 1O79A 1KFGA 2H6IB 5MEHA 1GLMA 1KREA 1S63B 1F9OA 1H13A 3SDQA 2ZBLA 1WZZA 2AFAA 4CE7A 3RSYA 1GXMA 3QRYA 1GAIA 2CQTA 5CA3A 3RX7A 4GTQB 2RI8A 1N4QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4S B;  1H36 A;  3E30 B;  3OXU A;  2PMV A;  2R2L B;  2SQC A;  1O1T B;  2G02 A;  1TNZ B;  4D4A A;  1LTX B;  3C72 B;  4ZH1 A;  1H37 A;  3SFX B;  2PN5 A;  4GTV B;  1NL4 B;  3HXB B;  3KQ4 A;  5FO9 B;  1D8D B;  4BOJ A;  5FO8 B;  2H6F B;  1H3C A;  1TN8 B;  3DSU B;  3EU5 B;  3Q7F B;  1TNU B;  2ZIR B;  4KKI A;  1QSJ A;  3KSQ B;  4ZRP A;  3D5S A;  4EHM B;  2H6H B;  3DPY B;  1GXN A;  1W6K A;  3EUV B;  1QQF A;  1GXO A;  4BOK A;  4YDE B;  3PZ3 B;  1O1R B;  1N4P B;  4GTO B;  1O6Q A;  3DST B;  5JPN B;  1O5M B;  4GTM B;  5FO7 B;  1R76 A;  1GSZ A;  2BB5 A;  2WY8 A;  1KZP B;  3CU7 A;  3HXC B;  1UMP A;  3Q75 B;  3K7X A;  1SA4 B;  3SFY B;  3DSX B;  1H3B A;  1N95 B;  1KZO B;  2B39 A;  4FXK B;  4GTT B;  4C1S A;  2XQW A;  1D8E B;  4ONT A;  1N94 B;  1SQC A;  4GTP B;  1H39 A;  5AGD A;  4GTR B;  1GHQ A;  3E33 B;  1DCE B;  3Q79 B;  1FPP B;  3DSV B;  2F0Y B;  3KLS A;  3PZ1 B;  3E34 B;  3OED A;  1SA5 B;  3RJ3 A;  2G0D A;  1TNY B;  4YDO B;  4V1R A;  4M76 A;  2A73 B;  2IEJ B;  1TN6 B;  3D5R A;  4GTS B;  3DSS B;  4FXG B;  1FT2 B;  1HZF A;  3DRA B;  4D4B A;  4D4D A;  2BBC A;  1W6J A;  2V8J A;  2BB6 A;  1H3A A;  3Q7A B;  3E32 B;  4D94 A;  1H35 A;  3PZ2 B;  2BED B;  2V8K A;  1MZC B;  1O6R A;  3E37 B;  3HXD B;  1JCQ B;  1QBQ B;  2H6G B;  3G6J B;  5JPM B;  3Q78 B;  1S64 B;  3PZ4 B;  2NOJ A;  4LNV A;  1N9A B;  3KSL B;  2V3P A;  1TN7 B;  1LD8 B;  2V8I A;  4D4C A;  2ZIS B;  1JCS B;  3HXE B;  1O6H A;  4KKJ A;  4LNG B;  4MBG B;  1N4R B;  3DSW B;  1O1S B;  2XWJ B;  1LD7 B;  1O79 A;  1TNB B;  2I07 B;  1C3D A;  2GOX A;  4MU9 A;  1FT1 B;  5FOB B;  2H6I B;  3HXF B;  4L9P B;  1S63 B;  2WII B;  4LNB B;  2XWB B;  1JCR B;  3Q73 B;  1GXM A;  4V1S A;  2WY7 A;  2WIN B;  4ZRQ A;  1X81 B;  3SQC A;  1NI1 B;  1TNO B;  2V3N A;  4GTQ B;  1N4Q B; 
#chains in the Genus database with same CATH topology
 3AFJ A;  2PMV A;  1N7R A;  3VXD A;  2G02 A;  1G87 A;  4LIX A;  1KRF A;  3ANJ A;  5IK0 A;  1ULV A;  4OK4 A;  4WU0 A;  4WVB A;  1K72 A;  3E7J A;  4OJZ A;  2DRS A;  3E73 A;  1FP3 A;  3KQ4 A;  3M78 A;  1WU4 A;  1D8D B;  4OZW A;  2FUT A;  3W7X A;  1H3C A;  1TN8 B;  3N0G A;  1UT9 A;  4KKI A;  1QSJ A;  3G4F A;  4WVC A;  1WU6 A;  3QSP A;  5GY3 A;  3SDV A;  3WIW A;  3QWT A;  3PYA A;  2H6H B;  3DPY B;  3X17 A;  3GT5 A;  1W6K A;  4TF4 A;  1QQF A;  4YDE B;  3PZ3 B;  1O1R B;  5ILZ A;  2BB5 A;  3W7U A;  2AHG A;  1CB8 A;  1F9G A;  1GA2 A;  2WYN A;  3K7X A;  1FBO A;  3WIR A;  2B39 A;  5IKA A;  3H3K A;  5ILK A;  3QT9 A;  4OZV A;  5CZL A;  4Q88 A;  1H39 A;  3D3I A;  4FNV A;  3S4B A;  3M73 A;  3SAE A;  1FPP B;  2F0Y B;  1NXC A;  3KLS A;  3E34 B;  1SA5 B;  4Z4J A;  1DOG A;  1RWH A;  2G0D A;  5IL3 A;  3G4D A;  3QPF A;  1LOH A;  4M76 A;  2A73 B;  1LXM A;  3P5R A;  5GZK A;  1N20 A;  1HZF A;  3DRA B;  3SDR A;  5IL8 A;  3Q7A B;  1H3A A;  1FO2 A;  3HXD B;  3S4A A;  3PYB A;  3H2W A;  3ACT A;  3REN A;  1HN0 A;  4LNV A;  2V3P A;  2EAE A;  1LD8 B;  2DRR A;  1KS8 A;  1HMW A;  1O6H A;  1IS9 A;  1FAE A;  2AHF A;  4LNG B;  3K11 A;  1O1S B;  2QNO A;  2FUZ A;  3ANK A;  5EAS A;  1W3Y A;  1FT1 B;  1KSC A;  4AYQ A;  2P0V A;  2ONH A;  1N7N A;  1KSD A;  1KKT A;  2Q1F A;  4LNB B;  1N24 A;  2XWB B;  1G9J A;  2WDA A;  4RNQ A;  4KTP A;  1RWF A;  1RQ5 A;  2JJB A;  1UG9 A;  3ON6 A;  4AYP A;  3E30 B;  1V5C A;  2EAD A;  1TNZ B;  1J0N A;  1VD5 A;  2GH4 A;  1LTX B;  1H37 A;  3M74 A;  5DHK A;  3QXF A;  3HXB B;  3RX5 A;  4OK2 A;  4BOJ A;  1EGU A;  5FO8 B;  5EAU A;  3WKH A;  3Q7F B;  3ANI A;  2FV1 A;  2ZZR A;  4ZRP A;  2D5J A;  3CIH A;  3E80 A;  5IM1 A;  4EHM B;  1X1H A;  3WKG A;  1XWQ A;  3NFV A;  3W5N A;  5DGR A;  5E2J A;  2XFG A;  4GTO B;  4FJQ A;  3EZ8 A;  5JPN B;  3W7S A;  3GZK A;  3CU7 A;  3SFY B;  1H54 A;  3LZ9 A;  3M7E A;  2FBA A;  2XQW A;  1D8E B;  4CJ1 A;  4Z4L A;  1SQC A;  3TF4 A;  1N7P A;  3E33 B;  1DCE B;  3DSV B;  3RRS A;  1N22 A;  5M7I A;  1J0M A;  1AGM A;  3M7L A;  1L2A A;  1HM3 A;  1GAH A;  3RJ3 A;  1G6I A;  1TNY B;  3EQA A;  1V7W A;  3M7B A;  2IEJ B;  3VSM A;  3D5R A;  4FXG B;  4D4D A;  1C82 A;  2BBC A;  2V8J A;  4D94 A;  2BED B;  2V8K A;  3VW5 A;  4NEI A;  1F9D A;  1QBQ B;  4MMH A;  3Q78 B;  3WKI A;  5GW7 A;  2ZIS B;  4KKJ A;  2F6D A;  2A8Z A;  3M7C A;  2XWJ B;  3ACS A;  2I07 B;  5ILJ A;  2GOX A;  4MU9 A;  1WU5 A;  5FOB B;  1X1I A;  5IK6 A;  2FUQ A;  4L9P B;  2WII B;  3SDT A;  3AFL A;  4EL8 A;  4AYR A;  3Q73 B;  2EAB A;  2WY7 A;  2WIN B;  3RX8 A;  1X81 B;  3SQC A;  1FCE A;  2DRQ A;  2V3N A;  3OXU A;  4GL3 A;  2SQC A;  1O1T B;  1N23 A;  3S4D A;  4ZH1 A;  2PN5 A;  4GTV B;  1X1J A;  1RWG A;  4KTR A;  1LF6 A;  1NL4 B;  2GZ6 A;  3T33 A;  3M02 A;  1IA7 A;  3M72 A;  4DOE A;  3KSQ B;  2CQS A;  3QDE A;  1XW2 A;  3M76 A;  1FMI A;  3EUV B;  4BOK A;  3VSN A;  1N21 A;  1O5M B;  1R76 A;  1OJM A;  1KZP B;  3HXC B;  1DL2 A;  2JF4 A;  4GAX A;  1H3B A;  1XWT A;  1KZO B;  4GTT B;  2RI9 A;  4ONT A;  2OKX A;  1N94 B;  2ONG A;  2YIK A;  5AGD A;  1GHQ A;  1RW9 A;  1H12 A;  3Q79 B;  3W7W A;  5ILD A;  1H14 A;  1V7V A;  3A3V A;  1N1Z A;  1RWA A;  3PZ1 B;  3WIQ A;  5KKB A;  2FV0 A;  5CD2 A;  3GLY A;  2J5C A;  2BRP A;  2BRW A;  4YDO B;  5JMD A;  1V7X A;  3QT3 A;  4MMI A;  4L0G A;  5JMF A;  1HXA A;  4GTS B;  1HXC A;  3PMM A;  3DSS B;  4L6X A;  1OJO A;  4TXT A;  2B4F A;  1H35 A;  3E37 B;  1MZC B;  1O6R A;  5DGQ A;  1JCQ B;  3WKF A;  2H6G B;  3PZ4 B;  4J5T A;  1N9A B;  3KSL B;  4D4C A;  1TN7 B;  2V8I A;  1HXG A;  3EU8 A;  4YCR A;  1JCS B;  3HXE B;  3A0O A;  3M71 A;  5ILI A;  4MBG B;  1N4R B;  3DSW B;  1LD7 B;  2E22 A;  4JJJ A;  1TNB B;  3WC3 A;  1C3D A;  1HMU A;  1HV6 A;  3HXF B;  3S4C A;  3S9V A;  1JCR B;  2BRV X;  4V1S A;  1I8Q A;  1HCU A;  3P2C A;  3H7L A;  4ZRQ A;  3E6U A;  1NI1 B;  1TNO B;  2VN7 A;  1N4S B;  1X9D A;  1H36 A;  2R2L B;  5IKH A;  1HX9 A;  4D4A A;  5EAT A;  3C72 B;  3SFX B;  5IK9 A;  2X03 A;  1NC5 A;  3M00 A;  5M7Y A;  4ZG8 A;  5FO9 B;  1LXK A;  2H6F B;  1G9G A;  3DSU B;  3EU5 B;  1TNU B;  4WVA A;  2ZIR B;  4Q2B A;  2Z07 A;  4E1Y A;  4ZH5 A;  1IA6 A;  3D5S A;  2JG0 A;  1GXN A;  3M75 A;  3M01 A;  1GXO A;  5DHI A;  1N4P B;  1O6Q A;  3DST B;  2NVP A;  4QT9 A;  4GTM B;  5FO7 B;  2VN4 A;  1GSZ A;  2WY8 A;  1UMP A;  3Q75 B;  3QXQ A;  5ILH A;  1SA4 B;  3DSX B;  3QFY A;  1N95 B;  1RWC A;  3SDU A;  4FXK B;  4C1S A;  1LF9 A;  1CLC A;  3QFZ A;  4XUV A;  2EAC A;  5ILY A;  4GTP B;  4GTR B;  1L1Y A;  4DOD A;  2RGK A;  2DRO A;  3OED A;  1FO3 A;  3NNB A;  3P5P A;  2D8L A;  3WUX A;  1OJN A;  3QG0 A;  4V1R A;  1V5D A;  1TN6 B;  2E24 A;  2WCO A;  1FT2 B;  1N1B A;  1N7Q A;  4D4B A;  1KWF A;  1W6J A;  2BB6 A;  3W7T A;  3W5M A;  3E32 B;  3PZ2 B;  1FBW A;  1N7O A;  3G6J B;  4AYO A;  1TF4 A;  5JPM B;  4FUS A;  5C05 A;  1S64 B;  2NOJ A;  1JS4 A;  4CJ0 A;  4DI5 A;  1CEM A;  1F1S A;  3M77 A;  1AYX A;  4F10 A;  1O79 A;  1KFG A;  1QAZ A;  2H6I B;  3N0F A;  5MEH A;  1GLM A;  1KRE A;  1S63 B;  1F9O A;  1H13 A;  3SDQ A;  2ZBL A;  4F13 A;  1HM2 A;  1WZZ A;  2AFA A;  4CE7 A;  3RSY A;  1GXM A;  3QRY A;  1GAI A;  2CQT A;  5CA3 A;  3RX7 A;  4GTQ B;  1OJP A;  2RI8 A;  1N4Q B; 
#chains in the Genus database with same CATH homology
 3AFJ A;  2PMV A;  3VXD A;  2G02 A;  1G87 A;  4LIX A;  1KRF A;  3ANJ A;  1ULV A;  4WU0 A;  4WVB A;  1K72 A;  2DRS A;  3E73 A;  1FP3 A;  3KQ4 A;  3M78 A;  1WU4 A;  1D8D B;  3W7X A;  1H3C A;  1TN8 B;  1UT9 A;  4KKI A;  1QSJ A;  4WVC A;  1WU6 A;  3QSP A;  5GY3 A;  3SDV A;  3WIW A;  3QWT A;  3PYA A;  2H6H B;  3DPY B;  3X17 A;  3GT5 A;  1W6K A;  4TF4 A;  1QQF A;  4YDE B;  3PZ3 B;  1O1R B;  2BB5 A;  3W7U A;  2AHG A;  1GA2 A;  2WYN A;  3K7X A;  1FBO A;  3WIR A;  2B39 A;  3H3K A;  3QT9 A;  5CZL A;  4Q88 A;  1H39 A;  3D3I A;  3S4B A;  3M73 A;  3SAE A;  1FPP B;  2F0Y B;  1NXC A;  3KLS A;  3E34 B;  1SA5 B;  4Z4J A;  1DOG A;  2G0D A;  3QPF A;  4M76 A;  2A73 B;  3P5R A;  5GZK A;  3SDR A;  1HZF A;  3DRA B;  3Q7A B;  1H3A A;  1FO2 A;  3HXD B;  3S4A A;  3PYB A;  3H2W A;  3ACT A;  3REN A;  4LNV A;  2V3P A;  2EAE A;  1LD8 B;  2DRR A;  1KS8 A;  1O6H A;  1IS9 A;  1FAE A;  2AHF A;  4LNG B;  3K11 A;  1O1S B;  2QNO A;  2FUZ A;  3ANK A;  1FT1 B;  1KSC A;  4AYQ A;  2P0V A;  1KSD A;  1KKT A;  4LNB B;  2XWB B;  1G9J A;  4KTP A;  1RQ5 A;  2JJB A;  1UG9 A;  3ON6 A;  4AYP A;  3E30 B;  1V5C A;  2EAD A;  1TNZ B;  1VD5 A;  2GH4 A;  1LTX B;  1H37 A;  3M74 A;  3QXF A;  3HXB B;  3RX5 A;  4BOJ A;  5FO8 B;  3WKH A;  3Q7F B;  3ANI A;  2FV1 A;  2ZZR A;  4ZRP A;  2D5J A;  3CIH A;  4EHM B;  3WKG A;  1XWQ A;  3W5N A;  5DGR A;  5E2J A;  2XFG A;  4GTO B;  3EZ8 A;  5JPN B;  3W7S A;  3GZK A;  3CU7 A;  3SFY B;  1H54 A;  3M7E A;  2FBA A;  2XQW A;  1D8E B;  4CJ1 A;  4Z4L A;  1SQC A;  3TF4 A;  3E33 B;  1DCE B;  3DSV B;  3RRS A;  5M7I A;  1AGM A;  3M7L A;  1L2A A;  1GAH A;  3RJ3 A;  1G6I A;  1TNY B;  3EQA A;  1V7W A;  3M7B A;  2IEJ B;  3D5R A;  4FXG B;  4D4D A;  2BBC A;  2V8J A;  4D94 A;  2BED B;  2V8K A;  3VW5 A;  1F9D A;  1QBQ B;  3Q78 B;  3WKI A;  5GW7 A;  2ZIS B;  4KKJ A;  2F6D A;  2A8Z A;  3M7C A;  2XWJ B;  3ACS A;  2I07 B;  2GOX A;  4MU9 A;  1WU5 A;  5FOB B;  4L9P B;  2WII B;  3SDT A;  4EL8 A;  4AYR A;  3Q73 B;  2EAB A;  2WY7 A;  2WIN B;  3RX8 A;  1X81 B;  3SQC A;  1FCE A;  2DRQ A;  2V3N A;  3OXU A;  4GL3 A;  2SQC A;  1O1T B;  3S4D A;  4ZH1 A;  2PN5 A;  4GTV B;  4KTR A;  1LF6 A;  1NL4 B;  2GZ6 A;  3T33 A;  1IA7 A;  3M72 A;  4DOE A;  3KSQ B;  2CQS A;  3QDE A;  1XW2 A;  3M76 A;  1FMI A;  3EUV B;  4BOK A;  1O5M B;  1R76 A;  1KZP B;  3HXC B;  1DL2 A;  2JF4 A;  1H3B A;  1XWT A;  1KZO B;  4GTT B;  2RI9 A;  4ONT A;  2OKX A;  1N94 B;  2YIK A;  5AGD A;  1GHQ A;  1H12 A;  3Q79 B;  3W7W A;  1H14 A;  1V7V A;  3A3V A;  3PZ1 B;  3WIQ A;  5KKB A;  2FV0 A;  5CD2 A;  3GLY A;  4YDO B;  1V7X A;  3QT3 A;  4L0G A;  4GTS B;  3PMM A;  3DSS B;  4L6X A;  4TXT A;  2B4F A;  1H35 A;  3E37 B;  1MZC B;  1O6R A;  5DGQ A;  1JCQ B;  3WKF A;  2H6G B;  3PZ4 B;  4J5T A;  1N9A B;  3KSL B;  4D4C A;  1TN7 B;  2V8I A;  3EU8 A;  4YCR A;  1JCS B;  3HXE B;  3M71 A;  4MBG B;  1N4R B;  3DSW B;  1LD7 B;  4JJJ A;  1TNB B;  3WC3 A;  1C3D A;  3HXF B;  3S4C A;  3S9V A;  1JCR B;  4V1S A;  1HCU A;  3P2C A;  3H7L A;  4ZRQ A;  3E6U A;  1NI1 B;  1TNO B;  2VN7 A;  1N4S B;  1X9D A;  1H36 A;  2R2L B;  4D4A A;  3C72 B;  3SFX B;  1NC5 A;  5M7Y A;  4ZG8 A;  5FO9 B;  2H6F B;  1G9G A;  3DSU B;  3EU5 B;  1TNU B;  4WVA A;  2ZIR B;  4Q2B A;  2Z07 A;  4ZH5 A;  1IA6 A;  3D5S A;  2JG0 A;  1GXN A;  3M75 A;  1GXO A;  1N4P B;  1O6Q A;  3DST B;  2NVP A;  4QT9 A;  4GTM B;  5FO7 B;  2VN4 A;  1GSZ A;  2WY8 A;  1UMP A;  3Q75 B;  3QXQ A;  1SA4 B;  3DSX B;  3QFY A;  1N95 B;  3SDU A;  4FXK B;  4C1S A;  1LF9 A;  1CLC A;  3QFZ A;  4XUV A;  2EAC A;  4GTP B;  4GTR B;  1L1Y A;  4DOD A;  2RGK A;  2DRO A;  3OED A;  1FO3 A;  3P5P A;  2D8L A;  3WUX A;  3QG0 A;  4V1R A;  1V5D A;  1TN6 B;  1FT2 B;  4D4B A;  1KWF A;  1W6J A;  2BB6 A;  3W7T A;  3W5M A;  3E32 B;  3PZ2 B;  1FBW A;  3G6J B;  4AYO A;  1TF4 A;  5JPM B;  4FUS A;  1S64 B;  2NOJ A;  1JS4 A;  4CJ0 A;  1CEM A;  3M77 A;  1AYX A;  1O79 A;  1KFG A;  2H6I B;  5MEH A;  1GLM A;  1KRE A;  1S63 B;  1F9O A;  1H13 A;  3SDQ A;  2ZBL A;  1WZZ A;  2AFA A;  4CE7 A;  3RSY A;  1GXM A;  3QRY A;  1GAI A;  2CQT A;  5CA3 A;  3RX7 A;  4GTQ B;  2RI8 A;  1N4Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...