2NVPA

X-ray crystal structure of protein cpf_0428 from clostridium perfringens. northeast structural genomics consortium target cpr63.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
430
structure length
430
Chain Sequence
SLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNDDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINKKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Crystal Structure of the Hypothetical Protein CPF_0428 from Clostridium perfringens, Northeast Structural Genomics Target CpR63.
rcsb
source organism Clostridium perfringens
molecule tags Structural genomics, unknown function
total genus 143
structure length 430
sequence length 430
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2nvpA01
4KTRA 4ZG8A 3E73A 4Z4LA 1KRFA 3GT5A 3S4BA 3GZKA 1K72A 3AFJA 4DOEA 1AGMA 3QXQA 3H2WA 3WKGA 2VN7A 1RQ5A 1KWFA 1WU4A 3QRYA 1VD5A 3D3IA 1HCUA 3T33A 1KFGA 2DRRA 1XWTA 2D8LA 2AHFA 3WUXA 5CA3A 4KTPA 2ZBLA 3QFZA 1IS9A 4L0GA 5GY3A 1WZZA 1DL2A 5MEHA 3QDEA 4ZH5A 2AFAA 3P2CA 1V7WA 2A8ZA 2EACA 3QFYA 2JJBA 3EZ8A 2EABA 3QT9A 1H54A 4XUVA 3X17A 3WIRA 3A3VA 1ULVA 4AYPA 3W7WA 1AYXA 3WC3A 3RENA 3GLYA 3QG0A 1X9DA 2DRSA 4L6XA 3H3KA 4AYRA 1GA2A 2FUZA 3PMMA 4FUSA 5DGRA 3VW5A 5M7YA 1NC5A 2CQTA 2WYNA 3ANIA 3ANJA 1V7XA 4TF4A 1NXCA 1L2AA 3TF4A 3QPFA 1LF9A 2AHGA 3ACSA 3QSPA 3W7SA 4TXTA 2RI9A 4JJJA 1KREA 1DOGA 2VN4A 2QNOA 1FBOA 2DRQA 2D5JA 2XFGA 3WKFA 4CE7A 2DROA 1FCEA 1IA6A 1KSDA 5KKBA 3RRSA 4CJ1A 3W7XA 3WIWA 4J5TA 1IA7A 1KS8A 3E6UA 2FBAA 2B4FA 2NVPA 1JS4A 1FAEA 3QXFA 3ON6A 2F6DA 1F9OA 3EQAA 2RGKA 3S4CA 2ZZRA 4WVAA 4WVBA 5CZLA 4Z4JA 4CJ0A 1V5DA 1LF6A 1H12A 1L1YA 3H7LA 2JG0A 1V5CA 1WU6A 3W7TA 2YIKA 1KKTA 5E2JA 2FV1A 1XWQA 2FV0A 3WKHA 1UG9A 1FMIA 1CLCA 3K11A 1TF4A 1KSCA 3ANKA 4AYOA 4EL8A 1G6IA 2EADA 2CQSA 1CEMA 3RX7A 3RX8A 3CIHA 2Z07A 1GAIA 1V7VA 3WKIA 1FO2A 3W5NA 4Q2BA 1G9JA 2OKXA 1H14A 3RSYA 3S4AA 1G9GA 2GZ6A 5GW7A 2GH4A 3QT3A 3WIQA 1FBWA 1WU5A 1FO3A 1GAHA 2P0VA 1UT9A 4WVCA 5DGQA 4Q88A 3W7UA 1G87A 1FP3A 1GLMA 3ACTA 5M7IA 2EAEA 3RX5A 3VXDA 4AYQA 3W5MA 2JF4A 1F9DA 1XW2A 1H13A 4WU0A 3QWTA 3S4DA 2RI8A 4DODA 5CD2A
chains in the Genus database with same CATH superfamily
1HX9A 1KRFA 3E7JA 3S4BA 4DOEA 1N4PB 5IL3A 3H2WA 1H36A 1OJMA 2BEDB 3T33A 1KFGA 1J0NA 2AHFA 4KTPA 3SFYB 1WZZA 1DL2A 4D4CA 4GTSB 5MEHA 3QDEA 3P2CA 2F0YB 5EASA 3EZ8A 1N7NA 3E32B 2B39A 1F9GA 5FO7B 1ULVA 1HZFA 3PZ3B 3PZ2B 3RENA 1TN6B 1JCSB 1X9DA 2BRWA 3PMMA 3RJ3A 4LNBB 2CQTA 4BOKA 5FOBB 3ANJA 3TF4A 1GXMA 3ACSA 4FXKB 4DI5A 1GXNA 1HXAA 2DRQA 4CE7A 2H6IB 1FCEA 1IA6A 4ZRQA 1N21A 3W7XA 3SQCA 3M78A 3HXEB 1O1SB 4ZH1A 1IA7A 3KLSA 3E6UA 5DHIA 4MMIA 3M7LA 1N4RB 1O1RB 2B4FA 1F1SA 3Q7FB 3C72B 2NVPA 1FAEA 3N0GA 2F6DA 5FO8B 1TNOB 1RWGA 3SDTA 2ZZRA 3E80A 1N4SB 3G4FA 4CJ0A 4D94A 3M73A 3H7LA 4MMHA 1WU6A 4RNQA 1LXKA 1S63B 3K11A 4L9PB 1O6RA 4AYOA 2PMVA 2EADA 5C05A 3D5RA 3M72A 3KSQB 4E1YA 1LXMA 4ONTA 3RX8A 1NI1B 3WKIA 3M74A 4GTQB 1FO2A 3W5NA 3SAEA 3EU8A 3RSYA 5ILKA 1JCRB 1TNBB 2GH4A 5JMFA 1UT9A 2A73B 1N7RA 1TNUB 5JPNB 4KKIA 3OEDA 3M7EA 2FUTA 3M7CA 4F13A 2JF4A 1FT2B 1XW2A 2E24A 1N22A 2BBCA 1O1TB 3S4DA 3M71A 1GXOA 1N94B 3E73A 3P5RA 5ILDA 3GZKA 1C82A 4ZRPA 3AFJA 1S64B 1AGMA 3QXQA 3WKGA 1RQ5A 3KSLB 1WU4A 3QRYA 1VD5A 2BRPA 5IL8A 1HCUA 1XWTA 2D8LA 4OZVA 2ZBLA 4YDOB 1D8DB 3SDQA 4V1SA 4L0GA 5GY3A 1RWAA 2AFAA 4D4BA 1I8QA 1OJPA 4GTOB 2A8ZA 3QFYA 2JJBA 4AYPA 3W7WA 4LNVA 3QG0A 4L6XA 1H3AA 2E22A 1GA2A 2FUZA 4FUSA 3N0FA 2G02A 3HXBB 3ANIA 1L2AA 2X03A 1NXCA 3M75A 3QSPA 1QSJA 2RI9A 5GZKA 3M02A 1FBOA 3WKFA 2DROA 2PN5A 4GTMB 1RW9A 2ZIRB 3DPYB 3CU7A 3SDVA 1HM2A 3WIWA 3M76A 4GTRB 1LOHA 4D4DA 2G0DA 1TN7B 3G6JB 2IEJB 3S4CA 1FPPB 3A0OA 4WVBA 4Z4JA 1LF6A 2YIKA 2R2LB 5E2JA 1LD8B 3D5SA 1N4QB 2XQWA 2WCOA 1UG9A 1N7QA 2BB5A 1O6HA 3E34B 1HM3A 3Q73B 3RX7A 2Z07A 2Q1FA 4GL3A 1RWCA 1H35A 2V3PA 1GSZA 1O6QA 3PYAA 1X1JA 4YDEB 1G9GA 2J5CA 1MZCB 3WIQA 1QQFA 2P0VA 1GHQA 3DSTB 5ILZA 4MU9A 1X1HA 3DSSB 2FUQA 2V8IA 1N24A 3W5MA 5EATA 1RWFA 1O5MB 1H13A 4WU0A 3QWTA 4KKJA 1KZOB 2RI8A 5IK6A 4ZG8A 1HXGA 1SA5B 3GT5A 3G4DA 1K72A 3OXUA 1H39A 1N1ZA 1KWFA 3D3IA 1FT1B 2DRRA 1D8EB 4FXGB 4GTTB 3WUXA 3QFZA 5DHKA 1IS9A 2V3NA 2WY7A 4ZH5A 1V7WA 2EACA 4OZWA 2V8JA 4XUVA 3A3VA 3HXCB 1AYXA 3WC3A 3GLYA 2WDAA 3H3KA 1HMUA 3M01A 5DGRA 3VW5A 1H3CA 3Q7AB 1V7XA 4TF4A 1LD7B 2AHGA 1N1BA 1O79A 4GTVB 4TXTA 1KZPB 2BRVX 1HV6A 4JJJA 1KREA 1DOGA 4GTPB 2VN4A 5AGDA 2H6HB 1OJNA 3LZ9A 3VSMA 5ILIA 4GAXA 1KS8A 1TNZB 4V1RA 1SQCA 1JS4A 2XWBB 1X81B 1F9OA 3EQAA 4D4AA 3P5PA 1V5DA 1W3YA 1H12A 1L1YA 2JG0A 1V5CA 2WIIB 4M76A 1KKTA 4FNVA 2FV0A 3PYBA 3WKHA 5ILHA 1CB8A 5FO9B 1FMIA 1CLCA 1NL4B 3DSUB 1KSCA 3ANKA 3NNBA 3NFVA 4EL8A 3K7XA 2CQSA 3PZ1B 4C1SA 3PZ4B 1CEMA 3CIHA 3KQ4A 1V7VA 5JPMB 1G9JA 1H14A 5JMDA 3QT3A 1WU5A 2BB6A 5ILJA 1GAHA 1UMPA 4OJZA 3E37B 1GLMA 1FP3A 2GOXA 3ACTA 5M7IA 4LIXA 1N7PA 2I07B 4OK4A 1W6KA 5EAUA 2XWJB 1TN8B 4FJQA 5IK0A 4BOJA 5CD2A 3VSNA 4KTRA 4MBGB 4Z4LA 1TNYB 3SDRA 3HXFB 1H37A 2VN7A 1R76A 2ZISB 5CA3A 4QT9A 2EABA 3SFXB 3DSWB 3QT9A 1H54A 3E33B 3X17A 3WIRA 3M00A 1HXCA 1N20A 2H6GB 2DRSA 4AYRA 1DCEB 2ONGA 5M7YA 1QAZA 1NC5A 5IM1A 2WYNA 3Q75B 4EHMB 5IKAA 3QPFA 1LF9A 5IKHA 2V8KA 3W7SA 3EUVB 1N7OA 2QNOA 2XFGA 2D5JA 1N9AB 3Q78B 1KSDA 5KKBA 3RRSA 3Q79B 1C3DA 4CJ1A 4J5TA 5ILYA 1W6JA 4LNGB 4F10A 2FBAA 1X1IA 3QXFA 3ON6A 1LTXB 1N95B 2RGKA 4WVAA 1EGUA 4OK2A 3EU5B 5CZLA 3SDUA 1SA4B 1J0MA 2WY8A 3DSVB 1QBQB 3W7TA 3DSXB 2FV1A 1N23A 1XWQA 2WINB 1TF4A 1G6IA 1JCQB 5IK9A 3HXDB 2SQCA 2NOJA 1GAIA 3M7BA 4Q2BA 1HMWA 2OKXA 3S4AA 2GZ6A 5GW7A 1RWHA 4YCRA 1FBWA 1FO3A 4Q88A 4WVCA 5DGQA 3W7UA 2H6FB 4NEIA 3AFLA 1G87A 3DRAB 1HN0A 1OJOA 2EAEA 3RX5A 2ONHA 3S9VA 3VXDA 4AYQA 1F9DA 1H3BA 3E30B 3M77A 4DODA
chains in the Genus database with same CATH topology
1KRFA 3S4BA 4DOEA 1N4PB 3H2WA 1H36A 2BEDB 3T33A 1KFGA 2AHFA 4KTPA 3SFYB 1WZZA 1DL2A 4D4CA 4GTSB 5MEHA 3QDEA 3P2CA 2F0YB 3EZ8A 3E32B 2B39A 5FO7B 1ULVA 1HZFA 3PZ3B 3PZ2B 3RENA 1TN6B 1JCSB 1X9DA 3PMMA 3RJ3A 4LNBB 2CQTA 4BOKA 5FOBB 3ANJA 3TF4A 1GXMA 3ACSA 4FXKB 1GXNA 2DRQA 4CE7A 2H6IB 1FCEA 1IA6A 4ZRQA 3W7XA 3SQCA 3M78A 3HXEB 1O1SB 4ZH1A 1IA7A 3KLSA 3E6UA 3M7LA 1N4RB 1O1RB 2B4FA 3Q7FB 2NVPA 3C72B 1FAEA 2F6DA 5FO8B 1TNOB 3SDTA 2ZZRA 1N4SB 4CJ0A 4D94A 3M73A 3H7LA 1WU6A 1S63B 3K11A 4L9PB 1O6RA 4AYOA 2PMVA 2EADA 3D5RA 3M72A 3KSQB 4ONTA 3RX8A 1NI1B 3WKIA 3M74A 4GTQB 1FO2A 3W5NA 3SAEA 3EU8A 3RSYA 1JCRB 1TNBB 2GH4A 1UT9A 2A73B 1TNUB 5JPNB 4KKIA 3OEDA 3M7EA 3M7CA 2JF4A 1FT2B 1XW2A 2BBCA 1O1TB 3S4DA 3M71A 1GXOA 1N94B 3E73A 3P5RA 3GZKA 4ZRPA 3AFJA 1S64B 1AGMA 3QXQA 3WKGA 1RQ5A 3KSLB 1WU4A 3QRYA 1VD5A 1HCUA 1XWTA 2D8LA 2ZBLA 4YDOB 1D8DB 3SDQA 4V1SA 4L0GA 5GY3A 2AFAA 4D4BA 4GTOB 2A8ZA 3QFYA 2JJBA 4AYPA 3W7WA 4LNVA 3QG0A 4L6XA 1H3AA 1GA2A 2FUZA 4FUSA 2G02A 3HXBB 3ANIA 1L2AA 1NXCA 3M75A 3QSPA 1QSJA 2RI9A 5GZKA 1FBOA 3WKFA 2DROA 2PN5A 4GTMB 2ZIRB 3DPYB 3CU7A 3SDVA 3WIWA 3M76A 4GTRB 4D4DA 2G0DA 1TN7B 3G6JB 2IEJB 3S4CA 1FPPB 4WVBA 4Z4JA 1LF6A 2YIKA 2R2LB 5E2JA 1LD8B 3D5SA 1N4QB 2XQWA 1UG9A 2BB5A 1O6HA 3E34B 3Q73B 3RX7A 2Z07A 4GL3A 1H35A 2V3PA 1GSZA 1O6QA 3PYAA 4YDEB 1G9GA 1MZCB 3WIQA 1QQFA 2P0VA 1GHQA 3DSTB 4MU9A 3DSSB 2V8IA 3W5MA 1O5MB 1H13A 4WU0A 3QWTA 4KKJA 1KZOB 2RI8A 4ZG8A 1SA5B 3GT5A 1K72A 3OXUA 1H39A 1KWFA 3D3IA 1FT1B 2DRRA 1D8EB 4FXGB 4GTTB 3WUXA 3QFZA 1IS9A 2V3NA 2WY7A 4ZH5A 1V7WA 2EACA 2V8JA 4XUVA 3A3VA 3HXCB 1AYXA 3WC3A 3GLYA 3H3KA 5DGRA 3VW5A 1H3CA 3Q7AB 1V7XA 4TF4A 1LD7B 4GTVB 1O79A 2AHGA 4TXTA 1KZPB 4JJJA 1KREA 1DOGA 4GTPB 2VN4A 5AGDA 2H6HB 1KS8A 1TNZB 4V1RA 1SQCA 1JS4A 2XWBB 1X81B 1F9OA 3EQAA 4D4AA 3P5PA 1V5DA 1H12A 1L1YA 2JG0A 1V5CA 2WIIB 4M76A 1KKTA 2FV0A 3PYBA 3WKHA 5FO9B 1FMIA 1CLCA 1NL4B 3DSUB 1KSCA 3ANKA 4EL8A 3K7XA 2CQSA 3PZ1B 4C1SA 3PZ4B 1CEMA 3CIHA 3KQ4A 1V7VA 5JPMB 1G9JA 1H14A 3QT3A 1WU5A 2BB6A 1GAHA 1UMPA 3E37B 1GLMA 1FP3A 2GOXA 3ACTA 5M7IA 4LIXA 2I07B 1W6KA 1TN8B 2XWJB 4BOJA 5CD2A 4KTRA 4MBGB 4Z4LA 1TNYB 3SDRA 3HXFB 1H37A 2VN7A 1R76A 2ZISB 5CA3A 4QT9A 2EABA 3SFXB 3DSWB 3QT9A 1H54A 3E33B 3X17A 3WIRA 2H6GB 2DRSA 4AYRA 1DCEB 5M7YA 1NC5A 2WYNA 3Q75B 4EHMB 3QPFA 1LF9A 2V8KA 3W7SA 3EUVB 2QNOA 2XFGA 2D5JA 1N9AB 3Q78B 1KSDA 5KKBA 3RRSA 3Q79B 1C3DA 4CJ1A 4J5TA 1W6JA 4LNGB 2FBAA 3QXFA 3ON6A 1LTXB 1N95B 2RGKA 4WVAA 3EU5B 5CZLA 3SDUA 1SA4B 2WY8A 3DSVB 1QBQB 3W7TA 3DSXB 2FV1A 1XWQA 2WINB 1TF4A 1G6IA 1JCQB 3HXDB 2SQCA 2NOJA 1GAIA 3M7BA 4Q2BA 2OKXA 3S4AA 2GZ6A 5GW7A 4YCRA 1FBWA 1FO3A 4Q88A 4WVCA 5DGQA 3W7UA 2H6FB 1G87A 3DRAB 3S9VA 2EAEA 3RX5A 3VXDA 4AYQA 1F9DA 1H3BA 3E30B 3M77A 4DODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTR A;  4ZG8 A;  3E73 A;  4Z4L A;  1KRF A;  3GT5 A;  3S4B A;  3GZK A;  1K72 A;  3AFJ A;  4DOE A;  1AGM A;  3QXQ A;  3H2W A;  3WKG A;  2VN7 A;  1RQ5 A;  1KWF A;  1WU4 A;  3QRY A;  1VD5 A;  3D3I A;  1HCU A;  3T33 A;  1KFG A;  2DRR A;  1XWT A;  2D8L A;  2AHF A;  3WUX A;  5CA3 A;  4KTP A;  2ZBL A;  3QFZ A;  1IS9 A;  4L0G A;  5GY3 A;  1WZZ A;  1DL2 A;  5MEH A;  3QDE A;  4ZH5 A;  2AFA A;  3P2C A;  1V7W A;  2A8Z A;  2EAC A;  3QFY A;  2JJB A;  3EZ8 A;  2EAB A;  3QT9 A;  1H54 A;  4XUV A;  3X17 A;  3WIR A;  3A3V A;  1ULV A;  4AYP A;  3W7W A;  1AYX A;  3WC3 A;  3REN A;  3GLY A;  3QG0 A;  1X9D A;  2DRS A;  4L6X A;  3H3K A;  4AYR A;  1GA2 A;  2FUZ A;  3PMM A;  4FUS A;  5DGR A;  3VW5 A;  5M7Y A;  1NC5 A;  2CQT A;  2WYN A;  3ANI A;  3ANJ A;  1V7X A;  4TF4 A;  1NXC A;  1L2A A;  3TF4 A;  3QPF A;  1LF9 A;  2AHG A;  3ACS A;  3QSP A;  3W7S A;  4TXT A;  2RI9 A;  4JJJ A;  1KRE A;  1DOG A;  2VN4 A;  2QNO A;  1FBO A;  2DRQ A;  2D5J A;  2XFG A;  3WKF A;  4CE7 A;  2DRO A;  1FCE A;  1IA6 A;  1KSD A;  5KKB A;  3RRS A;  4CJ1 A;  3W7X A;  3WIW A;  4J5T A;  1IA7 A;  1KS8 A;  3E6U A;  2FBA A;  2B4F A;  2NVP A;  1JS4 A;  1FAE A;  3QXF A;  3ON6 A;  2F6D A;  1F9O A;  3EQA A;  2RGK A;  3S4C A;  2ZZR A;  4WVA A;  4WVB A;  5CZL A;  4Z4J A;  4CJ0 A;  1V5D A;  1LF6 A;  1H12 A;  1L1Y A;  3H7L A;  2JG0 A;  1V5C A;  1WU6 A;  3W7T A;  2YIK A;  1KKT A;  5E2J A;  2FV1 A;  1XWQ A;  2FV0 A;  3WKH A;  1UG9 A;  1FMI A;  1CLC A;  3K11 A;  1TF4 A;  1KSC A;  3ANK A;  4AYO A;  4EL8 A;  1G6I A;  2EAD A;  2CQS A;  1CEM A;  3RX7 A;  3RX8 A;  3CIH A;  2Z07 A;  1GAI A;  1V7V A;  3WKI A;  1FO2 A;  3W5N A;  4Q2B A;  1G9J A;  2OKX A;  1H14 A;  3RSY A;  3S4A A;  1G9G A;  2GZ6 A;  5GW7 A;  2GH4 A;  3QT3 A;  3WIQ A;  1FBW A;  1WU5 A;  1FO3 A;  1GAH A;  2P0V A;  1UT9 A;  4WVC A;  5DGQ A;  4Q88 A;  3W7U A;  1G87 A;  1FP3 A;  1GLM A;  3ACT A;  5M7I A;  2EAE A;  3RX5 A;  3VXD A;  4AYQ A;  3W5M A;  2JF4 A;  1F9D A;  1XW2 A;  1H13 A;  4WU0 A;  3QWT A;  3S4D A;  2RI8 A;  4DOD A;  5CD2 A; 
#chains in the Genus database with same CATH topology
 1HX9 A;  1KRF A;  3E7J A;  3S4B A;  4DOE A;  1N4P B;  5IL3 A;  3H2W A;  1H36 A;  1OJM A;  2BED B;  3T33 A;  1KFG A;  1J0N A;  2AHF A;  4KTP A;  3SFY B;  1WZZ A;  1DL2 A;  4D4C A;  4GTS B;  5MEH A;  3QDE A;  3P2C A;  2F0Y B;  5EAS A;  3EZ8 A;  1N7N A;  3E32 B;  2B39 A;  1F9G A;  5FO7 B;  1ULV A;  1HZF A;  3PZ3 B;  3PZ2 B;  3REN A;  1TN6 B;  1JCS B;  1X9D A;  2BRW A;  3PMM A;  3RJ3 A;  4LNB B;  2CQT A;  4BOK A;  5FOB B;  3ANJ A;  3TF4 A;  1GXM A;  3ACS A;  4FXK B;  4DI5 A;  1GXN A;  1HXA A;  2DRQ A;  4CE7 A;  2H6I B;  1FCE A;  1IA6 A;  4ZRQ A;  1N21 A;  3W7X A;  3SQC A;  3M78 A;  3HXE B;  1O1S B;  4ZH1 A;  1IA7 A;  3KLS A;  3E6U A;  5DHI A;  4MMI A;  3M7L A;  1N4R B;  1O1R B;  2B4F A;  1F1S A;  3Q7F B;  3C72 B;  2NVP A;  1FAE A;  3N0G A;  2F6D A;  5FO8 B;  1TNO B;  1RWG A;  3SDT A;  2ZZR A;  3E80 A;  1N4S B;  3G4F A;  4CJ0 A;  4D94 A;  3M73 A;  3H7L A;  4MMH A;  1WU6 A;  4RNQ A;  1LXK A;  1S63 B;  3K11 A;  4L9P B;  1O6R A;  4AYO A;  2PMV A;  2EAD A;  5C05 A;  3D5R A;  3M72 A;  3KSQ B;  4E1Y A;  1LXM A;  4ONT A;  3RX8 A;  1NI1 B;  3WKI A;  3M74 A;  4GTQ B;  1FO2 A;  3W5N A;  3SAE A;  3EU8 A;  3RSY A;  5ILK A;  1JCR B;  1TNB B;  2GH4 A;  5JMF A;  1UT9 A;  2A73 B;  1N7R A;  1TNU B;  5JPN B;  4KKI A;  3OED A;  3M7E A;  2FUT A;  3M7C A;  4F13 A;  2JF4 A;  1FT2 B;  1XW2 A;  2E24 A;  1N22 A;  2BBC A;  1O1T B;  3S4D A;  3M71 A;  1GXO A;  1N94 B;  3E73 A;  3P5R A;  5ILD A;  3GZK A;  1C82 A;  4ZRP A;  3AFJ A;  1S64 B;  1AGM A;  3QXQ A;  3WKG A;  1RQ5 A;  3KSL B;  1WU4 A;  3QRY A;  1VD5 A;  2BRP A;  5IL8 A;  1HCU A;  1XWT A;  2D8L A;  4OZV A;  2ZBL A;  4YDO B;  1D8D B;  3SDQ A;  4V1S A;  4L0G A;  5GY3 A;  1RWA A;  2AFA A;  4D4B A;  1I8Q A;  1OJP A;  4GTO B;  2A8Z A;  3QFY A;  2JJB A;  4AYP A;  3W7W A;  4LNV A;  3QG0 A;  4L6X A;  1H3A A;  2E22 A;  1GA2 A;  2FUZ A;  4FUS A;  3N0F A;  2G02 A;  3HXB B;  3ANI A;  1L2A A;  2X03 A;  1NXC A;  3M75 A;  3QSP A;  1QSJ A;  2RI9 A;  5GZK A;  3M02 A;  1FBO A;  3WKF A;  2DRO A;  2PN5 A;  4GTM B;  1RW9 A;  2ZIR B;  3DPY B;  3CU7 A;  3SDV A;  1HM2 A;  3WIW A;  3M76 A;  4GTR B;  1LOH A;  4D4D A;  2G0D A;  1TN7 B;  3G6J B;  2IEJ B;  3S4C A;  1FPP B;  3A0O A;  4WVB A;  4Z4J A;  1LF6 A;  2YIK A;  2R2L B;  5E2J A;  1LD8 B;  3D5S A;  1N4Q B;  2XQW A;  2WCO A;  1UG9 A;  1N7Q A;  2BB5 A;  1O6H A;  3E34 B;  1HM3 A;  3Q73 B;  3RX7 A;  2Z07 A;  2Q1F A;  4GL3 A;  1RWC A;  1H35 A;  2V3P A;  1GSZ A;  1O6Q A;  3PYA A;  1X1J A;  4YDE B;  1G9G A;  2J5C A;  1MZC B;  3WIQ A;  1QQF A;  2P0V A;  1GHQ A;  3DST B;  5ILZ A;  4MU9 A;  1X1H A;  3DSS B;  2FUQ A;  2V8I A;  1N24 A;  3W5M A;  5EAT A;  1RWF A;  1O5M B;  1H13 A;  4WU0 A;  3QWT A;  4KKJ A;  1KZO B;  2RI8 A;  5IK6 A;  4ZG8 A;  1HXG A;  1SA5 B;  3GT5 A;  3G4D A;  1K72 A;  3OXU A;  1H39 A;  1N1Z A;  1KWF A;  3D3I A;  1FT1 B;  2DRR A;  1D8E B;  4FXG B;  4GTT B;  3WUX A;  3QFZ A;  5DHK A;  1IS9 A;  2V3N A;  2WY7 A;  4ZH5 A;  1V7W A;  2EAC A;  4OZW A;  2V8J A;  4XUV A;  3A3V A;  3HXC B;  1AYX A;  3WC3 A;  3GLY A;  2WDA A;  3H3K A;  1HMU A;  3M01 A;  5DGR A;  3VW5 A;  1H3C A;  3Q7A B;  1V7X A;  4TF4 A;  1LD7 B;  2AHG A;  1N1B A;  1O79 A;  4GTV B;  4TXT A;  1KZP B;  2BRV X;  1HV6 A;  4JJJ A;  1KRE A;  1DOG A;  4GTP B;  2VN4 A;  5AGD A;  2H6H B;  1OJN A;  3LZ9 A;  3VSM A;  5ILI A;  4GAX A;  1KS8 A;  1TNZ B;  4V1R A;  1SQC A;  1JS4 A;  2XWB B;  1X81 B;  1F9O A;  3EQA A;  4D4A A;  3P5P A;  1V5D A;  1W3Y A;  1H12 A;  1L1Y A;  2JG0 A;  1V5C A;  2WII B;  4M76 A;  1KKT A;  4FNV A;  2FV0 A;  3PYB A;  3WKH A;  5ILH A;  1CB8 A;  5FO9 B;  1FMI A;  1CLC A;  1NL4 B;  3DSU B;  1KSC A;  3ANK A;  3NNB A;  3NFV A;  4EL8 A;  3K7X A;  2CQS A;  3PZ1 B;  4C1S A;  3PZ4 B;  1CEM A;  3CIH A;  3KQ4 A;  1V7V A;  5JPM B;  1G9J A;  1H14 A;  5JMD A;  3QT3 A;  1WU5 A;  2BB6 A;  5ILJ A;  1GAH A;  1UMP A;  4OJZ A;  3E37 B;  1GLM A;  1FP3 A;  2GOX A;  3ACT A;  5M7I A;  4LIX A;  1N7P A;  2I07 B;  4OK4 A;  1W6K A;  5EAU A;  2XWJ B;  1TN8 B;  4FJQ A;  5IK0 A;  4BOJ A;  5CD2 A;  3VSN A;  4KTR A;  4MBG B;  4Z4L A;  1TNY B;  3SDR A;  3HXF B;  1H37 A;  2VN7 A;  1R76 A;  2ZIS B;  5CA3 A;  4QT9 A;  2EAB A;  3SFX B;  3DSW B;  3QT9 A;  1H54 A;  3E33 B;  3X17 A;  3WIR A;  3M00 A;  1HXC A;  1N20 A;  2H6G B;  2DRS A;  4AYR A;  1DCE B;  2ONG A;  5M7Y A;  1QAZ A;  1NC5 A;  5IM1 A;  2WYN A;  3Q75 B;  4EHM B;  5IKA A;  3QPF A;  1LF9 A;  5IKH A;  2V8K A;  3W7S A;  3EUV B;  1N7O A;  2QNO A;  2XFG A;  2D5J A;  1N9A B;  3Q78 B;  1KSD A;  5KKB A;  3RRS A;  3Q79 B;  1C3D A;  4CJ1 A;  4J5T A;  5ILY A;  1W6J A;  4LNG B;  4F10 A;  2FBA A;  1X1I A;  3QXF A;  3ON6 A;  1LTX B;  1N95 B;  2RGK A;  4WVA A;  1EGU A;  4OK2 A;  3EU5 B;  5CZL A;  3SDU A;  1SA4 B;  1J0M A;  2WY8 A;  3DSV B;  1QBQ B;  3W7T A;  3DSX B;  2FV1 A;  1N23 A;  1XWQ A;  2WIN B;  1TF4 A;  1G6I A;  1JCQ B;  5IK9 A;  3HXD B;  2SQC A;  2NOJ A;  1GAI A;  3M7B A;  4Q2B A;  1HMW A;  2OKX A;  3S4A A;  2GZ6 A;  5GW7 A;  1RWH A;  4YCR A;  1FBW A;  1FO3 A;  4Q88 A;  4WVC A;  5DGQ A;  3W7U A;  2H6F B;  4NEI A;  3AFL A;  1G87 A;  3DRA B;  1HN0 A;  1OJO A;  2EAE A;  3RX5 A;  2ONH A;  3S9V A;  3VXD A;  4AYQ A;  1F9D A;  1H3B A;  3E30 B;  3M77 A;  4DOD A; 
#chains in the Genus database with same CATH homology
 1KRF A;  3S4B A;  4DOE A;  1N4P B;  3H2W A;  1H36 A;  2BED B;  3T33 A;  1KFG A;  2AHF A;  4KTP A;  3SFY B;  1WZZ A;  1DL2 A;  4D4C A;  4GTS B;  5MEH A;  3QDE A;  3P2C A;  2F0Y B;  3EZ8 A;  3E32 B;  2B39 A;  5FO7 B;  1ULV A;  1HZF A;  3PZ3 B;  3PZ2 B;  3REN A;  1TN6 B;  1JCS B;  1X9D A;  3PMM A;  3RJ3 A;  4LNB B;  2CQT A;  4BOK A;  5FOB B;  3ANJ A;  3TF4 A;  1GXM A;  3ACS A;  4FXK B;  1GXN A;  2DRQ A;  4CE7 A;  2H6I B;  1FCE A;  1IA6 A;  4ZRQ A;  3W7X A;  3SQC A;  3M78 A;  3HXE B;  1O1S B;  4ZH1 A;  1IA7 A;  3KLS A;  3E6U A;  3M7L A;  1N4R B;  1O1R B;  2B4F A;  3Q7F B;  2NVP A;  3C72 B;  1FAE A;  2F6D A;  5FO8 B;  1TNO B;  3SDT A;  2ZZR A;  1N4S B;  4CJ0 A;  4D94 A;  3M73 A;  3H7L A;  1WU6 A;  1S63 B;  3K11 A;  4L9P B;  1O6R A;  4AYO A;  2PMV A;  2EAD A;  3D5R A;  3M72 A;  3KSQ B;  4ONT A;  3RX8 A;  1NI1 B;  3WKI A;  3M74 A;  4GTQ B;  1FO2 A;  3W5N A;  3SAE A;  3EU8 A;  3RSY A;  1JCR B;  1TNB B;  2GH4 A;  1UT9 A;  2A73 B;  1TNU B;  5JPN B;  4KKI A;  3OED A;  3M7E A;  3M7C A;  2JF4 A;  1FT2 B;  1XW2 A;  2BBC A;  1O1T B;  3S4D A;  3M71 A;  1GXO A;  1N94 B;  3E73 A;  3P5R A;  3GZK A;  4ZRP A;  3AFJ A;  1S64 B;  1AGM A;  3QXQ A;  3WKG A;  1RQ5 A;  3KSL B;  1WU4 A;  3QRY A;  1VD5 A;  1HCU A;  1XWT A;  2D8L A;  2ZBL A;  4YDO B;  1D8D B;  3SDQ A;  4V1S A;  4L0G A;  5GY3 A;  2AFA A;  4D4B A;  4GTO B;  2A8Z A;  3QFY A;  2JJB A;  4AYP A;  3W7W A;  4LNV A;  3QG0 A;  4L6X A;  1H3A A;  1GA2 A;  2FUZ A;  4FUS A;  2G02 A;  3HXB B;  3ANI A;  1L2A A;  1NXC A;  3M75 A;  3QSP A;  1QSJ A;  2RI9 A;  5GZK A;  1FBO A;  3WKF A;  2DRO A;  2PN5 A;  4GTM B;  2ZIR B;  3DPY B;  3CU7 A;  3SDV A;  3WIW A;  3M76 A;  4GTR B;  4D4D A;  2G0D A;  1TN7 B;  3G6J B;  2IEJ B;  3S4C A;  1FPP B;  4WVB A;  4Z4J A;  1LF6 A;  2YIK A;  2R2L B;  5E2J A;  1LD8 B;  3D5S A;  1N4Q B;  2XQW A;  1UG9 A;  2BB5 A;  1O6H A;  3E34 B;  3Q73 B;  3RX7 A;  2Z07 A;  4GL3 A;  1H35 A;  2V3P A;  1GSZ A;  1O6Q A;  3PYA A;  4YDE B;  1G9G A;  1MZC B;  3WIQ A;  1QQF A;  2P0V A;  1GHQ A;  3DST B;  4MU9 A;  3DSS B;  2V8I A;  3W5M A;  1O5M B;  1H13 A;  4WU0 A;  3QWT A;  4KKJ A;  1KZO B;  2RI8 A;  4ZG8 A;  1SA5 B;  3GT5 A;  1K72 A;  3OXU A;  1H39 A;  1KWF A;  3D3I A;  1FT1 B;  2DRR A;  1D8E B;  4FXG B;  4GTT B;  3WUX A;  3QFZ A;  1IS9 A;  2V3N A;  2WY7 A;  4ZH5 A;  1V7W A;  2EAC A;  2V8J A;  4XUV A;  3A3V A;  3HXC B;  1AYX A;  3WC3 A;  3GLY A;  3H3K A;  5DGR A;  3VW5 A;  1H3C A;  3Q7A B;  1V7X A;  4TF4 A;  1LD7 B;  4GTV B;  1O79 A;  2AHG A;  4TXT A;  1KZP B;  4JJJ A;  1KRE A;  1DOG A;  4GTP B;  2VN4 A;  5AGD A;  2H6H B;  1KS8 A;  1TNZ B;  4V1R A;  1SQC A;  1JS4 A;  2XWB B;  1X81 B;  1F9O A;  3EQA A;  4D4A A;  3P5P A;  1V5D A;  1H12 A;  1L1Y A;  2JG0 A;  1V5C A;  2WII B;  4M76 A;  1KKT A;  2FV0 A;  3PYB A;  3WKH A;  5FO9 B;  1FMI A;  1CLC A;  1NL4 B;  3DSU B;  1KSC A;  3ANK A;  4EL8 A;  3K7X A;  2CQS A;  3PZ1 B;  4C1S A;  3PZ4 B;  1CEM A;  3CIH A;  3KQ4 A;  1V7V A;  5JPM B;  1G9J A;  1H14 A;  3QT3 A;  1WU5 A;  2BB6 A;  1GAH A;  1UMP A;  3E37 B;  1GLM A;  1FP3 A;  2GOX A;  3ACT A;  5M7I A;  4LIX A;  2I07 B;  1W6K A;  1TN8 B;  2XWJ B;  4BOJ A;  5CD2 A;  4KTR A;  4MBG B;  4Z4L A;  1TNY B;  3SDR A;  3HXF B;  1H37 A;  2VN7 A;  1R76 A;  2ZIS B;  5CA3 A;  4QT9 A;  2EAB A;  3SFX B;  3DSW B;  3QT9 A;  1H54 A;  3E33 B;  3X17 A;  3WIR A;  2H6G B;  2DRS A;  4AYR A;  1DCE B;  5M7Y A;  1NC5 A;  2WYN A;  3Q75 B;  4EHM B;  3QPF A;  1LF9 A;  2V8K A;  3W7S A;  3EUV B;  2QNO A;  2XFG A;  2D5J A;  1N9A B;  3Q78 B;  1KSD A;  5KKB A;  3RRS A;  3Q79 B;  1C3D A;  4CJ1 A;  4J5T A;  1W6J A;  4LNG B;  2FBA A;  3QXF A;  3ON6 A;  1LTX B;  1N95 B;  2RGK A;  4WVA A;  3EU5 B;  5CZL A;  3SDU A;  1SA4 B;  2WY8 A;  3DSV B;  1QBQ B;  3W7T A;  3DSX B;  2FV1 A;  1XWQ A;  2WIN B;  1TF4 A;  1G6I A;  1JCQ B;  3HXD B;  2SQC A;  2NOJ A;  1GAI A;  3M7B A;  4Q2B A;  2OKX A;  3S4A A;  2GZ6 A;  5GW7 A;  4YCR A;  1FBW A;  1FO3 A;  4Q88 A;  4WVC A;  5DGQ A;  3W7U A;  2H6F B;  1G87 A;  3DRA B;  3S9V A;  2EAE A;  3RX5 A;  3VXD A;  4AYQ A;  1F9D A;  1H3B A;  3E30 B;  3M77 A;  4DOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...