3DSWB

Crystal structure of rabggtase(delta lrr; delta ig)in complex with mono-prenylated peptide ser-cys(gg)-ser-cys derivated from rab7
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
326
structure length
325
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 121
structure length 325
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dswB00
3EU5B 1KZOB 3DSWB 4BOKA 3DSXB 1UMPA 3DSTB 3SQCA 4FXKB 4LNGB 4GTRB 1O6QA 1LD7B 3KLSA 3DSVB 2IEJB 4KKIA 2H6FB 3KSLB 2BB6A 1H35A 1N95B 4GTTB 1N4RB 1SA4B 3Q79B 1N4QB 1TNOB 3E32B 1H37A 1QSJA 2H6GB 1JCSB 2H6HB 1SA5B 3Q7FB 1H39A 3KSQB 1N4PB 2I07B 3PZ4B 1JCQB 4V1SA 1JCRB 4M76A 1N4SB 2ZIRB 3Q78B 4ZRQA 2V8IA 1TN8B 1H3AA 1O1TB 3DSSB 1N94B 4LNBB 4MU9A 5FO7B 2WINB 1W6KA 3PZ1B 1O1RB 3E37B 3HXBB 4MBGB 1FT2B 1KZPB 3HXCB 4D4DA 1GXNA 3K7XA 1GXOA 1SQCA 4EHMB 3D5SA 4GTVB 2V3NA 2WY8A 1D8DB 2BBCA 1MZCB 1TNBB 4YDOB 2WY7A 3Q7AB 4C1SA 4GTSB 1HZFA 2PMVA 4FXGB 3D5RA 2V3PA 3PZ3B 1O1SB 1NI1B 4YDEB 2BEDB 3EUVB 4LNVA 3DRAB 1TNZB 1X81B 1FT1B 2R2LB 1FPPB 3RJ3A 4BOJA 3CU7A 4KKJA 2G02A 3SFYB 3DPYB 3HXFB 1DCEB 1GXMA 1O6HA 4D4CA 4GTOB 1S64B 1S63B 2SQCA 5FO8B 3OEDA 2B39A 4GTQB 3DSUB 4L9PB 5JPMB 2NOJA 1C3DA 2XQWA 2GOXA 2V8JA 4D4BA 1LD8B 3PZ2B 2A73B 1NL4B 2BB5A 4GTPB 4V1RA 2H6IB 1O79A 1TN7B 1H3CA 4ZRPA 1O5MB 2XWJB 4ONTA 1TNYB 3C72B 3KQ4A 3HXDB 5FO9B 3E34B 4D94A 1GSZA 1R76A 3E30B 3E33B 4GTMB 4ZH1A 5JPNB 3SFXB 3G6JB 5FOBB 3OXUA 1TNUB 3Q75B 1LTXB 3HXEB 1H36A 2PN5A 2ZISB 1N9AB 2V8KA 5AGDA 1QBQB 1D8EB 2F0YB 1W6JA 1O6RA 1QQFA 2XWBB 3Q73B 4D4AA 1GHQA 1H3BA 1TN6B 2WIIB 2G0DA
chains in the Genus database with same CATH superfamily
3W5MA 3W7UA 1FCEA 1G87A 3DSWB 1UMPA 3DSTB 3SQCA 5ILDA 3M7CA 4GTRB 4DOEA 2VN7A 2Q1FA 1KRFA 1H35A 1XW2A 4KTRA 2RI9A 1SA4B 1OJOA 1UG9A 4MMHA 1N4QB 2FUQA 3A3VA 4TF4A 2JF4A 3T33A 1N22A 3QT9A 3WKIA 3WIQA 4F13A 3Q7FB 4OK2A 5KKBA 1XWQA 4V1SA 4CE7A 4M76A 4Z4JA 2DRQA 1TN8B 1O1TB 4LNBB 5FO7B 3ANJA 1GAHA 3PZ1B 1O1RB 1F1SA 1IA7A 3WC3A 3M02A 5IKAA 2V3NA 1D8DB 3RSYA 1MZCB 3SDQA 1TNBB 2WY7A 3RENA 1V5DA 1HZFA 2PMVA 4FXGB 2V3PA 3AFLA 3W7WA 1EGUA 2AFAA 1N7OA 4YDEB 2BEDB 2NVPA 3EUVB 1K72A 3DRAB 1TNZB 2J5CA 2JJBA 1FT1B 1KKTA 3RJ3A 1RWFA 4QT9A 5CZLA 3ACSA 1S64B 1S63B 1OJPA 2SQCA 4L9PB 4EL8A 5DHKA 2A8ZA 1F9DA 3QG0A 4J5TA 2D8LA 5IL3A 1N7RA 1FBWA 4GTPB 1H3CA 1TN7B 2QNOA 1O5MB 4ZRPA 1TNYB 5DGRA 5E2JA 1RW9A 2XFGA 3E30B 2EAEA 4DI5A 3M7LA 3Q75B 1HMUA 1LTXB 5ILIA 3HXEB 3P5PA 3QXFA 2E24A 2ZISB 1N9AB 4RNQA 3H7LA 2V8KA 1W6JA 1O6RA 3Q73B 1N1BA 1GHQA 2D5JA 4BOKA 3DSXB 2CQTA 4L6XA 4JJJA 4FXKB 3W7SA 2IEJB 2H6FB 4OK4A 2BB6A 5EASA 3QDEA 1CB8A 1HCUA 1N4RB 1KWFA 2GH4A 3GZKA 1V5CA 2ONGA 3Q79B 4WVAA 2GZ6A 1H37A 3M71A 1JCSB 3A0OA 3M74A 2I07B 2WDAA 1UT9A 1JCRB 1N21A 1N4SB 2ZIRB 4ZRQA 5GZKA 3VXDA 4OZVA 3DSSB 1I8QA 3E7JA 2WINB 2DROA 1ULVA 3E37B 2FUZA 4WU0A 3HXBB 3WIRA 3HXCB 1GXNA 3K7XA 1LOHA 4MMIA 3QSPA 4EHMB 2BRPA 4GTVB 1CEMA 2ZZRA 1FBOA 4YDOB 3RX5A 4GTSB 3VSMA 3D5RA 3PZ3B 1NI1B 3EU8A 3QT3A 3SDVA 1RQ5A 1FP3A 3S4CA 4AYPA 5EAUA 3G4DA 4KTPA 5JMFA 2R2LB 3CU7A 3SFYB 3HXFB 2BRVX 5ILKA 4D4CA 5EATA 1H54A 2B39A 2DRRA 2NOJA 1C3DA 4YCRA 3EQAA 4XUVA 4CJ0A 1GLMA 1N7PA 5IKHA 2A73B 1NL4B 1W3YA 3ANKA 3P2CA 1LF6A 1RWAA 4ONTA 3E80A 5IK6A 3G4FA 2JG0A 1X1IA 1DOGA 3E33B 4GTMB 1G9GA 5IK9A 5CD2A 5FOBB 1TNUB 2EACA 2RI8A 5C05A 2PN5A 4WVCA 5ILJA 1L2AA 1WU5A 3W7XA 1GAIA 2P0VA 1QQFA 4LIXA 1TN6B 3NFVA 1KSDA 5M7YA 1KZOB 3WKHA 1G6IA 3S4AA 1WU6A 3M7BA 1HM2A 4LNGB 3RRSA 3P5RA 2AHFA 4KKIA 3KSLB 4GTTB 3M75A 2EADA 5ILZA 1IS9A 2WYNA 3E32B 2H6GB 4NEIA 3E73A 3WUXA 2H6HB 1SA5B 3SDUA 1H13A 5GW7A 3PZ4B 5MEHA 3NNBA 3Q78B 3S4DA 3E6UA 3QWTA 1J0NA 4MBGB 1FT2B 1HMWA 1OJMA 4D4DA 1GXOA 3QRYA 1X1HA 3D5SA 4OZWA 4Q88A 5JMDA 1G9JA 3M76A 1N7QA 4LNVA 4CJ1A 3M01A 1H12A 1FPPB 4BOJA 1N7NA 3DPYB 1HXGA 1NXCA 1LXMA 4ZH5A 1RWCA 1WU4A 2CQSA 5FO8B 3OEDA 5JPMB 3H2WA 3DSUB 3VW5A 2XQWA 1CLCA 2GOXA 2V8JA 3ANIA 4D4BA 4TXTA 1JS4A 3PZ2B 3RX8A 4V1RA 2H6IB 3N0FA 5CA3A 3W7TA 1O79A 3H3KA 4Z4LA 3C72B 4L0GA 5DHIA 1L1YA 2ONHA 1TF4A 3KQ4A 3HXDB 4ZG8A 3E34B 1HM3A 4D94A 1KFGA 3RX7A 1F9GA 3QFYA 1R76A 3PYBA 4FJQA 3VSNA 3SFXB 2ZBLA 3G6JB 5ILYA 3OXUA 4AYOA 3PMMA 3D3IA 1FO3A 1LXKA 1OJNA 2F0YB 1D8EB 2DRSA 4FNVA 4GAXA 3QFZA 3QPFA 4D4AA 5GY3A 3M72A 2YIKA 3EU5B 4FUSA 3PYAA 3SAEA 1H14A 2BRWA 5IK0A 4AYQA 3S9VA 3WKGA 1V7WA 1O6QA 1LD7B 3KLSA 3DSVB 1C82A 3SDTA 1HX9A 1N95B 3M7EA 3S4BA 1HN0A 1N1ZA 3WIWA 1TNOB 1F9OA 3GLYA 1QSJA 3W5NA 2X03A 3X17A 2AHGA 1H39A 3KSQB 1N4PB 2EABA 1JCQB 3AFJA 4Q2BA 2V8IA 1V7XA 4F10A 1H3AA 4E1YA 3N0GA 1N94B 4MU9A 1W6KA 2F6DA 1KZPB 1RWHA 4DODA 3ON6A 1SQCA 1NC5A 2VN4A 2E22A 2WY8A 2BBCA 3WKFA 1DL2A 3Q7AB 4C1SA 3M77A 2Z07A 5IM1A 5M7IA 1O1SB 3LZ9A 1J0MA 1WZZA 1N20A 3M78A 5ILHA 1X81B 1X1JA 1KSCA 4WVBA 1HXAA 2FV1A 1X9DA 4KKJA 2G02A 1DCEB 1LF9A 1KS8A 2OKXA 1GXMA 4OJZA 1O6HA 4GTOB 1N24A 4GL3A 1XWTA 4GTQB 3SDRA 1IA6A 1GA2A 3TF4A 1KREA 2FUTA 4AYRA 1LD8B 2BB5A 2XWJB 3CIHA 1FO2A 3M00A 3QXQA 1HV6A 3K11A 1AYXA 5FO9B 3GT5A 1GSZA 1N23A 4ZH1A 5JPNB 1VD5A 2FBAA 2WCOA 1HXCA 1AGMA 1H36A 2FV0A 1RWGA 5IL8A 5DGQA 1FAEA 1QAZA 2RGKA 1V7VA 5AGDA 1QBQB 2B4FA 1FMIA 2XWBB 3EZ8A 1H3BA 2WIIB 3ACTA 3M73A 2G0DA
chains in the Genus database with same CATH topology
3W5MA 3W7UA 1FCEA 1G87A 3DSWB 1UMPA 3DSTB 3SQCA 3M7CA 4GTRB 4DOEA 2VN7A 1KRFA 1H35A 1XW2A 4KTRA 2RI9A 1SA4B 1UG9A 1N4QB 3A3VA 4TF4A 2JF4A 3T33A 3WKIA 3QT9A 3WIQA 3Q7FB 5KKBA 1XWQA 4V1SA 4CE7A 4M76A 4Z4JA 2DRQA 1TN8B 1O1TB 4LNBB 5FO7B 3ANJA 1GAHA 3PZ1B 1O1RB 1IA7A 3WC3A 2V3NA 1D8DB 3RSYA 1MZCB 3SDQA 1TNBB 2WY7A 3RENA 1V5DA 1HZFA 2PMVA 4FXGB 2V3PA 3W7WA 2AFAA 4YDEB 2BEDB 2NVPA 3EUVB 1K72A 3DRAB 1TNZB 2JJBA 1FT1B 1KKTA 3RJ3A 4QT9A 5CZLA 3ACSA 1S64B 1S63B 2SQCA 4L9PB 4EL8A 2A8ZA 1F9DA 3QG0A 4J5TA 2D8LA 1FBWA 4GTPB 1H3CA 1TN7B 2QNOA 1O5MB 4ZRPA 1TNYB 5DGRA 5E2JA 2XFGA 3E30B 2EAEA 3M7LA 3Q75B 1LTXB 3HXEB 3P5PA 3QXFA 2ZISB 1N9AB 3H7LA 2V8KA 1W6JA 1O6RA 3Q73B 1GHQA 2D5JA 4BOKA 3DSXB 2CQTA 4L6XA 4JJJA 4FXKB 3W7SA 2IEJB 2H6FB 2BB6A 3QDEA 1HCUA 1N4RB 1KWFA 2GH4A 3GZKA 1V5CA 3Q79B 4WVAA 2GZ6A 1H37A 3M71A 1JCSB 3M74A 2I07B 1UT9A 1JCRB 1N4SB 2ZIRB 4ZRQA 5GZKA 3VXDA 3DSSB 2WINB 2DROA 1ULVA 3E37B 2FUZA 4WU0A 3HXBB 3WIRA 3HXCB 1GXNA 3K7XA 3QSPA 4EHMB 4GTVB 1CEMA 2ZZRA 1FBOA 4YDOB 3RX5A 4GTSB 3D5RA 3PZ3B 1NI1B 3EU8A 3QT3A 3SDVA 1RQ5A 1FP3A 3S4CA 4AYPA 4KTPA 2R2LB 3CU7A 3SFYB 3HXFB 4D4CA 1H54A 2B39A 2DRRA 2NOJA 1C3DA 4YCRA 3EQAA 4XUVA 4CJ0A 1GLMA 2A73B 1NL4B 3P2CA 3ANKA 1LF6A 4ONTA 2JG0A 1DOGA 3E33B 4GTMB 1G9GA 5CD2A 5FOBB 1TNUB 2EACA 2RI8A 2PN5A 4WVCA 1L2AA 1WU5A 3W7XA 1GAIA 2P0VA 1QQFA 4LIXA 1TN6B 1KSDA 5M7YA 1KZOB 3WKHA 1G6IA 3S4AA 1WU6A 3M7BA 4LNGB 3RRSA 3P5RA 2AHFA 4KKIA 3KSLB 4GTTB 3M75A 2EADA 1IS9A 2WYNA 3E32B 2H6GB 3WUXA 3E73A 2H6HB 1SA5B 3SDUA 1H13A 5GW7A 3PZ4B 5MEHA 3Q78B 3S4DA 3E6UA 3QWTA 4MBGB 1FT2B 4D4DA 1GXOA 3QRYA 3D5SA 4Q88A 1G9JA 3M76A 4LNVA 4CJ1A 1H12A 1FPPB 4BOJA 3DPYB 1NXCA 4ZH5A 1WU4A 2CQSA 5FO8B 3OEDA 5JPMB 3H2WA 3DSUB 3VW5A 2XQWA 1CLCA 2GOXA 2V8JA 3ANIA 4D4BA 4TXTA 1JS4A 3PZ2B 3RX8A 4V1RA 2H6IB 5CA3A 3W7TA 1O79A 3H3KA 4Z4LA 3C72B 4L0GA 1L1YA 1TF4A 3KQ4A 3HXDB 4ZG8A 3E34B 4D94A 1KFGA 3RX7A 3QFYA 1R76A 3PYBA 3SFXB 2ZBLA 3G6JB 3OXUA 4AYOA 3PMMA 3D3IA 1FO3A 2F0YB 1D8EB 2DRSA 3QFZA 3QPFA 4D4AA 5GY3A 3M72A 2YIKA 3EU5B 4FUSA 3PYAA 3SAEA 1H14A 4AYQA 3S9VA 3WKGA 1V7WA 1O6QA 1LD7B 3KLSA 3DSVB 3SDTA 1N95B 3M7EA 3S4BA 3WIWA 1TNOB 1F9OA 3GLYA 1QSJA 3W5NA 3X17A 2AHGA 1H39A 3KSQB 1N4PB 2EABA 1JCQB 3AFJA 4Q2BA 2V8IA 1V7XA 1H3AA 4MU9A 1N94B 1W6KA 2F6DA 1KZPB 4DODA 3ON6A 1SQCA 1NC5A 2VN4A 2WY8A 2BBCA 3WKFA 1DL2A 3Q7AB 4C1SA 3M77A 2Z07A 5M7IA 1O1SB 1WZZA 3M78A 1X81B 1KSCA 4WVBA 2FV1A 1X9DA 4KKJA 2G02A 1DCEB 1LF9A 1KS8A 2OKXA 1GXMA 1O6HA 4GTOB 4GL3A 1XWTA 4GTQB 3SDRA 1IA6A 1GA2A 3TF4A 1KREA 4AYRA 1LD8B 2BB5A 2XWJB 3CIHA 1FO2A 3QXQA 3K11A 1AYXA 5FO9B 3GT5A 1GSZA 4ZH1A 5JPNB 1VD5A 2FBAA 1AGMA 1H36A 2FV0A 5DGQA 1FAEA 2RGKA 1V7VA 5AGDA 1QBQB 2B4FA 1FMIA 2XWBB 3EZ8A 1H3BA 2WIIB 3ACTA 3M73A 2G0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU5 B;  1KZO B;  3DSW B;  4BOK A;  3DSX B;  1UMP A;  3DST B;  3SQC A;  4FXK B;  4LNG B;  4GTR B;  1O6Q A;  1LD7 B;  3KLS A;  3DSV B;  2IEJ B;  4KKI A;  2H6F B;  3KSL B;  2BB6 A;  1H35 A;  1N95 B;  4GTT B;  1N4R B;  1SA4 B;  3Q79 B;  1N4Q B;  1TNO B;  3E32 B;  1H37 A;  1QSJ A;  2H6G B;  1JCS B;  2H6H B;  1SA5 B;  3Q7F B;  1H39 A;  3KSQ B;  1N4P B;  2I07 B;  3PZ4 B;  1JCQ B;  4V1S A;  1JCR B;  4M76 A;  1N4S B;  2ZIR B;  3Q78 B;  4ZRQ A;  2V8I A;  1TN8 B;  1H3A A;  1O1T B;  3DSS B;  1N94 B;  4LNB B;  4MU9 A;  5FO7 B;  2WIN B;  1W6K A;  3PZ1 B;  1O1R B;  3E37 B;  3HXB B;  4MBG B;  1FT2 B;  1KZP B;  3HXC B;  4D4D A;  1GXN A;  3K7X A;  1GXO A;  1SQC A;  4EHM B;  3D5S A;  4GTV B;  2V3N A;  2WY8 A;  1D8D B;  2BBC A;  1MZC B;  1TNB B;  4YDO B;  2WY7 A;  3Q7A B;  4C1S A;  4GTS B;  1HZF A;  2PMV A;  4FXG B;  3D5R A;  2V3P A;  3PZ3 B;  1O1S B;  1NI1 B;  4YDE B;  2BED B;  3EUV B;  4LNV A;  3DRA B;  1TNZ B;  1X81 B;  1FT1 B;  2R2L B;  1FPP B;  3RJ3 A;  4BOJ A;  3CU7 A;  4KKJ A;  2G02 A;  3SFY B;  3DPY B;  3HXF B;  1DCE B;  1GXM A;  1O6H A;  4D4C A;  4GTO B;  1S64 B;  1S63 B;  2SQC A;  5FO8 B;  3OED A;  2B39 A;  4GTQ B;  3DSU B;  4L9P B;  5JPM B;  2NOJ A;  1C3D A;  2XQW A;  2GOX A;  2V8J A;  4D4B A;  1LD8 B;  3PZ2 B;  2A73 B;  1NL4 B;  2BB5 A;  4GTP B;  4V1R A;  2H6I B;  1O79 A;  1TN7 B;  1H3C A;  4ZRP A;  1O5M B;  2XWJ B;  4ONT A;  1TNY B;  3C72 B;  3KQ4 A;  3HXD B;  5FO9 B;  3E34 B;  4D94 A;  1GSZ A;  1R76 A;  3E30 B;  3E33 B;  4GTM B;  4ZH1 A;  5JPN B;  3SFX B;  3G6J B;  5FOB B;  3OXU A;  1TNU B;  3Q75 B;  1LTX B;  3HXE B;  1H36 A;  2PN5 A;  2ZIS B;  1N9A B;  2V8K A;  5AGD A;  1QBQ B;  1D8E B;  2F0Y B;  1W6J A;  1O6R A;  1QQF A;  2XWB B;  3Q73 B;  4D4A A;  1GHQ A;  1H3B A;  1TN6 B;  2WII B;  2G0D A; 
#chains in the Genus database with same CATH topology
 3W5M A;  3W7U A;  1FCE A;  1G87 A;  3DSW B;  1UMP A;  3DST B;  3SQC A;  5ILD A;  3M7C A;  4GTR B;  4DOE A;  2VN7 A;  2Q1F A;  1KRF A;  1H35 A;  1XW2 A;  4KTR A;  2RI9 A;  1SA4 B;  1OJO A;  1UG9 A;  4MMH A;  1N4Q B;  2FUQ A;  3A3V A;  4TF4 A;  2JF4 A;  3T33 A;  1N22 A;  3QT9 A;  3WKI A;  3WIQ A;  4F13 A;  3Q7F B;  4OK2 A;  5KKB A;  1XWQ A;  4V1S A;  4CE7 A;  4M76 A;  4Z4J A;  2DRQ A;  1TN8 B;  1O1T B;  4LNB B;  5FO7 B;  3ANJ A;  1GAH A;  3PZ1 B;  1O1R B;  1F1S A;  1IA7 A;  3WC3 A;  3M02 A;  5IKA A;  2V3N A;  1D8D B;  3RSY A;  1MZC B;  3SDQ A;  1TNB B;  2WY7 A;  3REN A;  1V5D A;  1HZF A;  2PMV A;  4FXG B;  2V3P A;  3AFL A;  3W7W A;  1EGU A;  2AFA A;  1N7O A;  4YDE B;  2BED B;  2NVP A;  3EUV B;  1K72 A;  3DRA B;  1TNZ B;  2J5C A;  2JJB A;  1FT1 B;  1KKT A;  3RJ3 A;  1RWF A;  4QT9 A;  5CZL A;  3ACS A;  1S64 B;  1S63 B;  1OJP A;  2SQC A;  4L9P B;  4EL8 A;  5DHK A;  2A8Z A;  1F9D A;  3QG0 A;  4J5T A;  2D8L A;  5IL3 A;  1N7R A;  1FBW A;  4GTP B;  1H3C A;  1TN7 B;  2QNO A;  1O5M B;  4ZRP A;  1TNY B;  5DGR A;  5E2J A;  1RW9 A;  2XFG A;  3E30 B;  2EAE A;  4DI5 A;  3M7L A;  3Q75 B;  1HMU A;  1LTX B;  5ILI A;  3HXE B;  3P5P A;  3QXF A;  2E24 A;  2ZIS B;  1N9A B;  4RNQ A;  3H7L A;  2V8K A;  1W6J A;  1O6R A;  3Q73 B;  1N1B A;  1GHQ A;  2D5J A;  4BOK A;  3DSX B;  2CQT A;  4L6X A;  4JJJ A;  4FXK B;  3W7S A;  2IEJ B;  2H6F B;  4OK4 A;  2BB6 A;  5EAS A;  3QDE A;  1CB8 A;  1HCU A;  1N4R B;  1KWF A;  2GH4 A;  3GZK A;  1V5C A;  2ONG A;  3Q79 B;  4WVA A;  2GZ6 A;  1H37 A;  3M71 A;  1JCS B;  3A0O A;  3M74 A;  2I07 B;  2WDA A;  1UT9 A;  1JCR B;  1N21 A;  1N4S B;  2ZIR B;  4ZRQ A;  5GZK A;  3VXD A;  4OZV A;  3DSS B;  1I8Q A;  3E7J A;  2WIN B;  2DRO A;  1ULV A;  3E37 B;  2FUZ A;  4WU0 A;  3HXB B;  3WIR A;  3HXC B;  1GXN A;  3K7X A;  1LOH A;  4MMI A;  3QSP A;  4EHM B;  2BRP A;  4GTV B;  1CEM A;  2ZZR A;  1FBO A;  4YDO B;  3RX5 A;  4GTS B;  3VSM A;  3D5R A;  3PZ3 B;  1NI1 B;  3EU8 A;  3QT3 A;  3SDV A;  1RQ5 A;  1FP3 A;  3S4C A;  4AYP A;  5EAU A;  3G4D A;  4KTP A;  5JMF A;  2R2L B;  3CU7 A;  3SFY B;  3HXF B;  2BRV X;  5ILK A;  4D4C A;  5EAT A;  1H54 A;  2B39 A;  2DRR A;  2NOJ A;  1C3D A;  4YCR A;  3EQA A;  4XUV A;  4CJ0 A;  1GLM A;  1N7P A;  5IKH A;  2A73 B;  1NL4 B;  1W3Y A;  3ANK A;  3P2C A;  1LF6 A;  1RWA A;  4ONT A;  3E80 A;  5IK6 A;  3G4F A;  2JG0 A;  1X1I A;  1DOG A;  3E33 B;  4GTM B;  1G9G A;  5IK9 A;  5CD2 A;  5FOB B;  1TNU B;  2EAC A;  2RI8 A;  5C05 A;  2PN5 A;  4WVC A;  5ILJ A;  1L2A A;  1WU5 A;  3W7X A;  1GAI A;  2P0V A;  1QQF A;  4LIX A;  1TN6 B;  3NFV A;  1KSD A;  5M7Y A;  1KZO B;  3WKH A;  1G6I A;  3S4A A;  1WU6 A;  3M7B A;  1HM2 A;  4LNG B;  3RRS A;  3P5R A;  2AHF A;  4KKI A;  3KSL B;  4GTT B;  3M75 A;  2EAD A;  5ILZ A;  1IS9 A;  2WYN A;  3E32 B;  2H6G B;  4NEI A;  3E73 A;  3WUX A;  2H6H B;  1SA5 B;  3SDU A;  1H13 A;  5GW7 A;  3PZ4 B;  5MEH A;  3NNB A;  3Q78 B;  3S4D A;  3E6U A;  3QWT A;  1J0N A;  4MBG B;  1FT2 B;  1HMW A;  1OJM A;  4D4D A;  1GXO A;  3QRY A;  1X1H A;  3D5S A;  4OZW A;  4Q88 A;  5JMD A;  1G9J A;  3M76 A;  1N7Q A;  4LNV A;  4CJ1 A;  3M01 A;  1H12 A;  1FPP B;  4BOJ A;  1N7N A;  3DPY B;  1HXG A;  1NXC A;  1LXM A;  4ZH5 A;  1RWC A;  1WU4 A;  2CQS A;  5FO8 B;  3OED A;  5JPM B;  3H2W A;  3DSU B;  3VW5 A;  2XQW A;  1CLC A;  2GOX A;  2V8J A;  3ANI A;  4D4B A;  4TXT A;  1JS4 A;  3PZ2 B;  3RX8 A;  4V1R A;  2H6I B;  3N0F A;  5CA3 A;  3W7T A;  1O79 A;  3H3K A;  4Z4L A;  3C72 B;  4L0G A;  5DHI A;  1L1Y A;  2ONH A;  1TF4 A;  3KQ4 A;  3HXD B;  4ZG8 A;  3E34 B;  1HM3 A;  4D94 A;  1KFG A;  3RX7 A;  1F9G A;  3QFY A;  1R76 A;  3PYB A;  4FJQ A;  3VSN A;  3SFX B;  2ZBL A;  3G6J B;  5ILY A;  3OXU A;  4AYO A;  3PMM A;  3D3I A;  1FO3 A;  1LXK A;  1OJN A;  2F0Y B;  1D8E B;  2DRS A;  4FNV A;  4GAX A;  3QFZ A;  3QPF A;  4D4A A;  5GY3 A;  3M72 A;  2YIK A;  3EU5 B;  4FUS A;  3PYA A;  3SAE A;  1H14 A;  2BRW A;  5IK0 A;  4AYQ A;  3S9V A;  3WKG A;  1V7W A;  1O6Q A;  1LD7 B;  3KLS A;  3DSV B;  1C82 A;  3SDT A;  1HX9 A;  1N95 B;  3M7E A;  3S4B A;  1HN0 A;  1N1Z A;  3WIW A;  1TNO B;  1F9O A;  3GLY A;  1QSJ A;  3W5N A;  2X03 A;  3X17 A;  2AHG A;  1H39 A;  3KSQ B;  1N4P B;  2EAB A;  1JCQ B;  3AFJ A;  4Q2B A;  2V8I A;  1V7X A;  4F10 A;  1H3A A;  4E1Y A;  3N0G A;  1N94 B;  4MU9 A;  1W6K A;  2F6D A;  1KZP B;  1RWH A;  4DOD A;  3ON6 A;  1SQC A;  1NC5 A;  2VN4 A;  2E22 A;  2WY8 A;  2BBC A;  3WKF A;  1DL2 A;  3Q7A B;  4C1S A;  3M77 A;  2Z07 A;  5IM1 A;  5M7I A;  1O1S B;  3LZ9 A;  1J0M A;  1WZZ A;  1N20 A;  3M78 A;  5ILH A;  1X81 B;  1X1J A;  1KSC A;  4WVB A;  1HXA A;  2FV1 A;  1X9D A;  4KKJ A;  2G02 A;  1DCE B;  1LF9 A;  1KS8 A;  2OKX A;  1GXM A;  4OJZ A;  1O6H A;  4GTO B;  1N24 A;  4GL3 A;  1XWT A;  4GTQ B;  3SDR A;  1IA6 A;  1GA2 A;  3TF4 A;  1KRE A;  2FUT A;  4AYR A;  1LD8 B;  2BB5 A;  2XWJ B;  3CIH A;  1FO2 A;  3M00 A;  3QXQ A;  1HV6 A;  3K11 A;  1AYX A;  5FO9 B;  3GT5 A;  1GSZ A;  1N23 A;  4ZH1 A;  5JPN B;  1VD5 A;  2FBA A;  2WCO A;  1HXC A;  1AGM A;  1H36 A;  2FV0 A;  1RWG A;  5IL8 A;  5DGQ A;  1FAE A;  1QAZ A;  2RGK A;  1V7V A;  5AGD A;  1QBQ B;  2B4F A;  1FMI A;  2XWB B;  3EZ8 A;  1H3B A;  2WII B;  3ACT A;  3M73 A;  2G0D A; 
#chains in the Genus database with same CATH homology
 3W5M A;  3W7U A;  1FCE A;  1G87 A;  3DSW B;  1UMP A;  3DST B;  3SQC A;  3M7C A;  4GTR B;  4DOE A;  2VN7 A;  1KRF A;  1H35 A;  1XW2 A;  4KTR A;  2RI9 A;  1SA4 B;  1UG9 A;  1N4Q B;  3A3V A;  4TF4 A;  2JF4 A;  3T33 A;  3WKI A;  3QT9 A;  3WIQ A;  3Q7F B;  5KKB A;  1XWQ A;  4V1S A;  4CE7 A;  4M76 A;  4Z4J A;  2DRQ A;  1TN8 B;  1O1T B;  4LNB B;  5FO7 B;  3ANJ A;  1GAH A;  3PZ1 B;  1O1R B;  1IA7 A;  3WC3 A;  2V3N A;  1D8D B;  3RSY A;  1MZC B;  3SDQ A;  1TNB B;  2WY7 A;  3REN A;  1V5D A;  1HZF A;  2PMV A;  4FXG B;  2V3P A;  3W7W A;  2AFA A;  4YDE B;  2BED B;  2NVP A;  3EUV B;  1K72 A;  3DRA B;  1TNZ B;  2JJB A;  1FT1 B;  1KKT A;  3RJ3 A;  4QT9 A;  5CZL A;  3ACS A;  1S64 B;  1S63 B;  2SQC A;  4L9P B;  4EL8 A;  2A8Z A;  1F9D A;  3QG0 A;  4J5T A;  2D8L A;  1FBW A;  4GTP B;  1H3C A;  1TN7 B;  2QNO A;  1O5M B;  4ZRP A;  1TNY B;  5DGR A;  5E2J A;  2XFG A;  3E30 B;  2EAE A;  3M7L A;  3Q75 B;  1LTX B;  3HXE B;  3P5P A;  3QXF A;  2ZIS B;  1N9A B;  3H7L A;  2V8K A;  1W6J A;  1O6R A;  3Q73 B;  1GHQ A;  2D5J A;  4BOK A;  3DSX B;  2CQT A;  4L6X A;  4JJJ A;  4FXK B;  3W7S A;  2IEJ B;  2H6F B;  2BB6 A;  3QDE A;  1HCU A;  1N4R B;  1KWF A;  2GH4 A;  3GZK A;  1V5C A;  3Q79 B;  4WVA A;  2GZ6 A;  1H37 A;  3M71 A;  1JCS B;  3M74 A;  2I07 B;  1UT9 A;  1JCR B;  1N4S B;  2ZIR B;  4ZRQ A;  5GZK A;  3VXD A;  3DSS B;  2WIN B;  2DRO A;  1ULV A;  3E37 B;  2FUZ A;  4WU0 A;  3HXB B;  3WIR A;  3HXC B;  1GXN A;  3K7X A;  3QSP A;  4EHM B;  4GTV B;  1CEM A;  2ZZR A;  1FBO A;  4YDO B;  3RX5 A;  4GTS B;  3D5R A;  3PZ3 B;  1NI1 B;  3EU8 A;  3QT3 A;  3SDV A;  1RQ5 A;  1FP3 A;  3S4C A;  4AYP A;  4KTP A;  2R2L B;  3CU7 A;  3SFY B;  3HXF B;  4D4C A;  1H54 A;  2B39 A;  2DRR A;  2NOJ A;  1C3D A;  4YCR A;  3EQA A;  4XUV A;  4CJ0 A;  1GLM A;  2A73 B;  1NL4 B;  3P2C A;  3ANK A;  1LF6 A;  4ONT A;  2JG0 A;  1DOG A;  3E33 B;  4GTM B;  1G9G A;  5CD2 A;  5FOB B;  1TNU B;  2EAC A;  2RI8 A;  2PN5 A;  4WVC A;  1L2A A;  1WU5 A;  3W7X A;  1GAI A;  2P0V A;  1QQF A;  4LIX A;  1TN6 B;  1KSD A;  5M7Y A;  1KZO B;  3WKH A;  1G6I A;  3S4A A;  1WU6 A;  3M7B A;  4LNG B;  3RRS A;  3P5R A;  2AHF A;  4KKI A;  3KSL B;  4GTT B;  3M75 A;  2EAD A;  1IS9 A;  2WYN A;  3E32 B;  2H6G B;  3WUX A;  3E73 A;  2H6H B;  1SA5 B;  3SDU A;  1H13 A;  5GW7 A;  3PZ4 B;  5MEH A;  3Q78 B;  3S4D A;  3E6U A;  3QWT A;  4MBG B;  1FT2 B;  4D4D A;  1GXO A;  3QRY A;  3D5S A;  4Q88 A;  1G9J A;  3M76 A;  4LNV A;  4CJ1 A;  1H12 A;  1FPP B;  4BOJ A;  3DPY B;  1NXC A;  4ZH5 A;  1WU4 A;  2CQS A;  5FO8 B;  3OED A;  5JPM B;  3H2W A;  3DSU B;  3VW5 A;  2XQW A;  1CLC A;  2GOX A;  2V8J A;  3ANI A;  4D4B A;  4TXT A;  1JS4 A;  3PZ2 B;  3RX8 A;  4V1R A;  2H6I B;  5CA3 A;  3W7T A;  1O79 A;  3H3K A;  4Z4L A;  3C72 B;  4L0G A;  1L1Y A;  1TF4 A;  3KQ4 A;  3HXD B;  4ZG8 A;  3E34 B;  4D94 A;  1KFG A;  3RX7 A;  3QFY A;  1R76 A;  3PYB A;  3SFX B;  2ZBL A;  3G6J B;  3OXU A;  4AYO A;  3PMM A;  3D3I A;  1FO3 A;  2F0Y B;  1D8E B;  2DRS A;  3QFZ A;  3QPF A;  4D4A A;  5GY3 A;  3M72 A;  2YIK A;  3EU5 B;  4FUS A;  3PYA A;  3SAE A;  1H14 A;  4AYQ A;  3S9V A;  3WKG A;  1V7W A;  1O6Q A;  1LD7 B;  3KLS A;  3DSV B;  3SDT A;  1N95 B;  3M7E A;  3S4B A;  3WIW A;  1TNO B;  1F9O A;  3GLY A;  1QSJ A;  3W5N A;  3X17 A;  2AHG A;  1H39 A;  3KSQ B;  1N4P B;  2EAB A;  1JCQ B;  3AFJ A;  4Q2B A;  2V8I A;  1V7X A;  1H3A A;  4MU9 A;  1N94 B;  1W6K A;  2F6D A;  1KZP B;  4DOD A;  3ON6 A;  1SQC A;  1NC5 A;  2VN4 A;  2WY8 A;  2BBC A;  3WKF A;  1DL2 A;  3Q7A B;  4C1S A;  3M77 A;  2Z07 A;  5M7I A;  1O1S B;  1WZZ A;  3M78 A;  1X81 B;  1KSC A;  4WVB A;  2FV1 A;  1X9D A;  4KKJ A;  2G02 A;  1DCE B;  1LF9 A;  1KS8 A;  2OKX A;  1GXM A;  1O6H A;  4GTO B;  4GL3 A;  1XWT A;  4GTQ B;  3SDR A;  1IA6 A;  1GA2 A;  3TF4 A;  1KRE A;  4AYR A;  1LD8 B;  2BB5 A;  2XWJ B;  3CIH A;  1FO2 A;  3QXQ A;  3K11 A;  1AYX A;  5FO9 B;  3GT5 A;  1GSZ A;  4ZH1 A;  5JPN B;  1VD5 A;  2FBA A;  1AGM A;  1H36 A;  2FV0 A;  5DGQ A;  1FAE A;  2RGK A;  1V7V A;  5AGD A;  1QBQ B;  2B4F A;  1FMI A;  2XWB B;  3EZ8 A;  1H3B A;  2WII B;  3ACT A;  3M73 A;  2G0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...