4D4DA

The catalytic domain, bcgh76, of bacillus circulans aman6 in complex with 1,6-manifg
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
336
structure length
333
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHQNSDHIVDGNWAGQGTYESWSSAAAVQALNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title Evidence for a Boat Conformation at the Transition State of Gh76 Alpha-1,6-Mannanases- Key Enzymes in Bacterial and Fungal Mannoprotein Metabolism
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 138
structure length 333
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4d4dA00
3OEDA 3Q75B 2F0YB 2BEDB 1TN8B 4GTPB 1O1RB 2V8KA 3E34B 3DPYB 1UMPA 3PZ3B 3Q7FB 2G0DA 3Q78B 1N4PB 3HXDB 4LNVA 3SQCA 4GTTB 2BB5A 3EU5B 5FO7B 5JPNB 4BOKA 2XWJB 1H36A 3HXCB 1SA5B 2I07B 1D8DB 1JCSB 4GTVB 3Q7AB 1GXNA 3D5SA 2R2LB 3PZ1B 1TN7B 4KKIA 1N4QB 3DSWB 1H3AA 5FO8B 4FXGB 1O5MB 2GOXA 5FOBB 3SFXB 1S63B 1TNBB 1D8EB 4D4BA 2A73B 2V8JA 5JPMB 5AGDA 1W6JA 1KZPB 2NOJA 4ZH1A 3Q79B 4GTSB 4C1SA 4YDOB 4ZRQA 1QBQB 2BBCA 3EUVB 1O1SB 3KQ4A 2H6GB 1W6KA 3PZ2B 4D94A 3OXUA 2BB6A 1TN6B 3KSQB 2V8IA 1O6QA 4GTMB 1S64B 3D5RA 3E32B 4GTOB 4D4DA 4LNBB 2WIIB 1FPPB 3G6JB 1H39A 1H37A 2H6IB 4GTRB 2WY7A 1FT2B 4ZRPA 1JCRB 2G02A 1N9AB 3DSSB 1FT1B 1H3BA 4BOJA 4YDEB 2WY8A 1X81B 1C3DA 1NL4B 2V3PA 4EHMB 3K7XA 3C72B 1O6RA 3HXFB 1HZFA 2PMVA 1O79A 4KKJA 4ONTA 1GXOA 4D4AA 1N94B 1QQFA 3DSVB 1NI1B 4MBGB 1QSJA 2H6FB 1LD7B 3DSXB 3KSLB 5FO9B 3DSTB 1O1TB 1DCEB 1TNUB 1N95B 1TNOB 1H35A 1JCQB 1MZCB 1SQCA 2XWBB 1LTXB 3E30B 1TNZB 3HXBB 1SA4B 3Q73B 3SFYB 1LD8B 3HXEB 1N4RB 4L9PB 1GXMA 1O6HA 2SQCA 3E33B 3PZ4B 2ZISB 4V1RA 2B39A 4GTQB 3E37B 4MU9A 2XQWA 3CU7A 2WINB 3DSUB 4D4CA 2ZIRB 1R76A 4LNGB 4V1SA 4FXKB 1N4SB 3RJ3A 2V3NA 1KZOB 1TNYB 1H3CA 2IEJB 3KLSA 2PN5A 3DRAB 4M76A 1GSZA 2H6HB 1GHQA
chains in the Genus database with same CATH superfamily
3E80A 3W7SA 2RGKA 1V5DA 3PZ3B 3P5RA 3HXDB 4LNVA 3M01A 1HCUA 5DGQA 5KKBA 1WU5A 3WC3A 4RNQA 2FV0A 4BOKA 2XWJB 2ONHA 3GT5A 1KWFA 1H13A 4FNVA 1HXGA 3HXCB 2GH4A 1SA5B 3P5PA 2D8LA 5DGRA 2R2LB 1KRFA 3PZ1B 4KTPA 1N4QB 3NNBA 4FXGB 5FOBB 3E7JA 3SFXB 4WVBA 1K72A 1WZZA 5EATA 4D4BA 2V8JA 2ONGA 5JPMB 5ILYA 3Q79B 4C1SA 1QBQB 4J5TA 3PZ2B 3X17A 3RENA 1TN6B 2V8IA 1VD5A 3LZ9A 4LNBB 2WIIB 1FPPB 3G6JB 3W7TA 1H39A 5IK0A 1HMUA 3TF4A 3S4AA 1H37A 3QXFA 5JMFA 4GTRB 4ZRPA 5ILKA 4OJZA 4OK2A 3M7CA 2YIKA 1C3DA 1NL4B 2EAEA 4EHMB 1DL2A 3ON6A 1XWQA 2XFGA 4AYRA 3S4DA 3T33A 4CE7A 1CB8A 3SDRA 1H54A 1LD7B 3VSNA 5FO9B 2GZ6A 3QDEA 1AGMA 1MZCB 1FCEA 3SDVA 2XWBB 1DOGA 1GLMA 3VSMA 3HXBB 1SA4B 1XWTA 3M72A 5IM1A 3S9VA 2SQCA 3E33B 4GTQB 4Z4LA 5IK6A 3E37B 1RWHA 5JMDA 2WINB 3A3VA 4D4CA 1OJOA 3EZ8A 1HMWA 1N4SB 3S4CA 1KSCA 3KLSA 1GSZA 1F9OA 1FMIA 2F0YB 1TN8B 4GTPB 1O1RB 2V8KA 3Q7FB 3Q78B 1N4PB 4MMHA 2VN7A 4GTTB 2BB5A 3EU5B 3QXQA 1ULVA 1L1YA 3M00A 2QNOA 1H36A 2X03A 4GTVB 1KSDA 3M76A 4KKIA 3DSWB 3RX8A 5FO8B 1O5MB 1G9GA 1V7WA 3S4BA 4DODA 2BRPA 3ANJA 3QRYA 1LXMA 3RRSA 1W6JA 1KZPB 4GTSB 1O1SB 5CD2A 1HX9A 3OXUA 3M02A 1H12A 4GTOB 1N7RA 1KKTA 3WIWA 2FUTA 4ZG8A 4GL3A 5ILZA 5IKAA 1I8QA 1FO2A 3M73A 1JCRB 2RI9A 4CJ0A 1N9AB 1FT1B 1RWCA 2ZBLA 4L6XA 1RQ5A 3D3IA 1X81B 3W5NA 1LF9A 1JS4A 2WYNA 2FV1A 2PMVA 1L2AA 4ZH5A 3WUXA 2H6FB 1N20A 1X1HA 2AHFA 3DSTB 1O1TB 1W3YA 1TNOB 1TF4A 1H35A 3QFYA 3QT9A 1SQCA 4DI5A 3W5MA 1LTXB 3ANKA 1H14A 3E30B 1TNZB 1FAEA 3Q73B 3QT3A 1N21A 3N0FA 1RWFA 1X9DA 2OKXA 1GXMA 2CQSA 1KS8A 3PZ4B 1RWAA 3QWTA 3CIHA 4L0GA 1N7NA 4GAXA 2V3NA 1TNYB 5IL3A 3PMMA 2AHGA 1H3CA 2IEJB 4OZVA 4Q88A 4E1YA 3DRAB 2JJBA 2XQWA 4Q2BA 3GLYA 3AFLA 3K11A 3OEDA 3QFZA 2BEDB 5E2JA 1HXCA 1UMPA 3H7LA 1LXKA 1GAIA 5ILHA 3W7WA 2WDAA 3WKIA 1N1BA 4MMIA 2BRVX 1D8DB 3W7XA 3D5SA 1TN7B 4AYQA 1V7XA 2J5CA 2JG0A 4DOEA 5EASA 1KFGA 1G87A 1TNBB 1D8EB 3ANIA 5AGDA 2NOJA 4ZH1A 4YDOB 1OJMA 4ZRQA 1HM3A 4Z4JA 2BRWA 1UG9A 3QPFA 2E22A 2H6GB 1W6KA 3WIRA 2F6DA 5DHKA 2AFAA 4EL8A 2B4FA 3KSQB 1HXAA 1S64B 3E32B 3RX7A 1IS9A 2NVPA 3SDQA 5IK9A 2EADA 1G6IA 1CEMA 2WY7A 3E6UA 1FT2B 5MEHA 2G02A 4KTRA 3DSSB 4YDEB 1NXCA 2V3PA 1RW9A 3K7XA 3C72B 3HXFB 1HZFA 2DRQA 1O79A 5ILJA 4ONTA 1FO3A 4QT9A 4AYPA 4D4AA 1N94B 1NI1B 2ZZRA 3G4DA 4MBGB 4WU0A 3DSXB 3KSLB 3M7EA 2Q1FA 3QSPA 1JCQB 3M74A 3M7LA 1N7QA 1LF6A 1X1IA 3N0GA 5GW7A 2JF4A 3EU8A 3SAEA 3SFYB 5C05A 5CA3A 4WVAA 1V7VA 1N7OA 1J0NA 4LIXA 4TF4A 1KREA 1LOHA 4OZWA 2B39A 1GA2A 3G4FA 3A0OA 2VN4A 3CU7A 3DSUB 1R76A 4LNGB 4NEIA 4FXKB 1HV6A 5M7IA 4OK4A 3WKFA 2DRSA 2PN5A 4M76A 4CJ1A 1CLCA 1GHQA 3M75A 1IA6A 3Q75B 1OJNA 5IL8A 3AFJA 5EAUA 3SDTA 1FBWA 3E34B 3DPYB 2G0DA 1OJPA 3WKGA 1F9DA 1HN0A 5FO7B 5JPNB 5GY3A 1FBOA 1N22A 3E73A 2EABA 2I07B 1JCSB 3Q7AB 1GXNA 4F13A 1H3AA 2GOXA 2D5JA 1S63B 4WVCA 3W7UA 1QAZA 3ACSA 1N1ZA 2A73B 2CQTA 2Z07A 5DHIA 5IKHA 1RWGA 3PYAA 4AYOA 4F10A 1N7PA 2BBCA 3EUVB 3KQ4A 3RSYA 1C82A 3EQAA 4D94A 2BB6A 1J0MA 3RX5A 3ACTA 4GTMB 1O6QA 2E24A 3D5RA 3M7BA 1N23A 4D4DA 2H6IB 1AYXA 1WU4A 4YCRA 1IA7A 4TXTA 1H3BA 1V5CA 4BOJA 1F1SA 2DROA 2WY8A 3M78A 3P2CA 5ILIA 2RI8A 3PYBA 1FP3A 1O6RA 1N24A 4XUVA 3VXDA 4KKJA 1GAHA 3H2WA 1GXOA 1QQFA 3DSVB 1QSJA 2A8ZA 3H3KA 3WKHA 2DRRA 1DCEB 3WIQA 1TNUB 1N95B 4FUSA 3QG0A 1EGUA 1F9GA 4JJJA 3GZKA 3SDUA 1NC5A 1WU6A 1X1JA 2FUQA 1LD8B 2P0VA 2FUZA 3HXEB 1UT9A 1N4RB 2FBAA 3M77A 4L9PB 5CZLA 1O6HA 1XW2A 4FJQA 5GZKA 2ZISB 4V1RA 3M71A 4MU9A 5M7YA 2ZIRB 3VW5A 4V1SA 3NFVA 3RJ3A 1G9JA 2EACA 1KZOB 2WCOA 5ILDA 1HM2A 2H6HB 3SQCA
chains in the Genus database with same CATH topology
3W7SA 2RGKA 1V5DA 3PZ3B 3P5RA 3HXDB 4LNVA 1HCUA 5DGQA 5KKBA 1WU5A 3WC3A 2FV0A 4BOKA 2XWJB 3GT5A 1KWFA 1H13A 3HXCB 2GH4A 1SA5B 3P5PA 2D8LA 5DGRA 2R2LB 1KRFA 3PZ1B 4KTPA 1N4QB 4FXGB 5FOBB 3SFXB 4WVBA 1K72A 1WZZA 4D4BA 2V8JA 5JPMB 3Q79B 4C1SA 1QBQB 4J5TA 3PZ2B 3X17A 3RENA 1TN6B 2V8IA 1VD5A 4LNBB 2WIIB 1FPPB 3G6JB 3W7TA 1H39A 3TF4A 3S4AA 1H37A 3QXFA 4GTRB 4ZRPA 3M7CA 2YIKA 1C3DA 1NL4B 2EAEA 4EHMB 1DL2A 3ON6A 1XWQA 2XFGA 4AYRA 3S4DA 3T33A 4CE7A 3SDRA 1H54A 1LD7B 5FO9B 2GZ6A 3QDEA 1AGMA 1MZCB 1FCEA 3SDVA 2XWBB 1DOGA 1GLMA 3HXBB 1SA4B 1XWTA 3M72A 3S9VA 2SQCA 3E33B 4GTQB 4Z4LA 3E37B 2WINB 3A3VA 4D4CA 3EZ8A 1N4SB 3S4CA 1KSCA 3KLSA 1GSZA 1F9OA 1FMIA 2F0YB 1TN8B 4GTPB 1O1RB 2V8KA 3Q7FB 3Q78B 1N4PB 2VN7A 4GTTB 2BB5A 3EU5B 3QXQA 1ULVA 1L1YA 2QNOA 1H36A 4GTVB 1KSDA 3M76A 4KKIA 3DSWB 3RX8A 5FO8B 1O5MB 1G9GA 1V7WA 3S4BA 4DODA 3ANJA 3QRYA 3RRSA 1W6JA 1KZPB 4GTSB 1O1SB 5CD2A 3OXUA 1H12A 4GTOB 1KKTA 3WIWA 4ZG8A 4GL3A 1FO2A 3M73A 1JCRB 2RI9A 4CJ0A 1N9AB 1FT1B 2ZBLA 4L6XA 1RQ5A 3D3IA 1X81B 3W5NA 1LF9A 1JS4A 2WYNA 2FV1A 2PMVA 1L2AA 4ZH5A 3WUXA 2H6FB 2AHFA 3DSTB 1O1TB 1TNOB 1TF4A 1H35A 3QFYA 3QT9A 1SQCA 3W5MA 1LTXB 3ANKA 1H14A 3E30B 1TNZB 1FAEA 3Q73B 3QT3A 1X9DA 2OKXA 1GXMA 2CQSA 1KS8A 3PZ4B 3QWTA 3CIHA 4L0GA 2V3NA 1TNYB 3PMMA 2AHGA 1H3CA 2IEJB 4Q88A 3DRAB 2JJBA 2XQWA 4Q2BA 3GLYA 3K11A 3OEDA 3QFZA 2BEDB 5E2JA 1UMPA 3H7LA 1GAIA 3W7WA 3WKIA 1D8DB 3W7XA 3D5SA 1TN7B 4AYQA 1V7XA 2JG0A 4DOEA 1KFGA 1G87A 1TNBB 1D8EB 3ANIA 5AGDA 2NOJA 4ZH1A 4YDOB 4ZRQA 4Z4JA 1UG9A 3QPFA 2H6GB 1W6KA 3WIRA 2F6DA 2AFAA 4EL8A 2B4FA 3KSQB 1S64B 3E32B 3RX7A 1IS9A 2NVPA 3SDQA 2EADA 1G6IA 1CEMA 2WY7A 3E6UA 1FT2B 5MEHA 2G02A 4KTRA 3DSSB 4YDEB 1NXCA 2V3PA 3K7XA 3C72B 3HXFB 1HZFA 2DRQA 1O79A 4ONTA 1FO3A 4QT9A 4AYPA 4D4AA 1N94B 1NI1B 2ZZRA 4MBGB 4WU0A 3DSXB 3KSLB 3M7EA 3QSPA 1JCQB 3M74A 3M7LA 1LF6A 5GW7A 2JF4A 3EU8A 3SAEA 3SFYB 5CA3A 4WVAA 1V7VA 4LIXA 4TF4A 1KREA 2B39A 1GA2A 2VN4A 3CU7A 3DSUB 1R76A 4LNGB 4FXKB 5M7IA 3WKFA 2DRSA 2PN5A 4M76A 4CJ1A 1CLCA 1GHQA 3M75A 1IA6A 3Q75B 3AFJA 3SDTA 1FBWA 3E34B 3DPYB 2G0DA 3WKGA 1F9DA 5FO7B 5JPNB 5GY3A 1FBOA 3E73A 2EABA 2I07B 1JCSB 3Q7AB 1GXNA 1H3AA 2GOXA 2D5JA 1S63B 4WVCA 3W7UA 3ACSA 2A73B 2CQTA 2Z07A 3PYAA 4AYOA 2BBCA 3EUVB 3KQ4A 3RSYA 3EQAA 4D94A 2BB6A 3RX5A 3ACTA 4GTMB 1O6QA 3D5RA 3M7BA 4D4DA 2H6IB 1AYXA 1WU4A 4YCRA 1IA7A 4TXTA 1H3BA 1V5CA 4BOJA 2DROA 2WY8A 3M78A 3P2CA 2RI8A 3PYBA 1FP3A 1O6RA 4XUVA 3VXDA 4KKJA 1GAHA 3H2WA 1GXOA 1QQFA 3DSVB 1QSJA 2A8ZA 3H3KA 3WKHA 2DRRA 1DCEB 3WIQA 1TNUB 1N95B 4FUSA 3QG0A 4JJJA 3GZKA 3SDUA 1NC5A 1WU6A 1LD8B 2P0VA 2FUZA 3HXEB 1UT9A 1N4RB 2FBAA 3M77A 4L9PB 5CZLA 1O6HA 1XW2A 5GZKA 2ZISB 4V1RA 3M71A 4MU9A 5M7YA 2ZIRB 3VW5A 4V1SA 3RJ3A 1G9JA 2EACA 1KZOB 2H6HB 3SQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OED A;  3Q75 B;  2F0Y B;  2BED B;  1TN8 B;  4GTP B;  1O1R B;  2V8K A;  3E34 B;  3DPY B;  1UMP A;  3PZ3 B;  3Q7F B;  2G0D A;  3Q78 B;  1N4P B;  3HXD B;  4LNV A;  3SQC A;  4GTT B;  2BB5 A;  3EU5 B;  5FO7 B;  5JPN B;  4BOK A;  2XWJ B;  1H36 A;  3HXC B;  1SA5 B;  2I07 B;  1D8D B;  1JCS B;  4GTV B;  3Q7A B;  1GXN A;  3D5S A;  2R2L B;  3PZ1 B;  1TN7 B;  4KKI A;  1N4Q B;  3DSW B;  1H3A A;  5FO8 B;  4FXG B;  1O5M B;  2GOX A;  5FOB B;  3SFX B;  1S63 B;  1TNB B;  1D8E B;  4D4B A;  2A73 B;  2V8J A;  5JPM B;  5AGD A;  1W6J A;  1KZP B;  2NOJ A;  4ZH1 A;  3Q79 B;  4GTS B;  4C1S A;  4YDO B;  4ZRQ A;  1QBQ B;  2BBC A;  3EUV B;  1O1S B;  3KQ4 A;  2H6G B;  1W6K A;  3PZ2 B;  4D94 A;  3OXU A;  2BB6 A;  1TN6 B;  3KSQ B;  2V8I A;  1O6Q A;  4GTM B;  1S64 B;  3D5R A;  3E32 B;  4GTO B;  4D4D A;  4LNB B;  2WII B;  1FPP B;  3G6J B;  1H39 A;  1H37 A;  2H6I B;  4GTR B;  2WY7 A;  1FT2 B;  4ZRP A;  1JCR B;  2G02 A;  1N9A B;  3DSS B;  1FT1 B;  1H3B A;  4BOJ A;  4YDE B;  2WY8 A;  1X81 B;  1C3D A;  1NL4 B;  2V3P A;  4EHM B;  3K7X A;  3C72 B;  1O6R A;  3HXF B;  1HZF A;  2PMV A;  1O79 A;  4KKJ A;  4ONT A;  1GXO A;  4D4A A;  1N94 B;  1QQF A;  3DSV B;  1NI1 B;  4MBG B;  1QSJ A;  2H6F B;  1LD7 B;  3DSX B;  3KSL B;  5FO9 B;  3DST B;  1O1T B;  1DCE B;  1TNU B;  1N95 B;  1TNO B;  1H35 A;  1JCQ B;  1MZC B;  1SQC A;  2XWB B;  1LTX B;  3E30 B;  1TNZ B;  3HXB B;  1SA4 B;  3Q73 B;  3SFY B;  1LD8 B;  3HXE B;  1N4R B;  4L9P B;  1GXM A;  1O6H A;  2SQC A;  3E33 B;  3PZ4 B;  2ZIS B;  4V1R A;  2B39 A;  4GTQ B;  3E37 B;  4MU9 A;  2XQW A;  3CU7 A;  2WIN B;  3DSU B;  4D4C A;  2ZIR B;  1R76 A;  4LNG B;  4V1S A;  4FXK B;  1N4S B;  3RJ3 A;  2V3N A;  1KZO B;  1TNY B;  1H3C A;  2IEJ B;  3KLS A;  2PN5 A;  3DRA B;  4M76 A;  1GSZ A;  2H6H B;  1GHQ A; 
#chains in the Genus database with same CATH topology
 3E80 A;  3W7S A;  2RGK A;  1V5D A;  3PZ3 B;  3P5R A;  3HXD B;  4LNV A;  3M01 A;  1HCU A;  5DGQ A;  5KKB A;  1WU5 A;  3WC3 A;  4RNQ A;  2FV0 A;  4BOK A;  2XWJ B;  2ONH A;  3GT5 A;  1KWF A;  1H13 A;  4FNV A;  1HXG A;  3HXC B;  2GH4 A;  1SA5 B;  3P5P A;  2D8L A;  5DGR A;  2R2L B;  1KRF A;  3PZ1 B;  4KTP A;  1N4Q B;  3NNB A;  4FXG B;  5FOB B;  3E7J A;  3SFX B;  4WVB A;  1K72 A;  1WZZ A;  5EAT A;  4D4B A;  2V8J A;  2ONG A;  5JPM B;  5ILY A;  3Q79 B;  4C1S A;  1QBQ B;  4J5T A;  3PZ2 B;  3X17 A;  3REN A;  1TN6 B;  2V8I A;  1VD5 A;  3LZ9 A;  4LNB B;  2WII B;  1FPP B;  3G6J B;  3W7T A;  1H39 A;  5IK0 A;  1HMU A;  3TF4 A;  3S4A A;  1H37 A;  3QXF A;  5JMF A;  4GTR B;  4ZRP A;  5ILK A;  4OJZ A;  4OK2 A;  3M7C A;  2YIK A;  1C3D A;  1NL4 B;  2EAE A;  4EHM B;  1DL2 A;  3ON6 A;  1XWQ A;  2XFG A;  4AYR A;  3S4D A;  3T33 A;  4CE7 A;  1CB8 A;  3SDR A;  1H54 A;  1LD7 B;  3VSN A;  5FO9 B;  2GZ6 A;  3QDE A;  1AGM A;  1MZC B;  1FCE A;  3SDV A;  2XWB B;  1DOG A;  1GLM A;  3VSM A;  3HXB B;  1SA4 B;  1XWT A;  3M72 A;  5IM1 A;  3S9V A;  2SQC A;  3E33 B;  4GTQ B;  4Z4L A;  5IK6 A;  3E37 B;  1RWH A;  5JMD A;  2WIN B;  3A3V A;  4D4C A;  1OJO A;  3EZ8 A;  1HMW A;  1N4S B;  3S4C A;  1KSC A;  3KLS A;  1GSZ A;  1F9O A;  1FMI A;  2F0Y B;  1TN8 B;  4GTP B;  1O1R B;  2V8K A;  3Q7F B;  3Q78 B;  1N4P B;  4MMH A;  2VN7 A;  4GTT B;  2BB5 A;  3EU5 B;  3QXQ A;  1ULV A;  1L1Y A;  3M00 A;  2QNO A;  1H36 A;  2X03 A;  4GTV B;  1KSD A;  3M76 A;  4KKI A;  3DSW B;  3RX8 A;  5FO8 B;  1O5M B;  1G9G A;  1V7W A;  3S4B A;  4DOD A;  2BRP A;  3ANJ A;  3QRY A;  1LXM A;  3RRS A;  1W6J A;  1KZP B;  4GTS B;  1O1S B;  5CD2 A;  1HX9 A;  3OXU A;  3M02 A;  1H12 A;  4GTO B;  1N7R A;  1KKT A;  3WIW A;  2FUT A;  4ZG8 A;  4GL3 A;  5ILZ A;  5IKA A;  1I8Q A;  1FO2 A;  3M73 A;  1JCR B;  2RI9 A;  4CJ0 A;  1N9A B;  1FT1 B;  1RWC A;  2ZBL A;  4L6X A;  1RQ5 A;  3D3I A;  1X81 B;  3W5N A;  1LF9 A;  1JS4 A;  2WYN A;  2FV1 A;  2PMV A;  1L2A A;  4ZH5 A;  3WUX A;  2H6F B;  1N20 A;  1X1H A;  2AHF A;  3DST B;  1O1T B;  1W3Y A;  1TNO B;  1TF4 A;  1H35 A;  3QFY A;  3QT9 A;  1SQC A;  4DI5 A;  3W5M A;  1LTX B;  3ANK A;  1H14 A;  3E30 B;  1TNZ B;  1FAE A;  3Q73 B;  3QT3 A;  1N21 A;  3N0F A;  1RWF A;  1X9D A;  2OKX A;  1GXM A;  2CQS A;  1KS8 A;  3PZ4 B;  1RWA A;  3QWT A;  3CIH A;  4L0G A;  1N7N A;  4GAX A;  2V3N A;  1TNY B;  5IL3 A;  3PMM A;  2AHG A;  1H3C A;  2IEJ B;  4OZV A;  4Q88 A;  4E1Y A;  3DRA B;  2JJB A;  2XQW A;  4Q2B A;  3GLY A;  3AFL A;  3K11 A;  3OED A;  3QFZ A;  2BED B;  5E2J A;  1HXC A;  1UMP A;  3H7L A;  1LXK A;  1GAI A;  5ILH A;  3W7W A;  2WDA A;  3WKI A;  1N1B A;  4MMI A;  2BRV X;  1D8D B;  3W7X A;  3D5S A;  1TN7 B;  4AYQ A;  1V7X A;  2J5C A;  2JG0 A;  4DOE A;  5EAS A;  1KFG A;  1G87 A;  1TNB B;  1D8E B;  3ANI A;  5AGD A;  2NOJ A;  4ZH1 A;  4YDO B;  1OJM A;  4ZRQ A;  1HM3 A;  4Z4J A;  2BRW A;  1UG9 A;  3QPF A;  2E22 A;  2H6G B;  1W6K A;  3WIR A;  2F6D A;  5DHK A;  2AFA A;  4EL8 A;  2B4F A;  3KSQ B;  1HXA A;  1S64 B;  3E32 B;  3RX7 A;  1IS9 A;  2NVP A;  3SDQ A;  5IK9 A;  2EAD A;  1G6I A;  1CEM A;  2WY7 A;  3E6U A;  1FT2 B;  5MEH A;  2G02 A;  4KTR A;  3DSS B;  4YDE B;  1NXC A;  2V3P A;  1RW9 A;  3K7X A;  3C72 B;  3HXF B;  1HZF A;  2DRQ A;  1O79 A;  5ILJ A;  4ONT A;  1FO3 A;  4QT9 A;  4AYP A;  4D4A A;  1N94 B;  1NI1 B;  2ZZR A;  3G4D A;  4MBG B;  4WU0 A;  3DSX B;  3KSL B;  3M7E A;  2Q1F A;  3QSP A;  1JCQ B;  3M74 A;  3M7L A;  1N7Q A;  1LF6 A;  1X1I A;  3N0G A;  5GW7 A;  2JF4 A;  3EU8 A;  3SAE A;  3SFY B;  5C05 A;  5CA3 A;  4WVA A;  1V7V A;  1N7O A;  1J0N A;  4LIX A;  4TF4 A;  1KRE A;  1LOH A;  4OZW A;  2B39 A;  1GA2 A;  3G4F A;  3A0O A;  2VN4 A;  3CU7 A;  3DSU B;  1R76 A;  4LNG B;  4NEI A;  4FXK B;  1HV6 A;  5M7I A;  4OK4 A;  3WKF A;  2DRS A;  2PN5 A;  4M76 A;  4CJ1 A;  1CLC A;  1GHQ A;  3M75 A;  1IA6 A;  3Q75 B;  1OJN A;  5IL8 A;  3AFJ A;  5EAU A;  3SDT A;  1FBW A;  3E34 B;  3DPY B;  2G0D A;  1OJP A;  3WKG A;  1F9D A;  1HN0 A;  5FO7 B;  5JPN B;  5GY3 A;  1FBO A;  1N22 A;  3E73 A;  2EAB A;  2I07 B;  1JCS B;  3Q7A B;  1GXN A;  4F13 A;  1H3A A;  2GOX A;  2D5J A;  1S63 B;  4WVC A;  3W7U A;  1QAZ A;  3ACS A;  1N1Z A;  2A73 B;  2CQT A;  2Z07 A;  5DHI A;  5IKH A;  1RWG A;  3PYA A;  4AYO A;  4F10 A;  1N7P A;  2BBC A;  3EUV B;  3KQ4 A;  3RSY A;  1C82 A;  3EQA A;  4D94 A;  2BB6 A;  1J0M A;  3RX5 A;  3ACT A;  4GTM B;  1O6Q A;  2E24 A;  3D5R A;  3M7B A;  1N23 A;  4D4D A;  2H6I B;  1AYX A;  1WU4 A;  4YCR A;  1IA7 A;  4TXT A;  1H3B A;  1V5C A;  4BOJ A;  1F1S A;  2DRO A;  2WY8 A;  3M78 A;  3P2C A;  5ILI A;  2RI8 A;  3PYB A;  1FP3 A;  1O6R A;  1N24 A;  4XUV A;  3VXD A;  4KKJ A;  1GAH A;  3H2W A;  1GXO A;  1QQF A;  3DSV B;  1QSJ A;  2A8Z A;  3H3K A;  3WKH A;  2DRR A;  1DCE B;  3WIQ A;  1TNU B;  1N95 B;  4FUS A;  3QG0 A;  1EGU A;  1F9G A;  4JJJ A;  3GZK A;  3SDU A;  1NC5 A;  1WU6 A;  1X1J A;  2FUQ A;  1LD8 B;  2P0V A;  2FUZ A;  3HXE B;  1UT9 A;  1N4R B;  2FBA A;  3M77 A;  4L9P B;  5CZL A;  1O6H A;  1XW2 A;  4FJQ A;  5GZK A;  2ZIS B;  4V1R A;  3M71 A;  4MU9 A;  5M7Y A;  2ZIR B;  3VW5 A;  4V1S A;  3NFV A;  3RJ3 A;  1G9J A;  2EAC A;  1KZO B;  2WCO A;  5ILD A;  1HM2 A;  2H6H B;  3SQC A; 
#chains in the Genus database with same CATH homology
 3W7S A;  2RGK A;  1V5D A;  3PZ3 B;  3P5R A;  3HXD B;  4LNV A;  1HCU A;  5DGQ A;  5KKB A;  1WU5 A;  3WC3 A;  2FV0 A;  4BOK A;  2XWJ B;  3GT5 A;  1KWF A;  1H13 A;  3HXC B;  2GH4 A;  1SA5 B;  3P5P A;  2D8L A;  5DGR A;  2R2L B;  1KRF A;  3PZ1 B;  4KTP A;  1N4Q B;  4FXG B;  5FOB B;  3SFX B;  4WVB A;  1K72 A;  1WZZ A;  4D4B A;  2V8J A;  5JPM B;  3Q79 B;  4C1S A;  1QBQ B;  4J5T A;  3PZ2 B;  3X17 A;  3REN A;  1TN6 B;  2V8I A;  1VD5 A;  4LNB B;  2WII B;  1FPP B;  3G6J B;  3W7T A;  1H39 A;  3TF4 A;  3S4A A;  1H37 A;  3QXF A;  4GTR B;  4ZRP A;  3M7C A;  2YIK A;  1C3D A;  1NL4 B;  2EAE A;  4EHM B;  1DL2 A;  3ON6 A;  1XWQ A;  2XFG A;  4AYR A;  3S4D A;  3T33 A;  4CE7 A;  3SDR A;  1H54 A;  1LD7 B;  5FO9 B;  2GZ6 A;  3QDE A;  1AGM A;  1MZC B;  1FCE A;  3SDV A;  2XWB B;  1DOG A;  1GLM A;  3HXB B;  1SA4 B;  1XWT A;  3M72 A;  3S9V A;  2SQC A;  3E33 B;  4GTQ B;  4Z4L A;  3E37 B;  2WIN B;  3A3V A;  4D4C A;  3EZ8 A;  1N4S B;  3S4C A;  1KSC A;  3KLS A;  1GSZ A;  1F9O A;  1FMI A;  2F0Y B;  1TN8 B;  4GTP B;  1O1R B;  2V8K A;  3Q7F B;  3Q78 B;  1N4P B;  2VN7 A;  4GTT B;  2BB5 A;  3EU5 B;  3QXQ A;  1ULV A;  1L1Y A;  2QNO A;  1H36 A;  4GTV B;  1KSD A;  3M76 A;  4KKI A;  3DSW B;  3RX8 A;  5FO8 B;  1O5M B;  1G9G A;  1V7W A;  3S4B A;  4DOD A;  3ANJ A;  3QRY A;  3RRS A;  1W6J A;  1KZP B;  4GTS B;  1O1S B;  5CD2 A;  3OXU A;  1H12 A;  4GTO B;  1KKT A;  3WIW A;  4ZG8 A;  4GL3 A;  1FO2 A;  3M73 A;  1JCR B;  2RI9 A;  4CJ0 A;  1N9A B;  1FT1 B;  2ZBL A;  4L6X A;  1RQ5 A;  3D3I A;  1X81 B;  3W5N A;  1LF9 A;  1JS4 A;  2WYN A;  2FV1 A;  2PMV A;  1L2A A;  4ZH5 A;  3WUX A;  2H6F B;  2AHF A;  3DST B;  1O1T B;  1TNO B;  1TF4 A;  1H35 A;  3QFY A;  3QT9 A;  1SQC A;  3W5M A;  1LTX B;  3ANK A;  1H14 A;  3E30 B;  1TNZ B;  1FAE A;  3Q73 B;  3QT3 A;  1X9D A;  2OKX A;  1GXM A;  2CQS A;  1KS8 A;  3PZ4 B;  3QWT A;  3CIH A;  4L0G A;  2V3N A;  1TNY B;  3PMM A;  2AHG A;  1H3C A;  2IEJ B;  4Q88 A;  3DRA B;  2JJB A;  2XQW A;  4Q2B A;  3GLY A;  3K11 A;  3OED A;  3QFZ A;  2BED B;  5E2J A;  1UMP A;  3H7L A;  1GAI A;  3W7W A;  3WKI A;  1D8D B;  3W7X A;  3D5S A;  1TN7 B;  4AYQ A;  1V7X A;  2JG0 A;  4DOE A;  1KFG A;  1G87 A;  1TNB B;  1D8E B;  3ANI A;  5AGD A;  2NOJ A;  4ZH1 A;  4YDO B;  4ZRQ A;  4Z4J A;  1UG9 A;  3QPF A;  2H6G B;  1W6K A;  3WIR A;  2F6D A;  2AFA A;  4EL8 A;  2B4F A;  3KSQ B;  1S64 B;  3E32 B;  3RX7 A;  1IS9 A;  2NVP A;  3SDQ A;  2EAD A;  1G6I A;  1CEM A;  2WY7 A;  3E6U A;  1FT2 B;  5MEH A;  2G02 A;  4KTR A;  3DSS B;  4YDE B;  1NXC A;  2V3P A;  3K7X A;  3C72 B;  3HXF B;  1HZF A;  2DRQ A;  1O79 A;  4ONT A;  1FO3 A;  4QT9 A;  4AYP A;  4D4A A;  1N94 B;  1NI1 B;  2ZZR A;  4MBG B;  4WU0 A;  3DSX B;  3KSL B;  3M7E A;  3QSP A;  1JCQ B;  3M74 A;  3M7L A;  1LF6 A;  5GW7 A;  2JF4 A;  3EU8 A;  3SAE A;  3SFY B;  5CA3 A;  4WVA A;  1V7V A;  4LIX A;  4TF4 A;  1KRE A;  2B39 A;  1GA2 A;  2VN4 A;  3CU7 A;  3DSU B;  1R76 A;  4LNG B;  4FXK B;  5M7I A;  3WKF A;  2DRS A;  2PN5 A;  4M76 A;  4CJ1 A;  1CLC A;  1GHQ A;  3M75 A;  1IA6 A;  3Q75 B;  3AFJ A;  3SDT A;  1FBW A;  3E34 B;  3DPY B;  2G0D A;  3WKG A;  1F9D A;  5FO7 B;  5JPN B;  5GY3 A;  1FBO A;  3E73 A;  2EAB A;  2I07 B;  1JCS B;  3Q7A B;  1GXN A;  1H3A A;  2GOX A;  2D5J A;  1S63 B;  4WVC A;  3W7U A;  3ACS A;  2A73 B;  2CQT A;  2Z07 A;  3PYA A;  4AYO A;  2BBC A;  3EUV B;  3KQ4 A;  3RSY A;  3EQA A;  4D94 A;  2BB6 A;  3RX5 A;  3ACT A;  4GTM B;  1O6Q A;  3D5R A;  3M7B A;  4D4D A;  2H6I B;  1AYX A;  1WU4 A;  4YCR A;  1IA7 A;  4TXT A;  1H3B A;  1V5C A;  4BOJ A;  2DRO A;  2WY8 A;  3M78 A;  3P2C A;  2RI8 A;  3PYB A;  1FP3 A;  1O6R A;  4XUV A;  3VXD A;  4KKJ A;  1GAH A;  3H2W A;  1GXO A;  1QQF A;  3DSV B;  1QSJ A;  2A8Z A;  3H3K A;  3WKH A;  2DRR A;  1DCE B;  3WIQ A;  1TNU B;  1N95 B;  4FUS A;  3QG0 A;  4JJJ A;  3GZK A;  3SDU A;  1NC5 A;  1WU6 A;  1LD8 B;  2P0V A;  2FUZ A;  3HXE B;  1UT9 A;  1N4R B;  2FBA A;  3M77 A;  4L9P B;  5CZL A;  1O6H A;  1XW2 A;  5GZK A;  2ZIS B;  4V1R A;  3M71 A;  4MU9 A;  5M7Y A;  2ZIR B;  3VW5 A;  4V1S A;  3RJ3 A;  1G9J A;  2EAC A;  1KZO B;  2H6H B;  3SQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...