4D4DA

The catalytic domain, bcgh76, of bacillus circulans aman6 in complex with 1,6-manifg
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
336
structure length
333
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHQNSDHIVDGNWAGQGTYESWSSAAAVQALNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-1,6-MANNANASE
publication title Evidence for a Boat Conformation at the Transition State of Gh76 Alpha-1,6-Mannanases- Key Enzymes in Bacterial and Fungal Mannoprotein Metabolism
pubmed doi rcsb
source organism Bacillus circulans
total genus 138
structure length 333
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4d4dA00
4LNGB 2WY7A 1FT1B 1H3CA 2BB5A 1O6RA 2V3NA 3EU5B 2R2LB 3Q7FB 3G6JB 2XWJB 4C1SA 2WIIB 3HXCB 4ZRQA 1C3DA 1S64B 4FXKB 1GHQA 1NL4B 4KKIA 4LNBB 1H35A 3KSLB 3D5RA 3Q78B 1O1TB 1N4PB 4GTSB 3K7XA 3DPYB 4ZRPA 3SFXB 3OEDA 1D8DB 5FO8B 4BOKA 2ZIRB 3E34B 2BEDB 1JCSB 1O1RB 1HZFA 1TN7B 1LD7B 3E32B 2I07B 5JPMB 1N94B 4GTRB 3Q75B 4L9PB 4GTMB 4D4DA 2NOJA 2H6FB 3D5SA 2G0DA 1JCQB 2IEJB 3PZ4B 1GXOA 1GXNA 1O79A 1TNOB 3DSSB 1TNYB 4MBGB 4YDOB 4BOJA 2A73B 4GTOB 1SA4B 1FT2B 1TN8B 4V1RA 1GXMA 3E37B 4GTPB 1KZPB 1O6QA 2H6GB 3SFYB 1H3AA 1DCEB 1H36A 1SQCA 1O1SB 4M76A 1QBQB 2WY8A 2V8JA 2GOXA 2V8KA 2XQWA 4GTQB 1H3BA 1N4SB 1O5MB 4GTTB 1SA5B 2B39A 4D4CA 4EHMB 1S63B 4LNVA 1TNZB 1KZOB 2BB6A 1GSZA 1JCRB 2H6IB 1N95B 1TN6B 4KKJA 2WINB 3E33B 3PZ1B 2G02A 4GTVB 1QSJA 1H37A 2XWBB 4ZH1A 5FOBB 1X81B 3CU7A 3DSUB 4YDEB 1N4RB 3C72B 3DRAB 3RJ3A 4V1SA 3HXBB 4FXGB 3SQCA 3KSQB 3Q79B 1H39A 2ZISB 3PZ2B 1W6JA 1UMPA 1N9AB 3PZ3B 1FPPB 2PN5A 1MZCB 4MU9A 2PMVA 5FO7B 1LTXB 3HXEB 1NI1B 1TNBB 3DSVB 1QQFA 3EUVB 3OXUA 3Q73B 1TNUB 3HXFB 5AGDA 5FO9B 1LD8B 2BBCA 4D4AA 2V8IA 1R76A 4ONTA 5JPNB 3KLSA 2H6HB 2V3PA 4D4BA 3DSTB 3KQ4A 2F0YB 1W6KA 3E30B 1D8EB 3Q7AB 3DSXB 4D94A 1O6HA 3HXDB 3DSWB 1N4QB 2SQCA
chains in the Genus database with same CATH superfamily
2WY7A 1H3CA 3WKHA 4GL3A 2V3NA 4FJQA 2R2LB 3Q7FB 4E1YA 4LIXA 2RGKA 3QRYA 1C3DA 4FXKB 1NL4B 1HX9A 4KKIA 1H35A 1O1TB 2E24A 1RWHA 3DPYB 1KKTA 4ZRPA 3OEDA 1D8DB 1F1SA 3M02A 4WVCA 2OKXA 3E6UA 3M76A 5JPMB 1HZFA 2I07B 3VW5A 4GTRB 1N7RA 1HCUA 4D4DA 2NOJA 3D5SA 4L0GA 1GXOA 3W7XA 2A73B 1TN8B 4V1RA 1GXMA 4F13A 4WVAA 2H6GB 3SFYB 1DCEB 1N1BA 2WY8A 2XQWA 2RI9A 1H12A 1NC5A 2DRSA 1H3BA 4GTTB 1G9GA 1AGMA 2B4FA 2QNOA 4LNVA 1GLMA 1TNZB 5ILJA 3P5PA 1RWCA 1GSZA 3WKGA 1WU5A 2H6IB 3M7EA 1V7WA 2WYNA 4KKJA 3PZ1B 3M00A 2EAEA 2AHGA 3QT9A 1N21A 3CU7A 4YDEB 1X1HA 3M71A 1N4RB 3QFZA 3WIRA 3RJ3A 2YIKA 1EGUA 3HXBB 1WZZA 1N22A 1N1ZA 5IL8A 3Q79B 1XWTA 1ULVA 3W7UA 1KSCA 1RQ5A 3RX5A 3QSPA 1UMPA 2F6DA 2Z07A 2PMVA 2D5JA 1LTXB 4ZH5A 1J0MA 3HXEB 4OZWA 3WKFA 1QQFA 1KRFA 2RI8A 3SDQA 3Q73B 3HXFB 2Q1FA 3M01A 4L6XA 5EASA 4D4BA 3KQ4A 5ILIA 3Q7AB 4WVBA 5CZLA 4D94A 3HXDB 1RWAA 3QWTA 2AHFA 1WU4A 2SQCA 3ACSA 3N0FA 4WU0A 5GY3A 1FT1B 2BB5A 1N7OA 2JG0A 4CJ1A 2D8LA 2XWJB 2WIIB 3HXCB 1G6IA 2EADA 3M7CA 3QPFA 1TF4A 1GAIA 1HM3A 4LNBB 3A3VA 1V5CA 1G87A 4J5TA 3M73A 1N4PB 1FBOA 4GAXA 4GTSB 1GA2A 3SFXB 3M75A 5FO8B 2ZIRB 1VD5A 1O1RB 1FMIA 3M7LA 4L9PB 3T33A 2IEJB 1O79A 3DSSB 3H3KA 5IK6A 3S9VA 2BRWA 3EZ8A 1GAHA 1HXGA 2EACA 4YCRA 5DGQA 1HN0A 4Z4LA 3W7WA 1KREA 1O1SB 1QBQB 2GOXA 3N0GA 3S4AA 1RW9A 4XUVA 5ILDA 1F9GA 1G9JA 2DRRA 5IL3A 4CE7A 1HMUA 4MMIA 3SDVA 3G4FA 1CLCA 1JCRB 3RX7A 3VSMA 3E33B 2P0VA 1QSJA 2XWBB 5E2JA 3S4BA 1HXAA 4ZH1A 5FOBB 1CEMA 1HM2A 3C72B 4ZG8A 1JS4A 5EATA 1V5DA 4FXGB 3W7TA 4JJJA 1X9DA 4TXTA 2ZISB 5DHIA 4OK4A 1W6JA 1XWQA 1N9AB 1L2AA 1FP3A 2A8ZA 1DL2A 1KS8A 3QDEA 3RX8A 5DGRA 1FCEA 2E22A 1NI1B 1TNBB 3WKIA 2BBCA 4D4AA 2V8IA 1WU6A 1HMWA 3SDRA 1QAZA 3AFLA 3D3IA 3DSTB 2ZBLA 2F0YB 2CQSA 1D8EB 2JJBA 5M7IA 5C05A 4Z4JA 1H13A 2FUZA 1N7NA 3M77A 3CIHA 3H7LA 3A0OA 4AYOA 3E73A 1FO3A 3M72A 3QT3A 2EABA 2FV1A 3S4CA 3RRSA 3TF4A 3KSLB 1I8QA 5IKHA 3WC3A 4BOKA 3E34B 1H54A 2BEDB 1LD7B 1N23A 1TN7B 1UT9A 3RENA 1N20A 2BRVX 3PMMA 5JMDA 4GTMB 3W5MA 2ZZRA 4TF4A 3M74A 3RSYA 2G0DA 1JCQB 2VN7A 1TNOB 4MBGB 3NFVA 5IM1A 1W3YA 1SA4B 1FT2B 1LXMA 3W5NA 3K11A 1O6QA 2CQTA 5KKBA 3ANKA 4KTRA 1SQCA 4Q88A 4M76A 1N7PA 3AFJA 1N4SB 4FNVA 1FO2A 1J0NA 3S4DA 4AYRA 4DI5A 5IK9A 2ONGA 4D4CA 2JF4A 4EHMB 1S63B 1UG9A 5ILZA 2XFGA 4FUSA 3X17A 1TN6B 1V7VA 3GT5A 1H37A 1X81B 4AYPA 3DSUB 4Q2BA 4DOEA 1IS9A 4V1SA 1FBWA 3W7SA 1RWFA 3SQCA 3NNBA 1NXCA 3M78A 1H39A 5DHKA 3SAEA 3SDTA 3G4DA 1H14A 4OK2A 3SDUA 1FPPB 3QFYA 2PN5A 5ILHA 1MZCB 4MU9A 3PYBA 1KWFA 1HV6A 5FO7B 3QG0A 3EUVB 2X03A 1X1IA 3ANIA 3WIQA 1LD8B 4ONTA 5JPNB 1KFGA 3KLSA 3LZ9A 2H6HB 2V3PA 1N24A 4EL8A 5GW7A 1W6KA 5IKAA 4NEIA 3DSWB 1N4QB 3PYAA 3E7JA 4LNGB 2GZ6A 5JMFA 4OJZA 1LF6A 1LXKA 1O6RA 2FUTA 5ILKA 3EU5B 3G6JB 4C1SA 5MEHA 4DODA 2WCOA 1HXCA 4ZRQA 1S64B 5ILYA 1GHQA 2FV0A 3Q78B 3D5RA 2FUQA 3K7XA 1FAEA 3ANJA 5CA3A 1KSDA 3WIWA 2J5CA 1JCSB 3EQAA 3E32B 1N94B 2ONHA 1CB8A 3Q75B 1F9DA 3QXQA 2H6FB 3PZ4B 1GXNA 1LF9A 4YDOB 1TNYB 4BOJA 2AFAA 4GTOB 3E80A 3E37B 4GTPB 1KZPB 2BRPA 1OJPA 1H3AA 5M7YA 1H36A 1IA6A 1L1YA 2V8JA 2V8KA 2NVPA 4GTQB 1O5MB 4KTPA 5EAUA 2DRQA 2GH4A 1SA5B 4QT9A 2B39A 1K72A 1LOHA 3P2CA 1KZOB 1C82A 2BB6A 1N95B 4RNQA 3GLYA 2WINB 3GZKA 2G02A 4GTVB 3P5RA 1V7XA 2FBAA 4MMHA 3QXFA 1OJOA 3DRAB 1N7QA 3ACTA 3KSQB 4OZVA 4CJ0A 4F10A 3PZ2B 1X1JA 5CD2A 3M7BA 5GZKA 2VN4A 3PZ3B 1RWGA 3ON6A 1XW2A 3WUXA 3EU8A 1OJMA 3DSVB 1F9OA 3H2WA 1AYXA 3OXUA 1TNUB 5AGDA 4AYQA 5FO9B 1R76A 2DROA 3VSNA 1IA7A 3E30B 2WDAA 5IK0A 1DOGA 3DSXB 1O6HA 1OJNA 3VXDA
chains in the Genus database with same CATH topology
2WY7A 1H3CA 3WKHA 4GL3A 2V3NA 2R2LB 3Q7FB 4LIXA 2RGKA 3QRYA 1C3DA 4FXKB 1NL4B 4KKIA 1H35A 1O1TB 3DPYB 1KKTA 4ZRPA 3OEDA 1D8DB 4WVCA 2OKXA 3E6UA 3M76A 5JPMB 1HZFA 2I07B 3VW5A 4GTRB 1HCUA 4D4DA 2NOJA 3D5SA 4L0GA 1GXOA 3W7XA 2A73B 1TN8B 4V1RA 1GXMA 4WVAA 2H6GB 3SFYB 1DCEB 2WY8A 2XQWA 2RI9A 1H12A 1NC5A 2DRSA 1H3BA 4GTTB 1G9GA 1AGMA 2B4FA 2QNOA 4LNVA 1GLMA 1TNZB 3P5PA 1GSZA 3WKGA 3M7EA 1WU5A 2H6IB 1V7WA 2WYNA 4KKJA 3PZ1B 2EAEA 2AHGA 3QT9A 3CU7A 4YDEB 3M71A 1N4RB 3QFZA 3WIRA 3RJ3A 2YIKA 3HXBB 1WZZA 3Q79B 1XWTA 1ULVA 3W7UA 1KSCA 1RQ5A 3RX5A 3QSPA 1UMPA 2F6DA 2Z07A 2PMVA 2D5JA 1LTXB 4ZH5A 3HXEB 3WKFA 1QQFA 1KRFA 2RI8A 3SDQA 3Q73B 3HXFB 4L6XA 4D4BA 3KQ4A 3Q7AB 4WVBA 5CZLA 4D94A 3HXDB 3QWTA 2AHFA 1WU4A 2SQCA 3ACSA 4WU0A 5GY3A 1FT1B 2BB5A 2JG0A 4CJ1A 2D8LA 2XWJB 2WIIB 3HXCB 1G6IA 2EADA 3M7CA 3QPFA 1TF4A 1GAIA 4LNBB 3A3VA 1V5CA 1G87A 4J5TA 3M73A 1N4PB 1FBOA 4GTSB 1GA2A 3SFXB 3M75A 5FO8B 2ZIRB 1VD5A 1O1RB 1FMIA 3M7LA 4L9PB 3T33A 2IEJB 1O79A 3DSSB 3H3KA 3S9VA 3EZ8A 1GAHA 2EACA 4YCRA 5DGQA 4Z4LA 3W7WA 1KREA 1O1SB 1QBQB 2GOXA 3S4AA 4XUVA 1G9JA 2DRRA 4CE7A 3SDVA 1CLCA 1JCRB 3RX7A 3E33B 2P0VA 1QSJA 2XWBB 5E2JA 3S4BA 4ZH1A 5FOBB 1CEMA 3C72B 4ZG8A 1JS4A 1V5DA 4FXGB 3W7TA 4JJJA 1X9DA 4TXTA 2ZISB 1W6JA 1XWQA 1N9AB 1L2AA 1FP3A 2A8ZA 1DL2A 1KS8A 3QDEA 3RX8A 5DGRA 1FCEA 1NI1B 1TNBB 3WKIA 2BBCA 4D4AA 2V8IA 1WU6A 3SDRA 3D3IA 3DSTB 2ZBLA 2F0YB 2CQSA 1D8EB 2JJBA 5M7IA 4Z4JA 1H13A 2FUZA 3M77A 3CIHA 3H7LA 4AYOA 3E73A 1FO3A 3M72A 3QT3A 2EABA 2FV1A 3S4CA 3RRSA 3TF4A 3KSLB 3WC3A 4BOKA 3E34B 1H54A 2BEDB 1LD7B 1TN7B 1UT9A 3RENA 3PMMA 4GTMB 3W5MA 2ZZRA 4TF4A 3M74A 3RSYA 2G0DA 1JCQB 2VN7A 1TNOB 4MBGB 1SA4B 1FT2B 3W5NA 3K11A 1O6QA 2CQTA 5KKBA 3ANKA 4KTRA 1SQCA 4Q88A 4M76A 3AFJA 1N4SB 1FO2A 3S4DA 4AYRA 4D4CA 2JF4A 4EHMB 1S63B 1UG9A 2XFGA 4FUSA 3X17A 1TN6B 1V7VA 3GT5A 1H37A 1X81B 4AYPA 3DSUB 4Q2BA 4DOEA 1IS9A 4V1SA 1FBWA 3W7SA 3SQCA 1NXCA 3M78A 1H39A 3SAEA 3SDTA 1H14A 3SDUA 1FPPB 3QFYA 2PN5A 1MZCB 4MU9A 3PYBA 1KWFA 5FO7B 3QG0A 3EUVB 3ANIA 3WIQA 1LD8B 4ONTA 5JPNB 1KFGA 3KLSA 2H6HB 2V3PA 4EL8A 5GW7A 1W6KA 3DSWB 1N4QB 3PYAA 4LNGB 2GZ6A 1LF6A 1O6RA 3EU5B 3G6JB 4C1SA 5MEHA 4DODA 4ZRQA 1S64B 1GHQA 2FV0A 3Q78B 3D5RA 3K7XA 1FAEA 3ANJA 5CA3A 1KSDA 3WIWA 1JCSB 3EQAA 3E32B 1N94B 3Q75B 1F9DA 3QXQA 2H6FB 3PZ4B 1GXNA 1LF9A 4YDOB 1TNYB 4BOJA 2AFAA 4GTOB 3E37B 4GTPB 1KZPB 1H3AA 5M7YA 1H36A 1IA6A 1L1YA 2V8JA 2V8KA 2NVPA 4GTQB 1O5MB 4KTPA 2DRQA 2GH4A 1SA5B 4QT9A 2B39A 1K72A 3P2CA 1KZOB 2BB6A 1N95B 3GLYA 2WINB 3GZKA 4GTVB 2G02A 3P5RA 1V7XA 2FBAA 3QXFA 3DRAB 3ACTA 3KSQB 4CJ0A 3PZ2B 5CD2A 3M7BA 5GZKA 2VN4A 3PZ3B 3ON6A 1XW2A 3WUXA 3EU8A 3DSVB 1F9OA 3H2WA 1AYXA 3OXUA 1TNUB 5AGDA 4AYQA 5FO9B 1R76A 2DROA 1IA7A 3E30B 1DOGA 3DSXB 1O6HA 3VXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNG B;  2WY7 A;  1FT1 B;  1H3C A;  2BB5 A;  1O6R A;  2V3N A;  3EU5 B;  2R2L B;  3Q7F B;  3G6J B;  2XWJ B;  4C1S A;  2WII B;  3HXC B;  4ZRQ A;  1C3D A;  1S64 B;  4FXK B;  1GHQ A;  1NL4 B;  4KKI A;  4LNB B;  1H35 A;  3KSL B;  3D5R A;  3Q78 B;  1O1T B;  1N4P B;  4GTS B;  3K7X A;  3DPY B;  4ZRP A;  3SFX B;  3OED A;  1D8D B;  5FO8 B;  4BOK A;  2ZIR B;  3E34 B;  2BED B;  1JCS B;  1O1R B;  1HZF A;  1TN7 B;  1LD7 B;  3E32 B;  2I07 B;  5JPM B;  1N94 B;  4GTR B;  3Q75 B;  4L9P B;  4GTM B;  4D4D A;  2NOJ A;  2H6F B;  3D5S A;  2G0D A;  1JCQ B;  2IEJ B;  3PZ4 B;  1GXO A;  1GXN A;  1O79 A;  1TNO B;  3DSS B;  1TNY B;  4MBG B;  4YDO B;  4BOJ A;  2A73 B;  4GTO B;  1SA4 B;  1FT2 B;  1TN8 B;  4V1R A;  1GXM A;  3E37 B;  4GTP B;  1KZP B;  1O6Q A;  2H6G B;  3SFY B;  1H3A A;  1DCE B;  1H36 A;  1SQC A;  1O1S B;  4M76 A;  1QBQ B;  2WY8 A;  2V8J A;  2GOX A;  2V8K A;  2XQW A;  4GTQ B;  1H3B A;  1N4S B;  1O5M B;  4GTT B;  1SA5 B;  2B39 A;  4D4C A;  4EHM B;  1S63 B;  4LNV A;  1TNZ B;  1KZO B;  2BB6 A;  1GSZ A;  1JCR B;  2H6I B;  1N95 B;  1TN6 B;  4KKJ A;  2WIN B;  3E33 B;  3PZ1 B;  2G02 A;  4GTV B;  1QSJ A;  1H37 A;  2XWB B;  4ZH1 A;  5FOB B;  1X81 B;  3CU7 A;  3DSU B;  4YDE B;  1N4R B;  3C72 B;  3DRA B;  3RJ3 A;  4V1S A;  3HXB B;  4FXG B;  3SQC A;  3KSQ B;  3Q79 B;  1H39 A;  2ZIS B;  3PZ2 B;  1W6J A;  1UMP A;  1N9A B;  3PZ3 B;  1FPP B;  2PN5 A;  1MZC B;  4MU9 A;  2PMV A;  5FO7 B;  1LTX B;  3HXE B;  1NI1 B;  1TNB B;  3DSV B;  1QQF A;  3EUV B;  3OXU A;  3Q73 B;  1TNU B;  3HXF B;  5AGD A;  5FO9 B;  1LD8 B;  2BBC A;  4D4A A;  2V8I A;  1R76 A;  4ONT A;  5JPN B;  3KLS A;  2H6H B;  2V3P A;  4D4B A;  3DST B;  3KQ4 A;  2F0Y B;  1W6K A;  3E30 B;  1D8E B;  3Q7A B;  3DSX B;  4D94 A;  1O6H A;  3HXD B;  3DSW B;  1N4Q B;  2SQC A; 
#chains in the Genus database with same CATH topology
 2WY7 A;  1H3C A;  3WKH A;  4GL3 A;  2V3N A;  4FJQ A;  2R2L B;  3Q7F B;  4E1Y A;  4LIX A;  2RGK A;  3QRY A;  1C3D A;  4FXK B;  1NL4 B;  1HX9 A;  4KKI A;  1H35 A;  1O1T B;  2E24 A;  1RWH A;  3DPY B;  1KKT A;  4ZRP A;  3OED A;  1D8D B;  1F1S A;  3M02 A;  4WVC A;  2OKX A;  3E6U A;  3M76 A;  5JPM B;  1HZF A;  2I07 B;  3VW5 A;  4GTR B;  1N7R A;  1HCU A;  4D4D A;  2NOJ A;  3D5S A;  4L0G A;  1GXO A;  3W7X A;  2A73 B;  1TN8 B;  4V1R A;  1GXM A;  4F13 A;  4WVA A;  2H6G B;  3SFY B;  1DCE B;  1N1B A;  2WY8 A;  2XQW A;  2RI9 A;  1H12 A;  1NC5 A;  2DRS A;  1H3B A;  4GTT B;  1G9G A;  1AGM A;  2B4F A;  2QNO A;  4LNV A;  1GLM A;  1TNZ B;  5ILJ A;  3P5P A;  1RWC A;  1GSZ A;  3WKG A;  1WU5 A;  2H6I B;  3M7E A;  1V7W A;  2WYN A;  4KKJ A;  3PZ1 B;  3M00 A;  2EAE A;  2AHG A;  3QT9 A;  1N21 A;  3CU7 A;  4YDE B;  1X1H A;  3M71 A;  1N4R B;  3QFZ A;  3WIR A;  3RJ3 A;  2YIK A;  1EGU A;  3HXB B;  1WZZ A;  1N22 A;  1N1Z A;  5IL8 A;  3Q79 B;  1XWT A;  1ULV A;  3W7U A;  1KSC A;  1RQ5 A;  3RX5 A;  3QSP A;  1UMP A;  2F6D A;  2Z07 A;  2PMV A;  2D5J A;  1LTX B;  4ZH5 A;  1J0M A;  3HXE B;  4OZW A;  3WKF A;  1QQF A;  1KRF A;  2RI8 A;  3SDQ A;  3Q73 B;  3HXF B;  2Q1F A;  3M01 A;  4L6X A;  5EAS A;  4D4B A;  3KQ4 A;  5ILI A;  3Q7A B;  4WVB A;  5CZL A;  4D94 A;  3HXD B;  1RWA A;  3QWT A;  2AHF A;  1WU4 A;  2SQC A;  3ACS A;  3N0F A;  4WU0 A;  5GY3 A;  1FT1 B;  2BB5 A;  1N7O A;  2JG0 A;  4CJ1 A;  2D8L A;  2XWJ B;  2WII B;  3HXC B;  1G6I A;  2EAD A;  3M7C A;  3QPF A;  1TF4 A;  1GAI A;  1HM3 A;  4LNB B;  3A3V A;  1V5C A;  1G87 A;  4J5T A;  3M73 A;  1N4P B;  1FBO A;  4GAX A;  4GTS B;  1GA2 A;  3SFX B;  3M75 A;  5FO8 B;  2ZIR B;  1VD5 A;  1O1R B;  1FMI A;  3M7L A;  4L9P B;  3T33 A;  2IEJ B;  1O79 A;  3DSS B;  3H3K A;  5IK6 A;  3S9V A;  2BRW A;  3EZ8 A;  1GAH A;  1HXG A;  2EAC A;  4YCR A;  5DGQ A;  1HN0 A;  4Z4L A;  3W7W A;  1KRE A;  1O1S B;  1QBQ B;  2GOX A;  3N0G A;  3S4A A;  1RW9 A;  4XUV A;  5ILD A;  1F9G A;  1G9J A;  2DRR A;  5IL3 A;  4CE7 A;  1HMU A;  4MMI A;  3SDV A;  3G4F A;  1CLC A;  1JCR B;  3RX7 A;  3VSM A;  3E33 B;  2P0V A;  1QSJ A;  2XWB B;  5E2J A;  3S4B A;  1HXA A;  4ZH1 A;  5FOB B;  1CEM A;  1HM2 A;  3C72 B;  4ZG8 A;  1JS4 A;  5EAT A;  1V5D A;  4FXG B;  3W7T A;  4JJJ A;  1X9D A;  4TXT A;  2ZIS B;  5DHI A;  4OK4 A;  1W6J A;  1XWQ A;  1N9A B;  1L2A A;  1FP3 A;  2A8Z A;  1DL2 A;  1KS8 A;  3QDE A;  3RX8 A;  5DGR A;  1FCE A;  2E22 A;  1NI1 B;  1TNB B;  3WKI A;  2BBC A;  4D4A A;  2V8I A;  1WU6 A;  1HMW A;  3SDR A;  1QAZ A;  3AFL A;  3D3I A;  3DST B;  2ZBL A;  2F0Y B;  2CQS A;  1D8E B;  2JJB A;  5M7I A;  5C05 A;  4Z4J A;  1H13 A;  2FUZ A;  1N7N A;  3M77 A;  3CIH A;  3H7L A;  3A0O A;  4AYO A;  3E73 A;  1FO3 A;  3M72 A;  3QT3 A;  2EAB A;  2FV1 A;  3S4C A;  3RRS A;  3TF4 A;  3KSL B;  1I8Q A;  5IKH A;  3WC3 A;  4BOK A;  3E34 B;  1H54 A;  2BED B;  1LD7 B;  1N23 A;  1TN7 B;  1UT9 A;  3REN A;  1N20 A;  2BRV X;  3PMM A;  5JMD A;  4GTM B;  3W5M A;  2ZZR A;  4TF4 A;  3M74 A;  3RSY A;  2G0D A;  1JCQ B;  2VN7 A;  1TNO B;  4MBG B;  3NFV A;  5IM1 A;  1W3Y A;  1SA4 B;  1FT2 B;  1LXM A;  3W5N A;  3K11 A;  1O6Q A;  2CQT A;  5KKB A;  3ANK A;  4KTR A;  1SQC A;  4Q88 A;  4M76 A;  1N7P A;  3AFJ A;  1N4S B;  4FNV A;  1FO2 A;  1J0N A;  3S4D A;  4AYR A;  4DI5 A;  5IK9 A;  2ONG A;  4D4C A;  2JF4 A;  4EHM B;  1S63 B;  1UG9 A;  5ILZ A;  2XFG A;  4FUS A;  3X17 A;  1TN6 B;  1V7V A;  3GT5 A;  1H37 A;  1X81 B;  4AYP A;  3DSU B;  4Q2B A;  4DOE A;  1IS9 A;  4V1S A;  1FBW A;  3W7S A;  1RWF A;  3SQC A;  3NNB A;  1NXC A;  3M78 A;  1H39 A;  5DHK A;  3SAE A;  3SDT A;  3G4D A;  1H14 A;  4OK2 A;  3SDU A;  1FPP B;  3QFY A;  2PN5 A;  5ILH A;  1MZC B;  4MU9 A;  3PYB A;  1KWF A;  1HV6 A;  5FO7 B;  3QG0 A;  3EUV B;  2X03 A;  1X1I A;  3ANI A;  3WIQ A;  1LD8 B;  4ONT A;  5JPN B;  1KFG A;  3KLS A;  3LZ9 A;  2H6H B;  2V3P A;  1N24 A;  4EL8 A;  5GW7 A;  1W6K A;  5IKA A;  4NEI A;  3DSW B;  1N4Q B;  3PYA A;  3E7J A;  4LNG B;  2GZ6 A;  5JMF A;  4OJZ A;  1LF6 A;  1LXK A;  1O6R A;  2FUT A;  5ILK A;  3EU5 B;  3G6J B;  4C1S A;  5MEH A;  4DOD A;  2WCO A;  1HXC A;  4ZRQ A;  1S64 B;  5ILY A;  1GHQ A;  2FV0 A;  3Q78 B;  3D5R A;  2FUQ A;  3K7X A;  1FAE A;  3ANJ A;  5CA3 A;  1KSD A;  3WIW A;  2J5C A;  1JCS B;  3EQA A;  3E32 B;  1N94 B;  2ONH A;  1CB8 A;  3Q75 B;  1F9D A;  3QXQ A;  2H6F B;  3PZ4 B;  1GXN A;  1LF9 A;  4YDO B;  1TNY B;  4BOJ A;  2AFA A;  4GTO B;  3E80 A;  3E37 B;  4GTP B;  1KZP B;  2BRP A;  1OJP A;  1H3A A;  5M7Y A;  1H36 A;  1IA6 A;  1L1Y A;  2V8J A;  2V8K A;  2NVP A;  4GTQ B;  1O5M B;  4KTP A;  5EAU A;  2DRQ A;  2GH4 A;  1SA5 B;  4QT9 A;  2B39 A;  1K72 A;  1LOH A;  3P2C A;  1KZO B;  1C82 A;  2BB6 A;  1N95 B;  4RNQ A;  3GLY A;  2WIN B;  3GZK A;  2G02 A;  4GTV B;  3P5R A;  1V7X A;  2FBA A;  4MMH A;  3QXF A;  1OJO A;  3DRA B;  1N7Q A;  3ACT A;  3KSQ B;  4OZV A;  4CJ0 A;  4F10 A;  3PZ2 B;  1X1J A;  5CD2 A;  3M7B A;  5GZK A;  2VN4 A;  3PZ3 B;  1RWG A;  3ON6 A;  1XW2 A;  3WUX A;  3EU8 A;  1OJM A;  3DSV B;  1F9O A;  3H2W A;  1AYX A;  3OXU A;  1TNU B;  5AGD A;  4AYQ A;  5FO9 B;  1R76 A;  2DRO A;  3VSN A;  1IA7 A;  3E30 B;  2WDA A;  5IK0 A;  1DOG A;  3DSX B;  1O6H A;  1OJN A;  3VXD A; 
#chains in the Genus database with same CATH homology
 2WY7 A;  1H3C A;  3WKH A;  4GL3 A;  2V3N A;  2R2L B;  3Q7F B;  4LIX A;  2RGK A;  3QRY A;  1C3D A;  4FXK B;  1NL4 B;  4KKI A;  1H35 A;  1O1T B;  3DPY B;  1KKT A;  4ZRP A;  3OED A;  1D8D B;  4WVC A;  2OKX A;  3E6U A;  3M76 A;  5JPM B;  1HZF A;  2I07 B;  3VW5 A;  4GTR B;  1HCU A;  4D4D A;  2NOJ A;  3D5S A;  4L0G A;  1GXO A;  3W7X A;  2A73 B;  1TN8 B;  4V1R A;  1GXM A;  4WVA A;  2H6G B;  3SFY B;  1DCE B;  2WY8 A;  2XQW A;  2RI9 A;  1H12 A;  1NC5 A;  2DRS A;  1H3B A;  4GTT B;  1G9G A;  1AGM A;  2B4F A;  2QNO A;  4LNV A;  1GLM A;  1TNZ B;  3P5P A;  1GSZ A;  3WKG A;  3M7E A;  1WU5 A;  2H6I B;  1V7W A;  2WYN A;  4KKJ A;  3PZ1 B;  2EAE A;  2AHG A;  3QT9 A;  3CU7 A;  4YDE B;  3M71 A;  1N4R B;  3QFZ A;  3WIR A;  3RJ3 A;  2YIK A;  3HXB B;  1WZZ A;  3Q79 B;  1XWT A;  1ULV A;  3W7U A;  1KSC A;  1RQ5 A;  3RX5 A;  3QSP A;  1UMP A;  2F6D A;  2Z07 A;  2PMV A;  2D5J A;  1LTX B;  4ZH5 A;  3HXE B;  3WKF A;  1QQF A;  1KRF A;  2RI8 A;  3SDQ A;  3Q73 B;  3HXF B;  4L6X A;  4D4B A;  3KQ4 A;  3Q7A B;  4WVB A;  5CZL A;  4D94 A;  3HXD B;  3QWT A;  2AHF A;  1WU4 A;  2SQC A;  3ACS A;  4WU0 A;  5GY3 A;  1FT1 B;  2BB5 A;  2JG0 A;  4CJ1 A;  2D8L A;  2XWJ B;  2WII B;  3HXC B;  1G6I A;  2EAD A;  3M7C A;  3QPF A;  1TF4 A;  1GAI A;  4LNB B;  3A3V A;  1V5C A;  1G87 A;  4J5T A;  3M73 A;  1N4P B;  1FBO A;  4GTS B;  1GA2 A;  3SFX B;  3M75 A;  5FO8 B;  2ZIR B;  1VD5 A;  1O1R B;  1FMI A;  3M7L A;  4L9P B;  3T33 A;  2IEJ B;  1O79 A;  3DSS B;  3H3K A;  3S9V A;  3EZ8 A;  1GAH A;  2EAC A;  4YCR A;  5DGQ A;  4Z4L A;  3W7W A;  1KRE A;  1O1S B;  1QBQ B;  2GOX A;  3S4A A;  4XUV A;  1G9J A;  2DRR A;  4CE7 A;  3SDV A;  1CLC A;  1JCR B;  3RX7 A;  3E33 B;  2P0V A;  1QSJ A;  2XWB B;  5E2J A;  3S4B A;  4ZH1 A;  5FOB B;  1CEM A;  3C72 B;  4ZG8 A;  1JS4 A;  1V5D A;  4FXG B;  3W7T A;  4JJJ A;  1X9D A;  4TXT A;  2ZIS B;  1W6J A;  1XWQ A;  1N9A B;  1L2A A;  1FP3 A;  2A8Z A;  1DL2 A;  1KS8 A;  3QDE A;  3RX8 A;  5DGR A;  1FCE A;  1NI1 B;  1TNB B;  3WKI A;  2BBC A;  4D4A A;  2V8I A;  1WU6 A;  3SDR A;  3D3I A;  3DST B;  2ZBL A;  2F0Y B;  2CQS A;  1D8E B;  2JJB A;  5M7I A;  4Z4J A;  1H13 A;  2FUZ A;  3M77 A;  3CIH A;  3H7L A;  4AYO A;  3E73 A;  1FO3 A;  3M72 A;  3QT3 A;  2EAB A;  2FV1 A;  3S4C A;  3RRS A;  3TF4 A;  3KSL B;  3WC3 A;  4BOK A;  3E34 B;  1H54 A;  2BED B;  1LD7 B;  1TN7 B;  1UT9 A;  3REN A;  3PMM A;  4GTM B;  3W5M A;  2ZZR A;  4TF4 A;  3M74 A;  3RSY A;  2G0D A;  1JCQ B;  2VN7 A;  1TNO B;  4MBG B;  1SA4 B;  1FT2 B;  3W5N A;  3K11 A;  1O6Q A;  2CQT A;  5KKB A;  3ANK A;  4KTR A;  1SQC A;  4Q88 A;  4M76 A;  3AFJ A;  1N4S B;  1FO2 A;  3S4D A;  4AYR A;  4D4C A;  2JF4 A;  4EHM B;  1S63 B;  1UG9 A;  2XFG A;  4FUS A;  3X17 A;  1TN6 B;  1V7V A;  3GT5 A;  1H37 A;  1X81 B;  4AYP A;  3DSU B;  4Q2B A;  4DOE A;  1IS9 A;  4V1S A;  1FBW A;  3W7S A;  3SQC A;  1NXC A;  3M78 A;  1H39 A;  3SAE A;  3SDT A;  1H14 A;  3SDU A;  1FPP B;  3QFY A;  2PN5 A;  1MZC B;  4MU9 A;  3PYB A;  1KWF A;  5FO7 B;  3QG0 A;  3EUV B;  3ANI A;  3WIQ A;  1LD8 B;  4ONT A;  5JPN B;  1KFG A;  3KLS A;  2H6H B;  2V3P A;  4EL8 A;  5GW7 A;  1W6K A;  3DSW B;  1N4Q B;  3PYA A;  4LNG B;  2GZ6 A;  1LF6 A;  1O6R A;  3EU5 B;  3G6J B;  4C1S A;  5MEH A;  4DOD A;  4ZRQ A;  1S64 B;  1GHQ A;  2FV0 A;  3Q78 B;  3D5R A;  3K7X A;  1FAE A;  3ANJ A;  5CA3 A;  1KSD A;  3WIW A;  1JCS B;  3EQA A;  3E32 B;  1N94 B;  3Q75 B;  1F9D A;  3QXQ A;  2H6F B;  3PZ4 B;  1GXN A;  1LF9 A;  4YDO B;  1TNY B;  4BOJ A;  2AFA A;  4GTO B;  3E37 B;  4GTP B;  1KZP B;  1H3A A;  5M7Y A;  1H36 A;  1IA6 A;  1L1Y A;  2V8J A;  2V8K A;  2NVP A;  4GTQ B;  1O5M B;  4KTP A;  2DRQ A;  2GH4 A;  1SA5 B;  4QT9 A;  2B39 A;  1K72 A;  3P2C A;  1KZO B;  2BB6 A;  1N95 B;  3GLY A;  2WIN B;  3GZK A;  4GTV B;  2G02 A;  3P5R A;  1V7X A;  2FBA A;  3QXF A;  3DRA B;  3ACT A;  3KSQ B;  4CJ0 A;  3PZ2 B;  5CD2 A;  3M7B A;  5GZK A;  2VN4 A;  3PZ3 B;  3ON6 A;  1XW2 A;  3WUX A;  3EU8 A;  3DSV B;  1F9O A;  3H2W A;  1AYX A;  3OXU A;  1TNU B;  5AGD A;  4AYQ A;  5FO9 B;  1R76 A;  2DRO A;  1IA7 A;  3E30 B;  1DOG A;  3DSX B;  1O6H A;  3VXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...