3HXBB

Engineered rabggtase in complex with a peptidomimetic inhibitor (compound 6)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 118
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3hxbB00
1O6QA 1GHQA 1GSZA 4FXGB 2XQWA 4GTPB 1H3AA 2G02A 4BOKA 1H35A 4LNGB 1R76A 4KKJA 4L9PB 1O1SB 1TN8B 1HZFA 1O6HA 4YDEB 3DSSB 1KZOB 2F0YB 4FXKB 4GTTB 4V1RA 2A73B 3E37B 4MU9A 1SQCA 1UMPA 2WINB 2PMVA 1N95B 2H6HB 4ZRQA 4D94A 2R2LB 1D8DB 3Q75B 1LTXB 4M76A 4ZRPA 3KSQB 3SQCA 3DSWB 5JPMB 2WY8A 1TNOB 1H36A 2H6FB 1O79A 3DSTB 3HXCB 3E33B 3HXFB 4GTQB 1KZPB 1JCQB 2BEDB 2H6IB 2H6GB 3E34B 1GXNA 1TN6B 3C72B 3HXEB 1H39A 1N4RB 2V8JA 1QQFA 4GTMB 5JPNB 2NOJA 1FT2B 4D4CA 1H3BA 3KSLB 1SA4B 3D5RA 1LD7B 1GXOA 2BB5A 4ZH1A 2XWJB 1TNYB 2ZISB 5FO7B 2ZIRB 1LD8B 3EU5B 3HXBB 2I07B 4KKIA 2G0DA 4GTRB 2SQCA 1JCSB 1TNBB 3EUVB 3Q78B 1N94B 3DSUB 2XWBB 4EHMB 1N4PB 1W6KA 3PZ3B 1H3CA 3PZ2B 2PN5A 1N4SB 1QSJA 1SA5B 4BOJA 3PZ4B 3G6JB 2V8IA 3DSVB 4V1SA 1O1RB 2V8KA 2BBCA 1O6RA 2WY7A 1S64B 3KQ4A 1X81B 3DPYB 4GTOB 3Q7FB 3CU7A 1H37A 1TNZB 2V3PA 1D8EB 4D4AA 1N4QB 1GXMA 3Q73B 4D4BA 1C3DA 1QBQB 4LNBB 3SFXB 3SFYB 3DSXB 2BB6A 1NL4B 3D5SA 5FO9B 4YDOB 2GOXA 3HXDB 1FPPB 3K7XA 4GTVB 3Q7AB 4ONTA 1NI1B 4GTSB 4D4DA 5FO8B 4C1SA 3RJ3A 3E30B 1O5MB 4MBGB 3KLSA 5AGDA 1DCEB 1S63B 5FOBB 1FT1B 3OEDA 1MZCB 1O1TB 2V3NA 2IEJB 4LNVA 3DRAB 3Q79B 3E32B 1TN7B 3PZ1B 1W6JA 1JCRB 3OXUA 1N9AB 2WIIB 1TNUB 2B39A
chains in the Genus database with same CATH superfamily
1GHQA 1GSZA 4YCRA 4OK2A 1XWTA 3EU8A 3A0OA 4Q2BA 1H3AA 1HM2A 5CZLA 1HV6A 1N7NA 4DOEA 1X1JA 4L9PB 1HXAA 2FUTA 1HZFA 3VW5A 2EAEA 3QXFA 1C82A 2WYNA 5DGQA 3E37B 3WIQA 1SQCA 3RX8A 2CQTA 1V7XA 1N95B 3Q75B 3M75A 1FBOA 5EAUA 3KSQB 3DSWB 5JPMB 1H36A 4TF4A 1OJNA 4GTQB 1OJPA 2H6IB 2BRVX 2H6GB 3VSMA 5IK9A 1GXNA 1WZZA 5CD2A 2XFGA 3QT3A 3W7XA 1H3BA 3ACSA 3P5RA 3M02A 1LF9A 3M76A 2BRWA 1RWGA 5IL8A 3SDUA 2SQCA 1FCEA 4NEIA 3Q78B 1W3YA 5JMDA 2FV1A 2XWBB 1LOHA 3RX5A 3PZ2B 4WVCA 4BOJA 1GLMA 3DSVB 3S4AA 1N20A 2V8KA 2D8LA 3QSPA 1N1ZA 4GTOB 1GAIA 2AHGA 2RGKA 3CU7A 1VD5A 1N4QB 1F1SA 4E1YA 1GXMA 3Q73B 4D4BA 3TF4A 1C3DA 1KRFA 3W7SA 1X1HA 2FBAA 3SFYB 1NL4B 5FO9B 1NC5A 2GOXA 3HXDB 3PMMA 4AYQA 1FPPB 4CJ1A 2VN4A 4ONTA 1HXGA 3N0GA 3QWTA 3RJ3A 5IK6A 3KLSA 1DCEB 1AYXA 3M74A 5GY3A 5M7YA 1LXMA 4WVBA 1N1BA 1F9DA 2V3NA 5IKAA 4LNVA 3GLYA 3Q79B 5KKBA 1W6JA 3ACTA 2FUZA 3GT5A 5IM1A 1O6QA 3ON6A 2GH4A 1IA7A 1TF4A 1N7RA 2G02A 3QXQA 5IK0A 5DHIA 1GA2A 1LXKA 1DL2A 1RWAA 3WIWA 3RX7A 3DSSB 1KZOB 2OKXA 4GTTB 1N7PA 4ZH5A 4D94A 2H6HB 4ZRQA 4Z4LA 4OZWA 2WY8A 4OZVA 2H6FB 3M78A 3HXFB 2DROA 4WVAA 2Q1FA 1UT9A 3A3VA 1TN6B 1H14A 1KREA 1H39A 2ONHA 1ULVA 2E22A 2A8ZA 5E2JA 3KSLB 3D5RA 1HX9A 3PYAA 1TNYB 2ZISB 4KTRA 5FO7B 2VN7A 1LD8B 3EU5B 2DRQA 1DOGA 1JCSB 5ILIA 1TNBB 1N94B 3DSUB 2X03A 4EHMB 1W6KA 3PZ3B 1H3CA 3QPFA 3PYBA 1N4SB 1V5DA 3G6JB 2V8IA 1KKTA 3M00A 1HXCA 3E6UA 1RQ5A 4AYOA 3W7UA 2BBCA 3QDEA 3S4BA 2GZ6A 2Z07A 1TNZB 1H54A 1RWFA 2V3PA 3WUXA 4D4AA 3RSYA 4GL3A 3WKGA 2AHFA 5IL3A 1HN0A 1XW2A 1QBQB 2NVPA 3SDQA 1WU4A 3W5MA 1IS9A 5CA3A 3K7XA 4D4DA 4RNQA 5FO8B 1G9GA 3E30B 1I8QA 1O5MB 4JJJA 5MEHA 5AGDA 3K11A 5FOBB 1FT1B 3OEDA 1O1TB 2EADA 3E32B 3H2WA 3NFVA 1N9AB 1G6IA 3LZ9A 2P0VA 3X17A 3EQAA 4L0GA 3QFYA 2ZZRA 4BOKA 3ANKA 1R76A 3S4CA 1O1SB 1TN8B 3E73A 1N7OA 3WKFA 1O6HA 3SAEA 2F0YB 3W5NA 4V1RA 2A73B 2WCOA 4J5TA 5DHKA 1J0NA 3H7LA 1QAZA 2DRRA 2R2LB 4Q88A 1LTXB 2J5CA 3SQCA 5ILYA 1RWHA 3M71A 1NXCA 1FO3A 3HXCB 3RENA 3E33B 1KZPB 2BEDB 3E34B 1F9OA 3M72A 5DGRA 3WIRA 2JF4A 3S4DA 3WC3A 3M7CA 3C72B 3G4FA 3HXEB 5IKHA 1GAHA 2B4FA 4GTMB 5JMFA 2NOJA 4WU0A 1CEMA 1H13A 2ONGA 4OK4A 1IA6A 1SA4B 1LD7B 2BB5A 4Z4JA 4ZH1A 2ZIRB 3M7EA 2I07B 4KKIA 2G0DA 3M7LA 1X1IA 3D3IA 3EUVB 5GZKA 3ANJA 1F9GA 2F6DA 3CIHA 3SDRA 3W7WA 3M01A 1KSDA 1AGMA 3NNBA 2PN5A 5C05A 3ANIA 3PZ4B 4TXTA 4F13A 3QFZA 3VXDA 1N7QA 2E24A 1O6RA 4GAXA 1S64B 2EACA 3DPYB 3Q7FB 1H37A 1K72A 4FUSA 1D8EB 2AFAA 1L1YA 3WKIA 3W7TA 2BRPA 3G4DA 4LNBB 3SFXB 1CLCA 2BB6A 3D5SA 5ILDA 2DRSA 3Q7AB 3WKHA 1OJMA 1NI1B 1KS8A 1UG9A 3T33A 4C1SA 3S9VA 2CQSA 4MMIA 5ILJA 1S63B 1N22A 1RW9A 4OJZA 3DRAB 4QT9A 3SDVA 1EGUA 4DODA 4LIXA 5GW7A 1J0MA 2WIIB 3OXUA 1TNUB 2B39A 3GZKA 4ZG8A 3E80A 4FXGB 2XQWA 4GTPB 1JS4A 1H35A 4LNGB 4KKJA 1CB8A 4YDEB 4FXKB 4MU9A 1UMPA 2WINB 2PMVA 3E7JA 2FV0A 1D8DB 5EATA 4M76A 4ZRPA 4FJQA 4MMHA 1FO2A 1FBWA 1TNOB 1O79A 3DSTB 2JJBA 5ILZA 1JCQB 3M73A 1WU5A 3EZ8A 3QG0A 3M7BA 2WDAA 1N4RB 4CJ0A 2V8JA 1QQFA 2ZBLA 1KFGA 1H12A 5JPNB 1FT2B 4D4CA 1HMWA 1V7VA 1XWQA 1GXOA 3AFLA 2XWJB 1L2AA 1N21A 1HMUA 1N23A 4DI5A 2JG0A 3HXBB 1V5CA 3RRSA 4GTRB 2FUQA 4KTPA 5ILKA 2RI8A 1N4PB 2YIKA 3VSNA 3H3KA 1QSJA 1SA5B 1V7WA 4V1SA 1RWCA 2D5JA 1O1RB 1G9JA 3P5PA 1KWFA 2WY7A 3KQ4A 4XUVA 1X81B 1LF6A 1X9DA 4AYRA 1HM3A 1KSCA 4AYPA 2QNOA 1OJOA 4CE7A 5ILHA 3DSXB 4F10A 3AFJA 4YDOB 1G87A 3SDTA 1FMIA 4GTVB 1FP3A 4L6XA 4GTSB 3N0FA 4MBGB 4EL8A 1WU6A 1N24A 2RI9A 3QT9A 1MZCB 2IEJB 3QRYA 5EASA 1FAEA 3M77A 1TN7B 3PZ1B 4FNVA 1JCRB 3P2CA 2EABA 1HCUA 5M7IA
chains in the Genus database with same CATH topology
1GHQA 1GSZA 4YCRA 1XWTA 3EU8A 4Q2BA 1H3AA 5CZLA 4DOEA 4L9PB 1HZFA 3VW5A 2EAEA 3QXFA 2WYNA 5DGQA 3E37B 3WIQA 1SQCA 3RX8A 2CQTA 1V7XA 1N95B 3Q75B 3M75A 1FBOA 3KSQB 3DSWB 5JPMB 1H36A 4TF4A 4GTQB 2H6IB 2H6GB 1GXNA 1WZZA 5CD2A 2XFGA 3QT3A 3W7XA 1H3BA 3ACSA 3P5RA 1LF9A 3M76A 3SDUA 2SQCA 1FCEA 3Q78B 2FV1A 2XWBB 3RX5A 3PZ2B 4WVCA 4BOJA 1GLMA 3DSVB 3S4AA 2V8KA 2D8LA 3QSPA 4GTOB 1GAIA 2AHGA 2RGKA 3CU7A 1VD5A 1N4QB 1GXMA 3Q73B 4D4BA 3TF4A 1C3DA 1KRFA 3W7SA 2FBAA 3SFYB 1NL4B 5FO9B 1NC5A 2GOXA 3HXDB 3PMMA 4AYQA 1FPPB 4CJ1A 2VN4A 4ONTA 3QWTA 3RJ3A 3KLSA 1DCEB 1AYXA 3M74A 5GY3A 5M7YA 4WVBA 1F9DA 2V3NA 4LNVA 3GLYA 3Q79B 5KKBA 1W6JA 3ACTA 2FUZA 3GT5A 1O6QA 3ON6A 2GH4A 1IA7A 1TF4A 2G02A 3QXQA 1GA2A 1DL2A 3WIWA 3RX7A 3DSSB 1KZOB 2OKXA 4GTTB 4ZH5A 4D94A 2H6HB 4ZRQA 4Z4LA 2WY8A 2H6FB 3M78A 3HXFB 2DROA 4WVAA 1UT9A 3A3VA 1TN6B 1H14A 1KREA 1H39A 1ULVA 2A8ZA 5E2JA 3KSLB 3D5RA 3PYAA 1TNYB 2ZISB 4KTRA 5FO7B 2VN7A 1LD8B 3EU5B 2DRQA 1DOGA 1JCSB 1TNBB 1N94B 3DSUB 4EHMB 1W6KA 3PZ3B 1H3CA 3QPFA 3PYBA 1N4SB 1V5DA 3G6JB 2V8IA 1KKTA 3E6UA 1RQ5A 4AYOA 3W7UA 2BBCA 3QDEA 3S4BA 2GZ6A 2Z07A 1TNZB 1H54A 2V3PA 3WUXA 4D4AA 3RSYA 4GL3A 3WKGA 2AHFA 1XW2A 1QBQB 2NVPA 3SDQA 1WU4A 3W5MA 1IS9A 5CA3A 3K7XA 4D4DA 5FO8B 1G9GA 3E30B 1O5MB 4JJJA 5MEHA 5AGDA 3K11A 5FOBB 1FT1B 3OEDA 1O1TB 2EADA 3E32B 3H2WA 1N9AB 1G6IA 2P0VA 3X17A 3EQAA 4L0GA 3QFYA 2ZZRA 4BOKA 3ANKA 1R76A 3S4CA 1O1SB 1TN8B 3E73A 3WKFA 1O6HA 3SAEA 2F0YB 3W5NA 4V1RA 2A73B 4J5TA 3H7LA 2DRRA 2R2LB 4Q88A 1LTXB 3SQCA 3M71A 1NXCA 1FO3A 3HXCB 3RENA 3E33B 1KZPB 2BEDB 3E34B 1F9OA 3M72A 5DGRA 3WIRA 2JF4A 3S4DA 3WC3A 3M7CA 3C72B 3HXEB 1GAHA 2B4FA 4GTMB 2NOJA 4WU0A 1CEMA 1H13A 1IA6A 1SA4B 1LD7B 2BB5A 4Z4JA 4ZH1A 2ZIRB 3M7EA 2I07B 4KKIA 2G0DA 3M7LA 3D3IA 3EUVB 5GZKA 3ANJA 2F6DA 3CIHA 3SDRA 3W7WA 1KSDA 1AGMA 2PN5A 3ANIA 3PZ4B 4TXTA 3QFZA 3VXDA 1O6RA 1S64B 2EACA 3DPYB 3Q7FB 1H37A 1K72A 4FUSA 1D8EB 2AFAA 1L1YA 3WKIA 3W7TA 4LNBB 3SFXB 1CLCA 2BB6A 3D5SA 2DRSA 3Q7AB 3WKHA 1NI1B 1KS8A 1UG9A 3T33A 4C1SA 3S9VA 2CQSA 1S63B 3DRAB 4QT9A 3SDVA 4DODA 4LIXA 5GW7A 3OXUA 2WIIB 1TNUB 2B39A 3GZKA 4ZG8A 4FXGB 2XQWA 4GTPB 1JS4A 1H35A 4LNGB 4KKJA 4YDEB 4FXKB 4MU9A 1UMPA 2WINB 2PMVA 2FV0A 1D8DB 4M76A 4ZRPA 1FO2A 1FBWA 1TNOB 1O79A 3DSTB 2JJBA 1JCQB 3M73A 1WU5A 3EZ8A 3QG0A 3M7BA 1N4RB 4CJ0A 2V8JA 1QQFA 2ZBLA 1KFGA 1H12A 5JPNB 1FT2B 4D4CA 1V7VA 1XWQA 1GXOA 2XWJB 1L2AA 2JG0A 3HXBB 1V5CA 3RRSA 4GTRB 4KTPA 2RI8A 1N4PB 2YIKA 3H3KA 1QSJA 1SA5B 1V7WA 4V1SA 2D5JA 1O1RB 1G9JA 3P5PA 1KWFA 2WY7A 3KQ4A 4XUVA 1X81B 1LF6A 1X9DA 4AYRA 1KSCA 4AYPA 2QNOA 4CE7A 3DSXB 3AFJA 4YDOB 1G87A 3SDTA 1FMIA 4GTVB 1FP3A 4L6XA 4GTSB 4MBGB 4EL8A 1WU6A 2RI9A 3QT9A 1MZCB 2IEJB 3QRYA 1FAEA 3M77A 1TN7B 3PZ1B 1JCRB 3P2CA 2EABA 1HCUA 5M7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O6Q A;  1GHQ A;  1GSZ A;  4FXG B;  2XQW A;  4GTP B;  1H3A A;  2G02 A;  4BOK A;  1H35 A;  4LNG B;  1R76 A;  4KKJ A;  4L9P B;  1O1S B;  1TN8 B;  1HZF A;  1O6H A;  4YDE B;  3DSS B;  1KZO B;  2F0Y B;  4FXK B;  4GTT B;  4V1R A;  2A73 B;  3E37 B;  4MU9 A;  1SQC A;  1UMP A;  2WIN B;  2PMV A;  1N95 B;  2H6H B;  4ZRQ A;  4D94 A;  2R2L B;  1D8D B;  3Q75 B;  1LTX B;  4M76 A;  4ZRP A;  3KSQ B;  3SQC A;  3DSW B;  5JPM B;  2WY8 A;  1TNO B;  1H36 A;  2H6F B;  1O79 A;  3DST B;  3HXC B;  3E33 B;  3HXF B;  4GTQ B;  1KZP B;  1JCQ B;  2BED B;  2H6I B;  2H6G B;  3E34 B;  1GXN A;  1TN6 B;  3C72 B;  3HXE B;  1H39 A;  1N4R B;  2V8J A;  1QQF A;  4GTM B;  5JPN B;  2NOJ A;  1FT2 B;  4D4C A;  1H3B A;  3KSL B;  1SA4 B;  3D5R A;  1LD7 B;  1GXO A;  2BB5 A;  4ZH1 A;  2XWJ B;  1TNY B;  2ZIS B;  5FO7 B;  2ZIR B;  1LD8 B;  3EU5 B;  3HXB B;  2I07 B;  4KKI A;  2G0D A;  4GTR B;  2SQC A;  1JCS B;  1TNB B;  3EUV B;  3Q78 B;  1N94 B;  3DSU B;  2XWB B;  4EHM B;  1N4P B;  1W6K A;  3PZ3 B;  1H3C A;  3PZ2 B;  2PN5 A;  1N4S B;  1QSJ A;  1SA5 B;  4BOJ A;  3PZ4 B;  3G6J B;  2V8I A;  3DSV B;  4V1S A;  1O1R B;  2V8K A;  2BBC A;  1O6R A;  2WY7 A;  1S64 B;  3KQ4 A;  1X81 B;  3DPY B;  4GTO B;  3Q7F B;  3CU7 A;  1H37 A;  1TNZ B;  2V3P A;  1D8E B;  4D4A A;  1N4Q B;  1GXM A;  3Q73 B;  4D4B A;  1C3D A;  1QBQ B;  4LNB B;  3SFX B;  3SFY B;  3DSX B;  2BB6 A;  1NL4 B;  3D5S A;  5FO9 B;  4YDO B;  2GOX A;  3HXD B;  1FPP B;  3K7X A;  4GTV B;  3Q7A B;  4ONT A;  1NI1 B;  4GTS B;  4D4D A;  5FO8 B;  4C1S A;  3RJ3 A;  3E30 B;  1O5M B;  4MBG B;  3KLS A;  5AGD A;  1DCE B;  1S63 B;  5FOB B;  1FT1 B;  3OED A;  1MZC B;  1O1T B;  2V3N A;  2IEJ B;  4LNV A;  3DRA B;  3Q79 B;  3E32 B;  1TN7 B;  3PZ1 B;  1W6J A;  1JCR B;  3OXU A;  1N9A B;  2WII B;  1TNU B;  2B39 A; 
#chains in the Genus database with same CATH topology
 1GHQ A;  1GSZ A;  4YCR A;  4OK2 A;  1XWT A;  3EU8 A;  3A0O A;  4Q2B A;  1H3A A;  1HM2 A;  5CZL A;  1HV6 A;  1N7N A;  4DOE A;  1X1J A;  4L9P B;  1HXA A;  2FUT A;  1HZF A;  3VW5 A;  2EAE A;  3QXF A;  1C82 A;  2WYN A;  5DGQ A;  3E37 B;  3WIQ A;  1SQC A;  3RX8 A;  2CQT A;  1V7X A;  1N95 B;  3Q75 B;  3M75 A;  1FBO A;  5EAU A;  3KSQ B;  3DSW B;  5JPM B;  1H36 A;  4TF4 A;  1OJN A;  4GTQ B;  1OJP A;  2H6I B;  2BRV X;  2H6G B;  3VSM A;  5IK9 A;  1GXN A;  1WZZ A;  5CD2 A;  2XFG A;  3QT3 A;  3W7X A;  1H3B A;  3ACS A;  3P5R A;  3M02 A;  1LF9 A;  3M76 A;  2BRW A;  1RWG A;  5IL8 A;  3SDU A;  2SQC A;  1FCE A;  4NEI A;  3Q78 B;  1W3Y A;  5JMD A;  2FV1 A;  2XWB B;  1LOH A;  3RX5 A;  3PZ2 B;  4WVC A;  4BOJ A;  1GLM A;  3DSV B;  3S4A A;  1N20 A;  2V8K A;  2D8L A;  3QSP A;  1N1Z A;  4GTO B;  1GAI A;  2AHG A;  2RGK A;  3CU7 A;  1VD5 A;  1N4Q B;  1F1S A;  4E1Y A;  1GXM A;  3Q73 B;  4D4B A;  3TF4 A;  1C3D A;  1KRF A;  3W7S A;  1X1H A;  2FBA A;  3SFY B;  1NL4 B;  5FO9 B;  1NC5 A;  2GOX A;  3HXD B;  3PMM A;  4AYQ A;  1FPP B;  4CJ1 A;  2VN4 A;  4ONT A;  1HXG A;  3N0G A;  3QWT A;  3RJ3 A;  5IK6 A;  3KLS A;  1DCE B;  1AYX A;  3M74 A;  5GY3 A;  5M7Y A;  1LXM A;  4WVB A;  1N1B A;  1F9D A;  2V3N A;  5IKA A;  4LNV A;  3GLY A;  3Q79 B;  5KKB A;  1W6J A;  3ACT A;  2FUZ A;  3GT5 A;  5IM1 A;  1O6Q A;  3ON6 A;  2GH4 A;  1IA7 A;  1TF4 A;  1N7R A;  2G02 A;  3QXQ A;  5IK0 A;  5DHI A;  1GA2 A;  1LXK A;  1DL2 A;  1RWA A;  3WIW A;  3RX7 A;  3DSS B;  1KZO B;  2OKX A;  4GTT B;  1N7P A;  4ZH5 A;  4D94 A;  2H6H B;  4ZRQ A;  4Z4L A;  4OZW A;  2WY8 A;  4OZV A;  2H6F B;  3M78 A;  3HXF B;  2DRO A;  4WVA A;  2Q1F A;  1UT9 A;  3A3V A;  1TN6 B;  1H14 A;  1KRE A;  1H39 A;  2ONH A;  1ULV A;  2E22 A;  2A8Z A;  5E2J A;  3KSL B;  3D5R A;  1HX9 A;  3PYA A;  1TNY B;  2ZIS B;  4KTR A;  5FO7 B;  2VN7 A;  1LD8 B;  3EU5 B;  2DRQ A;  1DOG A;  1JCS B;  5ILI A;  1TNB B;  1N94 B;  3DSU B;  2X03 A;  4EHM B;  1W6K A;  3PZ3 B;  1H3C A;  3QPF A;  3PYB A;  1N4S B;  1V5D A;  3G6J B;  2V8I A;  1KKT A;  3M00 A;  1HXC A;  3E6U A;  1RQ5 A;  4AYO A;  3W7U A;  2BBC A;  3QDE A;  3S4B A;  2GZ6 A;  2Z07 A;  1TNZ B;  1H54 A;  1RWF A;  2V3P A;  3WUX A;  4D4A A;  3RSY A;  4GL3 A;  3WKG A;  2AHF A;  5IL3 A;  1HN0 A;  1XW2 A;  1QBQ B;  2NVP A;  3SDQ A;  1WU4 A;  3W5M A;  1IS9 A;  5CA3 A;  3K7X A;  4D4D A;  4RNQ A;  5FO8 B;  1G9G A;  3E30 B;  1I8Q A;  1O5M B;  4JJJ A;  5MEH A;  5AGD A;  3K11 A;  5FOB B;  1FT1 B;  3OED A;  1O1T B;  2EAD A;  3E32 B;  3H2W A;  3NFV A;  1N9A B;  1G6I A;  3LZ9 A;  2P0V A;  3X17 A;  3EQA A;  4L0G A;  3QFY A;  2ZZR A;  4BOK A;  3ANK A;  1R76 A;  3S4C A;  1O1S B;  1TN8 B;  3E73 A;  1N7O A;  3WKF A;  1O6H A;  3SAE A;  2F0Y B;  3W5N A;  4V1R A;  2A73 B;  2WCO A;  4J5T A;  5DHK A;  1J0N A;  3H7L A;  1QAZ A;  2DRR A;  2R2L B;  4Q88 A;  1LTX B;  2J5C A;  3SQC A;  5ILY A;  1RWH A;  3M71 A;  1NXC A;  1FO3 A;  3HXC B;  3REN A;  3E33 B;  1KZP B;  2BED B;  3E34 B;  1F9O A;  3M72 A;  5DGR A;  3WIR A;  2JF4 A;  3S4D A;  3WC3 A;  3M7C A;  3C72 B;  3G4F A;  3HXE B;  5IKH A;  1GAH A;  2B4F A;  4GTM B;  5JMF A;  2NOJ A;  4WU0 A;  1CEM A;  1H13 A;  2ONG A;  4OK4 A;  1IA6 A;  1SA4 B;  1LD7 B;  2BB5 A;  4Z4J A;  4ZH1 A;  2ZIR B;  3M7E A;  2I07 B;  4KKI A;  2G0D A;  3M7L A;  1X1I A;  3D3I A;  3EUV B;  5GZK A;  3ANJ A;  1F9G A;  2F6D A;  3CIH A;  3SDR A;  3W7W A;  3M01 A;  1KSD A;  1AGM A;  3NNB A;  2PN5 A;  5C05 A;  3ANI A;  3PZ4 B;  4TXT A;  4F13 A;  3QFZ A;  3VXD A;  1N7Q A;  2E24 A;  1O6R A;  4GAX A;  1S64 B;  2EAC A;  3DPY B;  3Q7F B;  1H37 A;  1K72 A;  4FUS A;  1D8E B;  2AFA A;  1L1Y A;  3WKI A;  3W7T A;  2BRP A;  3G4D A;  4LNB B;  3SFX B;  1CLC A;  2BB6 A;  3D5S A;  5ILD A;  2DRS A;  3Q7A B;  3WKH A;  1OJM A;  1NI1 B;  1KS8 A;  1UG9 A;  3T33 A;  4C1S A;  3S9V A;  2CQS A;  4MMI A;  5ILJ A;  1S63 B;  1N22 A;  1RW9 A;  4OJZ A;  3DRA B;  4QT9 A;  3SDV A;  1EGU A;  4DOD A;  4LIX A;  5GW7 A;  1J0M A;  2WII B;  3OXU A;  1TNU B;  2B39 A;  3GZK A;  4ZG8 A;  3E80 A;  4FXG B;  2XQW A;  4GTP B;  1JS4 A;  1H35 A;  4LNG B;  4KKJ A;  1CB8 A;  4YDE B;  4FXK B;  4MU9 A;  1UMP A;  2WIN B;  2PMV A;  3E7J A;  2FV0 A;  1D8D B;  5EAT A;  4M76 A;  4ZRP A;  4FJQ A;  4MMH A;  1FO2 A;  1FBW A;  1TNO B;  1O79 A;  3DST B;  2JJB A;  5ILZ A;  1JCQ B;  3M73 A;  1WU5 A;  3EZ8 A;  3QG0 A;  3M7B A;  2WDA A;  1N4R B;  4CJ0 A;  2V8J A;  1QQF A;  2ZBL A;  1KFG A;  1H12 A;  5JPN B;  1FT2 B;  4D4C A;  1HMW A;  1V7V A;  1XWQ A;  1GXO A;  3AFL A;  2XWJ B;  1L2A A;  1N21 A;  1HMU A;  1N23 A;  4DI5 A;  2JG0 A;  3HXB B;  1V5C A;  3RRS A;  4GTR B;  2FUQ A;  4KTP A;  5ILK A;  2RI8 A;  1N4P B;  2YIK A;  3VSN A;  3H3K A;  1QSJ A;  1SA5 B;  1V7W A;  4V1S A;  1RWC A;  2D5J A;  1O1R B;  1G9J A;  3P5P A;  1KWF A;  2WY7 A;  3KQ4 A;  4XUV A;  1X81 B;  1LF6 A;  1X9D A;  4AYR A;  1HM3 A;  1KSC A;  4AYP A;  2QNO A;  1OJO A;  4CE7 A;  5ILH A;  3DSX B;  4F10 A;  3AFJ A;  4YDO B;  1G87 A;  3SDT A;  1FMI A;  4GTV B;  1FP3 A;  4L6X A;  4GTS B;  3N0F A;  4MBG B;  4EL8 A;  1WU6 A;  1N24 A;  2RI9 A;  3QT9 A;  1MZC B;  2IEJ B;  3QRY A;  5EAS A;  1FAE A;  3M77 A;  1TN7 B;  3PZ1 B;  4FNV A;  1JCR B;  3P2C A;  2EAB A;  1HCU A;  5M7I A; 
#chains in the Genus database with same CATH homology
 1GHQ A;  1GSZ A;  4YCR A;  1XWT A;  3EU8 A;  4Q2B A;  1H3A A;  5CZL A;  4DOE A;  4L9P B;  1HZF A;  3VW5 A;  2EAE A;  3QXF A;  2WYN A;  5DGQ A;  3E37 B;  3WIQ A;  1SQC A;  3RX8 A;  2CQT A;  1V7X A;  1N95 B;  3Q75 B;  3M75 A;  1FBO A;  3KSQ B;  3DSW B;  5JPM B;  1H36 A;  4TF4 A;  4GTQ B;  2H6I B;  2H6G B;  1GXN A;  1WZZ A;  5CD2 A;  2XFG A;  3QT3 A;  3W7X A;  1H3B A;  3ACS A;  3P5R A;  1LF9 A;  3M76 A;  3SDU A;  2SQC A;  1FCE A;  3Q78 B;  2FV1 A;  2XWB B;  3RX5 A;  3PZ2 B;  4WVC A;  4BOJ A;  1GLM A;  3DSV B;  3S4A A;  2V8K A;  2D8L A;  3QSP A;  4GTO B;  1GAI A;  2AHG A;  2RGK A;  3CU7 A;  1VD5 A;  1N4Q B;  1GXM A;  3Q73 B;  4D4B A;  3TF4 A;  1C3D A;  1KRF A;  3W7S A;  2FBA A;  3SFY B;  1NL4 B;  5FO9 B;  1NC5 A;  2GOX A;  3HXD B;  3PMM A;  4AYQ A;  1FPP B;  4CJ1 A;  2VN4 A;  4ONT A;  3QWT A;  3RJ3 A;  3KLS A;  1DCE B;  1AYX A;  3M74 A;  5GY3 A;  5M7Y A;  4WVB A;  1F9D A;  2V3N A;  4LNV A;  3GLY A;  3Q79 B;  5KKB A;  1W6J A;  3ACT A;  2FUZ A;  3GT5 A;  1O6Q A;  3ON6 A;  2GH4 A;  1IA7 A;  1TF4 A;  2G02 A;  3QXQ A;  1GA2 A;  1DL2 A;  3WIW A;  3RX7 A;  3DSS B;  1KZO B;  2OKX A;  4GTT B;  4ZH5 A;  4D94 A;  2H6H B;  4ZRQ A;  4Z4L A;  2WY8 A;  2H6F B;  3M78 A;  3HXF B;  2DRO A;  4WVA A;  1UT9 A;  3A3V A;  1TN6 B;  1H14 A;  1KRE A;  1H39 A;  1ULV A;  2A8Z A;  5E2J A;  3KSL B;  3D5R A;  3PYA A;  1TNY B;  2ZIS B;  4KTR A;  5FO7 B;  2VN7 A;  1LD8 B;  3EU5 B;  2DRQ A;  1DOG A;  1JCS B;  1TNB B;  1N94 B;  3DSU B;  4EHM B;  1W6K A;  3PZ3 B;  1H3C A;  3QPF A;  3PYB A;  1N4S B;  1V5D A;  3G6J B;  2V8I A;  1KKT A;  3E6U A;  1RQ5 A;  4AYO A;  3W7U A;  2BBC A;  3QDE A;  3S4B A;  2GZ6 A;  2Z07 A;  1TNZ B;  1H54 A;  2V3P A;  3WUX A;  4D4A A;  3RSY A;  4GL3 A;  3WKG A;  2AHF A;  1XW2 A;  1QBQ B;  2NVP A;  3SDQ A;  1WU4 A;  3W5M A;  1IS9 A;  5CA3 A;  3K7X A;  4D4D A;  5FO8 B;  1G9G A;  3E30 B;  1O5M B;  4JJJ A;  5MEH A;  5AGD A;  3K11 A;  5FOB B;  1FT1 B;  3OED A;  1O1T B;  2EAD A;  3E32 B;  3H2W A;  1N9A B;  1G6I A;  2P0V A;  3X17 A;  3EQA A;  4L0G A;  3QFY A;  2ZZR A;  4BOK A;  3ANK A;  1R76 A;  3S4C A;  1O1S B;  1TN8 B;  3E73 A;  3WKF A;  1O6H A;  3SAE A;  2F0Y B;  3W5N A;  4V1R A;  2A73 B;  4J5T A;  3H7L A;  2DRR A;  2R2L B;  4Q88 A;  1LTX B;  3SQC A;  3M71 A;  1NXC A;  1FO3 A;  3HXC B;  3REN A;  3E33 B;  1KZP B;  2BED B;  3E34 B;  1F9O A;  3M72 A;  5DGR A;  3WIR A;  2JF4 A;  3S4D A;  3WC3 A;  3M7C A;  3C72 B;  3HXE B;  1GAH A;  2B4F A;  4GTM B;  2NOJ A;  4WU0 A;  1CEM A;  1H13 A;  1IA6 A;  1SA4 B;  1LD7 B;  2BB5 A;  4Z4J A;  4ZH1 A;  2ZIR B;  3M7E A;  2I07 B;  4KKI A;  2G0D A;  3M7L A;  3D3I A;  3EUV B;  5GZK A;  3ANJ A;  2F6D A;  3CIH A;  3SDR A;  3W7W A;  1KSD A;  1AGM A;  2PN5 A;  3ANI A;  3PZ4 B;  4TXT A;  3QFZ A;  3VXD A;  1O6R A;  1S64 B;  2EAC A;  3DPY B;  3Q7F B;  1H37 A;  1K72 A;  4FUS A;  1D8E B;  2AFA A;  1L1Y A;  3WKI A;  3W7T A;  4LNB B;  3SFX B;  1CLC A;  2BB6 A;  3D5S A;  2DRS A;  3Q7A B;  3WKH A;  1NI1 B;  1KS8 A;  1UG9 A;  3T33 A;  4C1S A;  3S9V A;  2CQS A;  1S63 B;  3DRA B;  4QT9 A;  3SDV A;  4DOD A;  4LIX A;  5GW7 A;  3OXU A;  2WII B;  1TNU B;  2B39 A;  3GZK A;  4ZG8 A;  4FXG B;  2XQW A;  4GTP B;  1JS4 A;  1H35 A;  4LNG B;  4KKJ A;  4YDE B;  4FXK B;  4MU9 A;  1UMP A;  2WIN B;  2PMV A;  2FV0 A;  1D8D B;  4M76 A;  4ZRP A;  1FO2 A;  1FBW A;  1TNO B;  1O79 A;  3DST B;  2JJB A;  1JCQ B;  3M73 A;  1WU5 A;  3EZ8 A;  3QG0 A;  3M7B A;  1N4R B;  4CJ0 A;  2V8J A;  1QQF A;  2ZBL A;  1KFG A;  1H12 A;  5JPN B;  1FT2 B;  4D4C A;  1V7V A;  1XWQ A;  1GXO A;  2XWJ B;  1L2A A;  2JG0 A;  3HXB B;  1V5C A;  3RRS A;  4GTR B;  4KTP A;  2RI8 A;  1N4P B;  2YIK A;  3H3K A;  1QSJ A;  1SA5 B;  1V7W A;  4V1S A;  2D5J A;  1O1R B;  1G9J A;  3P5P A;  1KWF A;  2WY7 A;  3KQ4 A;  4XUV A;  1X81 B;  1LF6 A;  1X9D A;  4AYR A;  1KSC A;  4AYP A;  2QNO A;  4CE7 A;  3DSX B;  3AFJ A;  4YDO B;  1G87 A;  3SDT A;  1FMI A;  4GTV B;  1FP3 A;  4L6X A;  4GTS B;  4MBG B;  4EL8 A;  1WU6 A;  2RI9 A;  3QT9 A;  1MZC B;  2IEJ B;  3QRY A;  1FAE A;  3M77 A;  1TN7 B;  3PZ1 B;  1JCR B;  3P2C A;  2EAB A;  1HCU A;  5M7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...