2NVPA

X-ray crystal structure of protein cpf_0428 from clostridium perfringens. northeast structural genomics consortium target cpr63.
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
430
structure length
430
Chain Sequence
SLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNDDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINKKLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein
publication title Crystal Structure of the Hypothetical Protein CPF_0428 from Clostridium perfringens, Northeast Structural Genomics Target CpR63.
rcsb
source organism Clostridium perfringens
total genus 143
structure length 430
sequence length 430
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2nvpA01
3GLYA 4JJJA 2JJBA 3RRSA 1JS4A 2WYNA 1AGMA 1XWTA 2AHGA 3QXFA 3W5MA 2Z07A 1KFGA 1F9OA 2VN7A 1GAHA 3ACTA 4AYOA 2QNOA 1L1YA 3CIHA 5E2JA 4Z4JA 1FO3A 1UT9A 1KSDA 2VN4A 3D3IA 4Q2BA 1IS9A 3WKIA 1LF6A 2F6DA 1FBWA 3A3VA 3RX8A 1ULVA 1G9GA 1KSCA 5DGRA 3H3KA 2YIKA 4WVCA 5CZLA 3WUXA 1RQ5A 3QWTA 1G87A 4CJ1A 1KWFA 4ZH5A 2OKXA 3ANKA 1F9DA 1FO2A 2GH4A 3PMMA 1FBOA 3GT5A 4AYRA 2GZ6A 3H2WA 2FUZA 4Z4LA 5GW7A 2RI8A 2B4FA 3WIRA 1NXCA 3T33A 3WKFA 5GY3A 1H12A 1TF4A 4WVAA 3EZ8A 1G9JA 1FAEA 1CLCA 4L0GA 1V7WA 1KKTA 4TF4A 3VW5A 3W7SA 2FV1A 4WVBA 1DL2A 3ACSA 3RX7A 3RX5A 3S4AA 5M7YA 2EACA 3WIQA 2D8LA 4WU0A 1XWQA 1WU4A 1AYXA 2AHFA 3VXDA 1V5CA 4TXTA 2AFAA 2RGKA 2EAEA 3P2CA 1UG9A 3QFYA 4DODA 1IA6A 4AYPA 3K11A 3RSYA 1V5DA 4ZG8A 3WKHA 5CD2A 4KTRA 1LF9A 2DRQA 1WZZA 4DOEA 1WU5A 4J5TA 3X17A 2D5JA 2EABA 2DRSA 2NVPA 1K72A 1X9DA 1G6IA 2RI9A 2FV0A 1KS8A 3H7LA 4CE7A 3W5NA 3E6UA 3QG0A 1DOGA 3EQAA 3QT3A 1H14A 1V7VA 2DRRA 3S4CA 2DROA 1FP3A 3W7XA 1FCEA 3QSPA 3W7WA 1NC5A 4CJ0A 2CQSA 3GZKA 1KREA 1GLMA 3ANIA 5M7IA 4EL8A 3TF4A 2XFGA 3S4DA 5KKBA 3QXQA 4Q88A 5CA3A 2ZBLA 3QPFA 1GAIA 1IA7A 2FBAA 3QRYA 3RENA 1CEMA 4KTPA 4FUSA 4L6XA 3W7TA 2JG0A 1L2AA 2A8ZA 1XW2A 1KRFA 2ZZRA 3QDEA 1H54A 3S4BA 3WC3A 2EADA 5MEHA 3AFJA 1GA2A 5DGQA 3W7UA 1HCUA 3ANJA 3QT9A 3QFZA 1WU6A 1FMIA 4XUVA 3WKGA 4AYQA 2CQTA 2JF4A 1V7XA 3ON6A 3E73A 1H13A 2P0VA 1VD5A 3WIWA
chains in the Genus database with same CATH superfamily
3SDQA 4V1RA 5ILIA 2WYNA 2BB5A 3C72B 3DRAB 4C1SA 3SFXB 3Q78B 4AYOA 3DPYB 4ZH1A 4Z4JA 1UT9A 1O6RA 2XWBB 2F6DA 1N22A 1H36A 3M75A 1N20A 5DGRA 1GHQA 5JMFA 3SQCA 1RQ5A 1N1ZA 2F0YB 1O1TB 5IL3A 1GXNA 3ANKA 1F9DA 2WIIB 4FJQA 2BEDB 2B4FA 4D4CA 3WKFA 1RWAA 5GY3A 3N0GA 4WVAA 5DHKA 1RW9A 1KZPB 1V7WA 1D8DB 4D94A 3HXDB 2ONGA 2FV1A 5ILHA 4LIXA 3RX5A 5IM1A 5M7YA 2ZIRB 4GTTB 1N4RB 3G4FA 3M01A 2RGKA 3M74A 2V8IA 3PZ2B 1H37A 3A0OA 2J5CA 3SAEA 4KTRA 1KZOB 1DCEB 1LOHA 1HX9A 1LXKA 5GZKA 2D5JA 3X17A 1G6IA 1KS8A 4CE7A 3OEDA 3E6UA 1H14A 3EU8A 1O1SB 1FP3A 1N7PA 2WY8A 3E32B 3QSPA 2FUTA 5JMDA 4CJ0A 2CQSA 5FOBB 3GZKA 3KSQB 1GLMA 3D5SA 3K7XA 3SDTA 3N0FA 1HXCA 4Q88A 2A73B 5CA3A 2ZBLA 1C3DA 1GAIA 3RENA 3M77A 1CEMA 4KTPA 4GTPB 1OJMA 2JG0A 5JPMB 4YDEB 1X1IA 2ZZRA 3VSNA 1R76A 1GA2A 1HCUA 1HM3A 2WINB 3CU7A 3ON6A 1I8QA 1VD5A 1NI1B 3WIWA 2ONHA 2WDAA 4JJJA 2JJBA 3RRSA 1JS4A 3M72A 3M7BA 1LD7B 2Z07A 2P0VA 1N94B 1F9OA 1GAHA 3ACTA 2QNOA 1L1YA 5E2JA 1QQFA 5ILYA 1GXMA 4ZRPA 1J0MA 1TN7B 1IS9A 4Q2BA 5IK9A 3A3VA 5IK6A 4L9PB 4MU9A 3EUVB 3NFVA 1F9GA 3PZ4B 3WUXA 1QAZA 4FXGB 1KWFA 3P5RA 1X81B 3GT5A 3M7LA 2GZ6A 2BRWA 4ONTA 3EU5B 1TF4A 1G9JA 1F1SA 3HXCB 3Q79B 1SA5B 3VW5A 4F13A 1N24A 3W7SA 4D4AA 1DL2A 3ACSA 4FNVA 1O1RB 2H6IB 1RWHA 4NEIA 2EACA 3AFLA 1H39A 1QBQB 1XWQA 1AYXA 2G02A 3SDUA 2B39A 1RWGA 2EAEA 1UG9A 3QFYA 1IA6A 3K11A 1TN6B 1W3YA 3RSYA 3WKHA 1H3BA 2XWJB 1O5MB 2I07B 2V8KA 2XQWA 4OK4A 1X9DA 2RI9A 3KSLB 3W5NA 4D4BA 3QG0A 3DSVB 2G0DA 1V7VA 3QT3A 3S4CA 1HZFA 3PZ3B 2V8JA 4GTMB 1FT2B 1N9AB 1KREA 2BRPA 4V1SA 3ANIA 1OJNA 5M7IA 4EL8A 2XFGA 3S4DA 3QXQA 4M76A 4OZVA 3QRYA 4OK2A 1N7NA 2PN5A 5AGDA 1D8EB 1XW2A 1KRFA 1H54A 3WC3A 1SQCA 3W7UA 5MEHA 3QFZA 5ILKA 1MZCB 1FMIA 2PMVA 3WKGA 4AYQA 2CQTA 2JF4A 3SDVA 3E73A 1J0NA 3GLYA 4GTRB 2ZISB 1HV6A 1AGMA 2AHGA 3M02A 3Q73B 5IK0A 5EASA 3DSXB 3PYAA 3NNBA 1CB8A 1FO3A 4KKJA 1OJOA 3WKIA 1LF6A 1FBWA 4MMHA 1G9GA 3DSWB 3HXEB 2WCOA 3H3KA 4WVCA 3QWTA 2WY7A 4CJ1A 1TNZB 1S63B 4E1YA 4GL3A 3M7CA 4MMIA 4BOJA 3HXFB 4AYRA 3H2WA 2FUZA 4YCRA 5C05A 4Z4LA 5GW7A 2RI8A 1NXCA 1N7OA 1H12A 4LNBB 2FUQA 3Q7FB 3KLSA 3EZ8A 1FAEA 1CLCA 1X1JA 3P5PA 4TF4A 2X03A 4KKIA 1HMUA 1N7QA 2R2LB 3RX7A 2V3PA 3S4AA 1TN8B 1N21A 3WIQA 3KQ4A 4WU0A 5FO8B 2AHFA 1V5CA 1N4PB 1H35A 4TXTA 1TNOB 3Q75B 4QT9A 3P2CA 1NL4B 3SDRA 2H6HB 5CD2A 1LF9A 1JCQB 2DRQA 4MBGB 1WZZA 3PZ1B 4DOEA 5IKAA 5FO7B 2EABA 1K72A 1N7RA 1N95B 3H7LA 1HXAA 1N4QB 1DOGA 3D5RA 2DRRA 1N1BA 2DROA 3PYBA 1FCEA 3W7WA 2Q1FA 1EGUA 1SA4B 3SFYB 5DHIA 5FO9B 3TF4A 5KKBA 5EATA 4F10A 1HM2A 3QPFA 4OJZA 1IA7A 2FBAA 3S9VA 4DI5A 3RJ3A 5ILDA 3QDEA 3M71A 2EADA 2IEJB 3AFJA 1TNYB 4GTVB 3ANJA 4XUVA 2E22A 5ILZA 1H13A 1H3CA 1HMWA 1O6QA 1TNBB 3M78A 1XWTA 3M7EA 3QXFA 3W5MA 1KFGA 2VN7A 3CIHA 5IL8A 2VN4A 1KSDA 3D3IA 1JCSB 1GXOA 3RX8A 1ULVA 1KSCA 4RNQA 2YIKA 5CZLA 3VSMA 1G87A 1LD8B 2H6FB 4ZH5A 2OKXA 1S64B 1FO2A 2GH4A 3PMMA 1FBOA 2V3NA 1HN0A 4LNVA 4FXKB 3WIRA 1X1HA 3T33A 3E34B 1N4SB 1OJPA 4L0GA 1KKTA 4YDOB 3DSTB 4OZWA 3DSUB 4WVBA 2SQCA 5EAUA 2D8LA 4GTSB 1WU4A 3Q7AB 4LNGB 3VXDA 1TNUB 2AFAA 1H3AA 3E7JA 4DODA 4AYPA 3E37B 1V5DA 4GTQB 2H6GB 4ZG8A 1FPPB 4D4DA 1HXGA 3G4DA 1WU5A 4J5TA 5ILJA 1O6HA 2DRSA 2NVPA 2FV0A 1JCRB 3EQAA 2BRVX 3W7XA 2BB6A 3LZ9A 3M76A 4ZRQA 1NC5A 3E30B 3M00A 4GTOB 2BBCA 1UMPA 4BOKA 1W6JA 3E33B 3E80A 1LTXB 1LXMA 3OXUA 2GOXA 2NOJA 3HXBB 1RWFA 5IKHA 1C82A 1GSZA 1FT1B 2E24A 3G6JB 4FUSA 4GAXA 4L6XA 3W7TA 1L2AA 2A8ZA 3M73A 3S4BA 1N23A 1O79A 1RWCA 5DGQA 5JPNB 4EHMB 3QT9A 1WU6A 1QSJA 1V7XA 1W6KA 3DSSB
chains in the Genus database with same CATH topology
3SDQA 4V1RA 2WYNA 2BB5A 3C72B 3DRAB 4C1SA 3SFXB 3Q78B 4AYOA 3DPYB 4ZH1A 4Z4JA 1UT9A 1O6RA 2XWBB 2F6DA 1H36A 3M75A 5DGRA 1GHQA 3SQCA 1RQ5A 2F0YB 1O1TB 1GXNA 3ANKA 1F9DA 2WIIB 2BEDB 2B4FA 4D4CA 3WKFA 5GY3A 4WVAA 1KZPB 1V7WA 1D8DB 4D94A 3HXDB 2FV1A 4LIXA 3RX5A 5M7YA 2ZIRB 4GTTB 1N4RB 2RGKA 3M74A 2V8IA 3PZ2B 1H37A 3SAEA 4KTRA 1KZOB 1DCEB 5GZKA 3X17A 2D5JA 1G6IA 1KS8A 4CE7A 3OEDA 3E6UA 1H14A 3EU8A 1O1SB 1FP3A 2WY8A 3E32B 3QSPA 4CJ0A 2CQSA 5FOBB 3GZKA 3KSQB 1GLMA 3D5SA 3K7XA 3SDTA 4Q88A 2A73B 5CA3A 2ZBLA 1C3DA 1GAIA 3RENA 3M77A 1CEMA 4KTPA 4GTPB 2JG0A 5JPMB 4YDEB 2ZZRA 1R76A 1GA2A 1HCUA 2WINB 3CU7A 3ON6A 1VD5A 1NI1B 3WIWA 4JJJA 2JJBA 3RRSA 1JS4A 3M72A 3M7BA 1LD7B 2Z07A 2P0VA 1N94B 1F9OA 1GAHA 3ACTA 2QNOA 1L1YA 5E2JA 1QQFA 1GXMA 4ZRPA 1TN7B 1IS9A 4Q2BA 3A3VA 4L9PB 4MU9A 3EUVB 3PZ4B 3WUXA 4FXGB 1KWFA 3P5RA 1X81B 3GT5A 3M7LA 2GZ6A 4ONTA 3EU5B 1TF4A 1G9JA 3HXCB 3Q79B 1SA5B 3VW5A 3W7SA 4D4AA 1DL2A 3ACSA 1O1RB 2H6IB 2EACA 1H39A 1QBQB 1XWQA 1AYXA 2G02A 3SDUA 2B39A 2EAEA 1UG9A 3QFYA 1IA6A 3K11A 1TN6B 3RSYA 3WKHA 1H3BA 2XWJB 1O5MB 2I07B 2V8KA 2XQWA 1X9DA 2RI9A 3KSLB 3W5NA 4D4BA 3QG0A 3DSVB 2G0DA 1V7VA 3QT3A 3S4CA 1HZFA 3PZ3B 2V8JA 4GTMB 1FT2B 1N9AB 1KREA 4V1SA 3ANIA 5M7IA 4EL8A 2XFGA 3S4DA 3QXQA 4M76A 3QRYA 2PN5A 5AGDA 1D8EB 1XW2A 1KRFA 1H54A 3WC3A 1SQCA 3W7UA 5MEHA 3QFZA 1MZCB 1FMIA 2PMVA 3WKGA 4AYQA 2CQTA 2JF4A 3SDVA 3E73A 3GLYA 4GTRB 2ZISB 1AGMA 2AHGA 3Q73B 3DSXB 3PYAA 1FO3A 4KKJA 3WKIA 1LF6A 1FBWA 1G9GA 3DSWB 3HXEB 3H3KA 4WVCA 3QWTA 2WY7A 4CJ1A 1TNZB 1S63B 4GL3A 3M7CA 4BOJA 3HXFB 4AYRA 3H2WA 2FUZA 4YCRA 4Z4LA 5GW7A 2RI8A 1NXCA 1H12A 4LNBB 3Q7FB 3KLSA 3EZ8A 1FAEA 1CLCA 3P5PA 4TF4A 4KKIA 2R2LB 3RX7A 2V3PA 3S4AA 1TN8B 3WIQA 3KQ4A 4WU0A 5FO8B 2AHFA 1V5CA 1N4PB 1H35A 4TXTA 1TNOB 3Q75B 4QT9A 3P2CA 1NL4B 3SDRA 2H6HB 5CD2A 1LF9A 1JCQB 2DRQA 4MBGB 1WZZA 3PZ1B 4DOEA 5FO7B 2EABA 1K72A 1N95B 3H7LA 1N4QB 1DOGA 3D5RA 2DRRA 2DROA 3PYBA 1FCEA 3W7WA 1SA4B 3SFYB 5FO9B 3TF4A 5KKBA 3QPFA 1IA7A 2FBAA 3S9VA 3RJ3A 3QDEA 3M71A 2EADA 2IEJB 3AFJA 1TNYB 4GTVB 3ANJA 4XUVA 1H13A 1H3CA 1O6QA 1TNBB 3M78A 1XWTA 3M7EA 3QXFA 3W5MA 1KFGA 2VN7A 3CIHA 2VN4A 1KSDA 3D3IA 1JCSB 1GXOA 3RX8A 1ULVA 1KSCA 2YIKA 5CZLA 1G87A 1LD8B 2H6FB 4ZH5A 2OKXA 1S64B 1FO2A 2GH4A 3PMMA 1FBOA 2V3NA 4LNVA 4FXKB 3WIRA 3T33A 3E34B 1N4SB 4L0GA 1KKTA 4YDOB 3DSTB 3DSUB 4WVBA 2SQCA 2D8LA 4GTSB 1WU4A 3Q7AB 4LNGB 3VXDA 1TNUB 2AFAA 1H3AA 4DODA 4AYPA 3E37B 1V5DA 4GTQB 2H6GB 4ZG8A 1FPPB 4D4DA 1WU5A 4J5TA 1O6HA 2DRSA 2NVPA 2FV0A 1JCRB 3EQAA 3W7XA 2BB6A 3M76A 4ZRQA 1NC5A 3E30B 4GTOB 2BBCA 1UMPA 4BOKA 1W6JA 3E33B 1LTXB 3OXUA 2GOXA 2NOJA 3HXBB 1GSZA 1FT1B 3G6JB 4FUSA 4L6XA 3W7TA 1L2AA 2A8ZA 3M73A 3S4BA 1O79A 5DGQA 5JPNB 4EHMB 3QT9A 1WU6A 1QSJA 1V7XA 1W6KA 3DSSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLY A;  4JJJ A;  2JJB A;  3RRS A;  1JS4 A;  2WYN A;  1AGM A;  1XWT A;  2AHG A;  3QXF A;  3W5M A;  2Z07 A;  1KFG A;  1F9O A;  2VN7 A;  1GAH A;  3ACT A;  4AYO A;  2QNO A;  1L1Y A;  3CIH A;  5E2J A;  4Z4J A;  1FO3 A;  1UT9 A;  1KSD A;  2VN4 A;  3D3I A;  4Q2B A;  1IS9 A;  3WKI A;  1LF6 A;  2F6D A;  1FBW A;  3A3V A;  3RX8 A;  1ULV A;  1G9G A;  1KSC A;  5DGR A;  3H3K A;  2YIK A;  4WVC A;  5CZL A;  3WUX A;  1RQ5 A;  3QWT A;  1G87 A;  4CJ1 A;  1KWF A;  4ZH5 A;  2OKX A;  3ANK A;  1F9D A;  1FO2 A;  2GH4 A;  3PMM A;  1FBO A;  3GT5 A;  4AYR A;  2GZ6 A;  3H2W A;  2FUZ A;  4Z4L A;  5GW7 A;  2RI8 A;  2B4F A;  3WIR A;  1NXC A;  3T33 A;  3WKF A;  5GY3 A;  1H12 A;  1TF4 A;  4WVA A;  3EZ8 A;  1G9J A;  1FAE A;  1CLC A;  4L0G A;  1V7W A;  1KKT A;  4TF4 A;  3VW5 A;  3W7S A;  2FV1 A;  4WVB A;  1DL2 A;  3ACS A;  3RX7 A;  3RX5 A;  3S4A A;  5M7Y A;  2EAC A;  3WIQ A;  2D8L A;  4WU0 A;  1XWQ A;  1WU4 A;  1AYX A;  2AHF A;  3VXD A;  1V5C A;  4TXT A;  2AFA A;  2RGK A;  2EAE A;  3P2C A;  1UG9 A;  3QFY A;  4DOD A;  1IA6 A;  4AYP A;  3K11 A;  3RSY A;  1V5D A;  4ZG8 A;  3WKH A;  5CD2 A;  4KTR A;  1LF9 A;  2DRQ A;  1WZZ A;  4DOE A;  1WU5 A;  4J5T A;  3X17 A;  2D5J A;  2EAB A;  2DRS A;  2NVP A;  1K72 A;  1X9D A;  1G6I A;  2RI9 A;  2FV0 A;  1KS8 A;  3H7L A;  4CE7 A;  3W5N A;  3E6U A;  3QG0 A;  1DOG A;  3EQA A;  3QT3 A;  1H14 A;  1V7V A;  2DRR A;  3S4C A;  2DRO A;  1FP3 A;  3W7X A;  1FCE A;  3QSP A;  3W7W A;  1NC5 A;  4CJ0 A;  2CQS A;  3GZK A;  1KRE A;  1GLM A;  3ANI A;  5M7I A;  4EL8 A;  3TF4 A;  2XFG A;  3S4D A;  5KKB A;  3QXQ A;  4Q88 A;  5CA3 A;  2ZBL A;  3QPF A;  1GAI A;  1IA7 A;  2FBA A;  3QRY A;  3REN A;  1CEM A;  4KTP A;  4FUS A;  4L6X A;  3W7T A;  2JG0 A;  1L2A A;  2A8Z A;  1XW2 A;  1KRF A;  2ZZR A;  3QDE A;  1H54 A;  3S4B A;  3WC3 A;  2EAD A;  5MEH A;  3AFJ A;  1GA2 A;  5DGQ A;  3W7U A;  1HCU A;  3ANJ A;  3QT9 A;  3QFZ A;  1WU6 A;  1FMI A;  4XUV A;  3WKG A;  4AYQ A;  2CQT A;  2JF4 A;  1V7X A;  3ON6 A;  3E73 A;  1H13 A;  2P0V A;  1VD5 A;  3WIW A; 
#chains in the Genus database with same CATH topology
 3SDQ A;  4V1R A;  5ILI A;  2WYN A;  2BB5 A;  3C72 B;  3DRA B;  4C1S A;  3SFX B;  3Q78 B;  4AYO A;  3DPY B;  4ZH1 A;  4Z4J A;  1UT9 A;  1O6R A;  2XWB B;  2F6D A;  1N22 A;  1H36 A;  3M75 A;  1N20 A;  5DGR A;  1GHQ A;  5JMF A;  3SQC A;  1RQ5 A;  1N1Z A;  2F0Y B;  1O1T B;  5IL3 A;  1GXN A;  3ANK A;  1F9D A;  2WII B;  4FJQ A;  2BED B;  2B4F A;  4D4C A;  3WKF A;  1RWA A;  5GY3 A;  3N0G A;  4WVA A;  5DHK A;  1RW9 A;  1KZP B;  1V7W A;  1D8D B;  4D94 A;  3HXD B;  2ONG A;  2FV1 A;  5ILH A;  4LIX A;  3RX5 A;  5IM1 A;  5M7Y A;  2ZIR B;  4GTT B;  1N4R B;  3G4F A;  3M01 A;  2RGK A;  3M74 A;  2V8I A;  3PZ2 B;  1H37 A;  3A0O A;  2J5C A;  3SAE A;  4KTR A;  1KZO B;  1DCE B;  1LOH A;  1HX9 A;  1LXK A;  5GZK A;  2D5J A;  3X17 A;  1G6I A;  1KS8 A;  4CE7 A;  3OED A;  3E6U A;  1H14 A;  3EU8 A;  1O1S B;  1FP3 A;  1N7P A;  2WY8 A;  3E32 B;  3QSP A;  2FUT A;  5JMD A;  4CJ0 A;  2CQS A;  5FOB B;  3GZK A;  3KSQ B;  1GLM A;  3D5S A;  3K7X A;  3SDT A;  3N0F A;  1HXC A;  4Q88 A;  2A73 B;  5CA3 A;  2ZBL A;  1C3D A;  1GAI A;  3REN A;  3M77 A;  1CEM A;  4KTP A;  4GTP B;  1OJM A;  2JG0 A;  5JPM B;  4YDE B;  1X1I A;  2ZZR A;  3VSN A;  1R76 A;  1GA2 A;  1HCU A;  1HM3 A;  2WIN B;  3CU7 A;  3ON6 A;  1I8Q A;  1VD5 A;  1NI1 B;  3WIW A;  2ONH A;  2WDA A;  4JJJ A;  2JJB A;  3RRS A;  1JS4 A;  3M72 A;  3M7B A;  1LD7 B;  2Z07 A;  2P0V A;  1N94 B;  1F9O A;  1GAH A;  3ACT A;  2QNO A;  1L1Y A;  5E2J A;  1QQF A;  5ILY A;  1GXM A;  4ZRP A;  1J0M A;  1TN7 B;  1IS9 A;  4Q2B A;  5IK9 A;  3A3V A;  5IK6 A;  4L9P B;  4MU9 A;  3EUV B;  3NFV A;  1F9G A;  3PZ4 B;  3WUX A;  1QAZ A;  4FXG B;  1KWF A;  3P5R A;  1X81 B;  3GT5 A;  3M7L A;  2GZ6 A;  2BRW A;  4ONT A;  3EU5 B;  1TF4 A;  1G9J A;  1F1S A;  3HXC B;  3Q79 B;  1SA5 B;  3VW5 A;  4F13 A;  1N24 A;  3W7S A;  4D4A A;  1DL2 A;  3ACS A;  4FNV A;  1O1R B;  2H6I B;  1RWH A;  4NEI A;  2EAC A;  3AFL A;  1H39 A;  1QBQ B;  1XWQ A;  1AYX A;  2G02 A;  3SDU A;  2B39 A;  1RWG A;  2EAE A;  1UG9 A;  3QFY A;  1IA6 A;  3K11 A;  1TN6 B;  1W3Y A;  3RSY A;  3WKH A;  1H3B A;  2XWJ B;  1O5M B;  2I07 B;  2V8K A;  2XQW A;  4OK4 A;  1X9D A;  2RI9 A;  3KSL B;  3W5N A;  4D4B A;  3QG0 A;  3DSV B;  2G0D A;  1V7V A;  3QT3 A;  3S4C A;  1HZF A;  3PZ3 B;  2V8J A;  4GTM B;  1FT2 B;  1N9A B;  1KRE A;  2BRP A;  4V1S A;  3ANI A;  1OJN A;  5M7I A;  4EL8 A;  2XFG A;  3S4D A;  3QXQ A;  4M76 A;  4OZV A;  3QRY A;  4OK2 A;  1N7N A;  2PN5 A;  5AGD A;  1D8E B;  1XW2 A;  1KRF A;  1H54 A;  3WC3 A;  1SQC A;  3W7U A;  5MEH A;  3QFZ A;  5ILK A;  1MZC B;  1FMI A;  2PMV A;  3WKG A;  4AYQ A;  2CQT A;  2JF4 A;  3SDV A;  3E73 A;  1J0N A;  3GLY A;  4GTR B;  2ZIS B;  1HV6 A;  1AGM A;  2AHG A;  3M02 A;  3Q73 B;  5IK0 A;  5EAS A;  3DSX B;  3PYA A;  3NNB A;  1CB8 A;  1FO3 A;  4KKJ A;  1OJO A;  3WKI A;  1LF6 A;  1FBW A;  4MMH A;  1G9G A;  3DSW B;  3HXE B;  2WCO A;  3H3K A;  4WVC A;  3QWT A;  2WY7 A;  4CJ1 A;  1TNZ B;  1S63 B;  4E1Y A;  4GL3 A;  3M7C A;  4MMI A;  4BOJ A;  3HXF B;  4AYR A;  3H2W A;  2FUZ A;  4YCR A;  5C05 A;  4Z4L A;  5GW7 A;  2RI8 A;  1NXC A;  1N7O A;  1H12 A;  4LNB B;  2FUQ A;  3Q7F B;  3KLS A;  3EZ8 A;  1FAE A;  1CLC A;  1X1J A;  3P5P A;  4TF4 A;  2X03 A;  4KKI A;  1HMU A;  1N7Q A;  2R2L B;  3RX7 A;  2V3P A;  3S4A A;  1TN8 B;  1N21 A;  3WIQ A;  3KQ4 A;  4WU0 A;  5FO8 B;  2AHF A;  1V5C A;  1N4P B;  1H35 A;  4TXT A;  1TNO B;  3Q75 B;  4QT9 A;  3P2C A;  1NL4 B;  3SDR A;  2H6H B;  5CD2 A;  1LF9 A;  1JCQ B;  2DRQ A;  4MBG B;  1WZZ A;  3PZ1 B;  4DOE A;  5IKA A;  5FO7 B;  2EAB A;  1K72 A;  1N7R A;  1N95 B;  3H7L A;  1HXA A;  1N4Q B;  1DOG A;  3D5R A;  2DRR A;  1N1B A;  2DRO A;  3PYB A;  1FCE A;  3W7W A;  2Q1F A;  1EGU A;  1SA4 B;  3SFY B;  5DHI A;  5FO9 B;  3TF4 A;  5KKB A;  5EAT A;  4F10 A;  1HM2 A;  3QPF A;  4OJZ A;  1IA7 A;  2FBA A;  3S9V A;  4DI5 A;  3RJ3 A;  5ILD A;  3QDE A;  3M71 A;  2EAD A;  2IEJ B;  3AFJ A;  1TNY B;  4GTV B;  3ANJ A;  4XUV A;  2E22 A;  5ILZ A;  1H13 A;  1H3C A;  1HMW A;  1O6Q A;  1TNB B;  3M78 A;  1XWT A;  3M7E A;  3QXF A;  3W5M A;  1KFG A;  2VN7 A;  3CIH A;  5IL8 A;  2VN4 A;  1KSD A;  3D3I A;  1JCS B;  1GXO A;  3RX8 A;  1ULV A;  1KSC A;  4RNQ A;  2YIK A;  5CZL A;  3VSM A;  1G87 A;  1LD8 B;  2H6F B;  4ZH5 A;  2OKX A;  1S64 B;  1FO2 A;  2GH4 A;  3PMM A;  1FBO A;  2V3N A;  1HN0 A;  4LNV A;  4FXK B;  3WIR A;  1X1H A;  3T33 A;  3E34 B;  1N4S B;  1OJP A;  4L0G A;  1KKT A;  4YDO B;  3DST B;  4OZW A;  3DSU B;  4WVB A;  2SQC A;  5EAU A;  2D8L A;  4GTS B;  1WU4 A;  3Q7A B;  4LNG B;  3VXD A;  1TNU B;  2AFA A;  1H3A A;  3E7J A;  4DOD A;  4AYP A;  3E37 B;  1V5D A;  4GTQ B;  2H6G B;  4ZG8 A;  1FPP B;  4D4D A;  1HXG A;  3G4D A;  1WU5 A;  4J5T A;  5ILJ A;  1O6H A;  2DRS A;  2NVP A;  2FV0 A;  1JCR B;  3EQA A;  2BRV X;  3W7X A;  2BB6 A;  3LZ9 A;  3M76 A;  4ZRQ A;  1NC5 A;  3E30 B;  3M00 A;  4GTO B;  2BBC A;  1UMP A;  4BOK A;  1W6J A;  3E33 B;  3E80 A;  1LTX B;  1LXM A;  3OXU A;  2GOX A;  2NOJ A;  3HXB B;  1RWF A;  5IKH A;  1C82 A;  1GSZ A;  1FT1 B;  2E24 A;  3G6J B;  4FUS A;  4GAX A;  4L6X A;  3W7T A;  1L2A A;  2A8Z A;  3M73 A;  3S4B A;  1N23 A;  1O79 A;  1RWC A;  5DGQ A;  5JPN B;  4EHM B;  3QT9 A;  1WU6 A;  1QSJ A;  1V7X A;  1W6K A;  3DSS B; 
#chains in the Genus database with same CATH homology
 3SDQ A;  4V1R A;  2WYN A;  2BB5 A;  3C72 B;  3DRA B;  4C1S A;  3SFX B;  3Q78 B;  4AYO A;  3DPY B;  4ZH1 A;  4Z4J A;  1UT9 A;  1O6R A;  2XWB B;  2F6D A;  1H36 A;  3M75 A;  5DGR A;  1GHQ A;  3SQC A;  1RQ5 A;  2F0Y B;  1O1T B;  1GXN A;  3ANK A;  1F9D A;  2WII B;  2BED B;  2B4F A;  4D4C A;  3WKF A;  5GY3 A;  4WVA A;  1KZP B;  1V7W A;  1D8D B;  4D94 A;  3HXD B;  2FV1 A;  4LIX A;  3RX5 A;  5M7Y A;  2ZIR B;  4GTT B;  1N4R B;  2RGK A;  3M74 A;  2V8I A;  3PZ2 B;  1H37 A;  3SAE A;  4KTR A;  1KZO B;  1DCE B;  5GZK A;  3X17 A;  2D5J A;  1G6I A;  1KS8 A;  4CE7 A;  3OED A;  3E6U A;  1H14 A;  3EU8 A;  1O1S B;  1FP3 A;  2WY8 A;  3E32 B;  3QSP A;  4CJ0 A;  2CQS A;  5FOB B;  3GZK A;  3KSQ B;  1GLM A;  3D5S A;  3K7X A;  3SDT A;  4Q88 A;  2A73 B;  5CA3 A;  2ZBL A;  1C3D A;  1GAI A;  3REN A;  3M77 A;  1CEM A;  4KTP A;  4GTP B;  2JG0 A;  5JPM B;  4YDE B;  2ZZR A;  1R76 A;  1GA2 A;  1HCU A;  2WIN B;  3CU7 A;  3ON6 A;  1VD5 A;  1NI1 B;  3WIW A;  4JJJ A;  2JJB A;  3RRS A;  1JS4 A;  3M72 A;  3M7B A;  1LD7 B;  2Z07 A;  2P0V A;  1N94 B;  1F9O A;  1GAH A;  3ACT A;  2QNO A;  1L1Y A;  5E2J A;  1QQF A;  1GXM A;  4ZRP A;  1TN7 B;  1IS9 A;  4Q2B A;  3A3V A;  4L9P B;  4MU9 A;  3EUV B;  3PZ4 B;  3WUX A;  4FXG B;  1KWF A;  3P5R A;  1X81 B;  3GT5 A;  3M7L A;  2GZ6 A;  4ONT A;  3EU5 B;  1TF4 A;  1G9J A;  3HXC B;  3Q79 B;  1SA5 B;  3VW5 A;  3W7S A;  4D4A A;  1DL2 A;  3ACS A;  1O1R B;  2H6I B;  2EAC A;  1H39 A;  1QBQ B;  1XWQ A;  1AYX A;  2G02 A;  3SDU A;  2B39 A;  2EAE A;  1UG9 A;  3QFY A;  1IA6 A;  3K11 A;  1TN6 B;  3RSY A;  3WKH A;  1H3B A;  2XWJ B;  1O5M B;  2I07 B;  2V8K A;  2XQW A;  1X9D A;  2RI9 A;  3KSL B;  3W5N A;  4D4B A;  3QG0 A;  3DSV B;  2G0D A;  1V7V A;  3QT3 A;  3S4C A;  1HZF A;  3PZ3 B;  2V8J A;  4GTM B;  1FT2 B;  1N9A B;  1KRE A;  4V1S A;  3ANI A;  5M7I A;  4EL8 A;  2XFG A;  3S4D A;  3QXQ A;  4M76 A;  3QRY A;  2PN5 A;  5AGD A;  1D8E B;  1XW2 A;  1KRF A;  1H54 A;  3WC3 A;  1SQC A;  3W7U A;  5MEH A;  3QFZ A;  1MZC B;  1FMI A;  2PMV A;  3WKG A;  4AYQ A;  2CQT A;  2JF4 A;  3SDV A;  3E73 A;  3GLY A;  4GTR B;  2ZIS B;  1AGM A;  2AHG A;  3Q73 B;  3DSX B;  3PYA A;  1FO3 A;  4KKJ A;  3WKI A;  1LF6 A;  1FBW A;  1G9G A;  3DSW B;  3HXE B;  3H3K A;  4WVC A;  3QWT A;  2WY7 A;  4CJ1 A;  1TNZ B;  1S63 B;  4GL3 A;  3M7C A;  4BOJ A;  3HXF B;  4AYR A;  3H2W A;  2FUZ A;  4YCR A;  4Z4L A;  5GW7 A;  2RI8 A;  1NXC A;  1H12 A;  4LNB B;  3Q7F B;  3KLS A;  3EZ8 A;  1FAE A;  1CLC A;  3P5P A;  4TF4 A;  4KKI A;  2R2L B;  3RX7 A;  2V3P A;  3S4A A;  1TN8 B;  3WIQ A;  3KQ4 A;  4WU0 A;  5FO8 B;  2AHF A;  1V5C A;  1N4P B;  1H35 A;  4TXT A;  1TNO B;  3Q75 B;  4QT9 A;  3P2C A;  1NL4 B;  3SDR A;  2H6H B;  5CD2 A;  1LF9 A;  1JCQ B;  2DRQ A;  4MBG B;  1WZZ A;  3PZ1 B;  4DOE A;  5FO7 B;  2EAB A;  1K72 A;  1N95 B;  3H7L A;  1N4Q B;  1DOG A;  3D5R A;  2DRR A;  2DRO A;  3PYB A;  1FCE A;  3W7W A;  1SA4 B;  3SFY B;  5FO9 B;  3TF4 A;  5KKB A;  3QPF A;  1IA7 A;  2FBA A;  3S9V A;  3RJ3 A;  3QDE A;  3M71 A;  2EAD A;  2IEJ B;  3AFJ A;  1TNY B;  4GTV B;  3ANJ A;  4XUV A;  1H13 A;  1H3C A;  1O6Q A;  1TNB B;  3M78 A;  1XWT A;  3M7E A;  3QXF A;  3W5M A;  1KFG A;  2VN7 A;  3CIH A;  2VN4 A;  1KSD A;  3D3I A;  1JCS B;  1GXO A;  3RX8 A;  1ULV A;  1KSC A;  2YIK A;  5CZL A;  1G87 A;  1LD8 B;  2H6F B;  4ZH5 A;  2OKX A;  1S64 B;  1FO2 A;  2GH4 A;  3PMM A;  1FBO A;  2V3N A;  4LNV A;  4FXK B;  3WIR A;  3T33 A;  3E34 B;  1N4S B;  4L0G A;  1KKT A;  4YDO B;  3DST B;  3DSU B;  4WVB A;  2SQC A;  2D8L A;  4GTS B;  1WU4 A;  3Q7A B;  4LNG B;  3VXD A;  1TNU B;  2AFA A;  1H3A A;  4DOD A;  4AYP A;  3E37 B;  1V5D A;  4GTQ B;  2H6G B;  4ZG8 A;  1FPP B;  4D4D A;  1WU5 A;  4J5T A;  1O6H A;  2DRS A;  2NVP A;  2FV0 A;  1JCR B;  3EQA A;  3W7X A;  2BB6 A;  3M76 A;  4ZRQ A;  1NC5 A;  3E30 B;  4GTO B;  2BBC A;  1UMP A;  4BOK A;  1W6J A;  3E33 B;  1LTX B;  3OXU A;  2GOX A;  2NOJ A;  3HXB B;  1GSZ A;  1FT1 B;  3G6J B;  4FUS A;  4L6X A;  3W7T A;  1L2A A;  2A8Z A;  3M73 A;  3S4B A;  1O79 A;  5DGQ A;  5JPN B;  4EHM B;  3QT9 A;  1WU6 A;  1QSJ A;  1V7X A;  1W6K A;  3DSS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...