4OZVA

Crystal structure of the periplasmic alginate lyase algl
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
335
structure length
333
Chain Sequence
b'ADLVPPPGYYAAVGERKAGSCPAVPPPYTGSLVFTSKYEGSDSARATLNVKAEKTFRSQIKDITDMERGATKLVTQYMRSGRDGDLACALNWMSAWARAGALQSDDFNHTGKSMRKWALGSLSGAYMRLKFSSSRPLAAHAEQSREIEDWFARLGTQVVRDWSGLPLKKINNHSYWAAWSVMSTAVVTNRRDLFDWAVSEFKVAANQVDEQGFLPNELKRRQRALAYHNYALPPLAMIAAFAQVNGVDLRQENHGALQRLAERVMKGVDDEETFEEKTGEDQDMTDLKVDNKYAWLEPYCALYRCEPKMLEAKKDREPFNSFRLGGEVTRVFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate lyase
publication title Crystal Structure of the periplasmic alginate lyase AlgL
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 140
structure length 333
sequence length 335
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4ozvA00
1EGUA 3E7JA 1HV6A 1RWFA 1RWGA 4F13A 1X1HA 4OZVA 1J0NA 5JMDA 2WCOA 1OJPA 1F9GA 1N7QA 1W3YA 3VSNA 1F1SA 1N7PA 2BRWA 4OK2A 4F10A 1LXKA 4OZWA 4MMHA 2BRPA 3E80A 1QAZA 4MMIA 1LOHA 1RWHA 2FUTA 3A0OA 4E1YA 1X1JA 1N7NA 1C82A 1N7RA 1OJNA 2E22A 3NFVA 1HM3A 2BRVX 1LXMA 2X03A 1I8QA 1HN0A 3AFLA 2FUQA 4FNVA 3VSMA 1OJOA 5JMFA 1N7OA 1OJMA 1RWCA 1HM2A 3NNBA 2E24A 4OK4A 4OJZA 1RW9A 1RWAA 2WDAA 1CB8A 1X1IA 1HMWA 1HMUA 4NEIA 1J0MA 2Q1FA
chains in the Genus database with same CATH superfamily
3SFXB 1TNUB 1RWFA 4OZVA 1J0NA 1HXAA 1C3DA 2EACA 4F10A 3D3IA 4FXGB 3DSXB 3Q75B 4ZG8A 3Q78B 3EZ8A 3M7BA 3HXDB 4GTQB 1GSZA 1G9JA 1H36A 1KWFA 4AYQA 3A3VA 1RWCA 4Q2BA 1O5MB 3P2CA 5EASA 1WU5A 1V7WA 3M01A 2ZISB 4NEIA 2DRRA 4CE7A 3W7SA 1DCEB 3KSQB 3M02A 3E80A 1N1BA 4FUSA 5GW7A 5JPMB 2F0YB 2I07B 5IM1A 1KZPB 1LF9A 1MZCB 3VW5A 5EATA 4ZRQA 3QG0A 1V7VA 3S4BA 3VXDA 3W7XA 1XWTA 4J5TA 1O79A 3M76A 2V8IA 3QXFA 1HMUA 2JG0A 1UT9A 3Q7AB 3EQAA 4LNBB 3QT9A 1RWGA 1H39A 5FO7B 1W3YA 2ZBLA 3QRYA 3K11A 1O6RA 4MMHA 1LTXB 2RI8A 3ACTA 1HZFA 2QNOA 1K72A 4RNQA 1FBWA 1KSDA 3SQCA 3SDRA 1NXCA 2ONGA 1XWQA 4CJ1A 2ONHA 3ON6A 1FO3A 1FT1B 1H13A 4OJZA 4GTSB 1S64B 2A73B 3WKHA 4BOKA 3LZ9A 2V8JA 3M74A 3WKFA 1IS9A 2R2LB 1SA5B 2ZIRB 3DPYB 3W7UA 4GTOB 2E22A 2BRVX 1XW2A 1TN6B 2A8ZA 5JPNB 1OJOA 4V1SA 3N0GA 2H6HB 2GH4A 5ILYA 3E30B 3M7LA 3QDEA 5FOBB 4FJQA 3EU8A 1GXMA 1O1TB 2WYNA 3KQ4A 4F13A 1OJPA 3G6JB 2G02A 4DOEA 3N0FA 4C1SA 3EU5B 1LOHA 3KSLB 2FUTA 3OEDA 3RENA 1F9OA 1V5DA 5EAUA 1V5CA 1R76A 1HCUA 4KKIA 2JF4A 1OJMA 3NNBA 1JCSB 5ILKA 3M71A 1AGMA 3PMMA 3KLSA 1H3BA 5GZKA 1J0MA 3HXEB 2V3NA 4XUVA 4GL3A 1D8EB 2AHGA 4KKJA 1N22A 1H35A 2WIIB 1GHQA 2AHFA 4DODA 1FBOA 1RQ5A 3NFVA 4GTVB 3WKIA 4KTPA 1JS4A 3RX7A 3VSMA 1V7XA 4TF4A 3E33B 3QXQA 4GTTB 3W5MA 2CQSA 2BBCA 1KFGA 1O1RB 5CA3A 1HV6A 1S63B 1N20A 2FUZA 5ILZA 5E2JA 3PYAA 4OK2A 2DRSA 2NOJA 1QAZA 4GAXA 1FT2B 1WU6A 1WZZA 1QBQB 4WVBA 5DGQA 1N7RA 5DGRA 1LXMA 5FO9B 1HN0A 1N4QB 5KKBA 1FAEA 3M77A 3SAEA 5ILHA 2VN4A 4DI5A 4EHMB 2H6GB 3OXUA 4ZRPA 4LNVA 3E7JA 2D5JA 1EGUA 3QSPA 3E34B 3WUXA 1KREA 5JMDA 3HXBB 3ANJA 3HXCB 4YDOB 5IL8A 4GTRB 1IA6A 3M75A 2XWJB 2P0VA 3K7XA 1O6HA 3PZ1B 2J5CA 1WU4A 3M78A 1N95B 4YCRA 1GXOA 3ACSA 3P5PA 3ANIA 1G9GA 2D8LA 5CD2A 2Q1FA 1TN8B 2DRQA 1N23A 5ILIA 1FMIA 4QT9A 4Z4LA 1GAIA 3G4DA 2EABA 2PN5A 1N4RB 2GOXA 1H3CA 2PMVA 3QT3A 1N9AB 1X1JA 1OJNA 2FUQA 3SDTA 1G87A 5IL3A 3W7TA 3W5NA 1ULVA 5IK6A 1RWAA 2WDAA 1CB8A 3WC3A 1DL2A 4D4BA 2XQWA 3QPFA 3C72B 3GZKA 1X1HA 1F9GA 1N7QA 1JCQB 1N7PA 1VD5A 4L6XA 3RX8A 2BRPA 1O6QA 2GZ6A 3GLYA 2RGKA 3DSSB 3A0OA 1D8DB 1HX9A 1RWHA 1TN7B 3AFJA 2X03A 1TNYB 1FP3A 2V3PA 1KSCA 2CQTA 3DSUB 4ONTA 1CLCA 4YDEB 5M7IA 1N4SB 5IKAA 1LD8B 3Q79B 3SDQA 1GA2A 4D94A 4FXKB 3PYBA 5IK9A 1X81B 3M7CA 4GTPB 2DROA 5M7YA 1TNBB 3M72A 2BEDB 4OZWA 2ZZRA 2XFGA 4KTRA 3SDUA 2BB5A 1C82A 1H12A 1W6JA 1HM3A 3P5RA 5MEHA 2FV1A 3E32B 2RI9A 4WVAA 2VN7A 4V1RA 5IK0A 3E73A 1JCRB 2E24A 3DSTB 1X1IA 4EL8A 3WIQA 3DSWB 5C05A 3WIWA 4WU0A 3CIHA 4AYOA 1W6KA 1FO2A 4M76A 2V8KA 3S4CA 1N7NA 3RX5A 4D4AA 2H6IB 4L0GA 3S9VA 4CJ0A 2WINB 3AFLA 3TF4A 2EADA 4LIXA 2BB6A 2FBAA 4Q88A 3X17A 1NC5A 2AFAA 3D5SA 3SDVA 1QSJA 5AGDA 2WY8A 1IA7A 4AYRA 5ILDA 2WY7A 4TXTA 1KZOB 2Z07A 2EAEA 3RRSA 3DRAB 3PZ4B 1X9DA 3DSVB 3E6UA 4LNGB 3D5RA 2B4FA 3PZ3B 1NL4B 1QQFA 4ZH5A 1SQCA 3EUVB 1N7OA 2XWBB 4OK4A 1KKTA 1RW9A 3QFZA 1G6IA 3Q7FB 5IKHA 2YIKA 3E37B 4Z4JA 5CZLA 1KS8A 3ANKA 3RJ3A 4JJJA 2WCOA 2SQCA 1N94B 3S4DA 4D4DA 1TNOB 5DHIA 1L2AA 4MMIA 3T33A 3WKGA 2IEJB 1FCEA 3QFYA 1I8QA 3M73A 4MU9A 1N4PB 1KRFA 1H14A 5JMFA 4WVCA 3RSYA 1HM2A 1AYXA 2JJBA 1TNZB 1H54A 4ZH1A 1HMWA 1UMPA 3WIRA 1UG9A 4BOJA 3CU7A 1GAHA 1SA4B 3QWTA 2F6DA 2BRWA 2H6FB 1LXKA 3M00A 3H2WA 5DHKA 1LF6A 1F9DA 1TF4A 3H3KA 4E1YA 5FO8B 4GTMB 1HXCA 1FPPB 4FNVA 2FV0A 2B39A 4AYPA 4L9PB 1N24A 3G4FA 3H7LA 1LD7B 4MBGB 1N21A 1H3AA 3VSNA 1F1SA 3W7WA 1O1SB 3M7EA 3S4AA 3SFYB 5ILJA 1GXNA 2OKXA 1H37A 3PZ2B 3HXFB 4D4CA 3GT5A 1CEMA 1NI1B 1L1YA 2G0DA 1N1ZA 3Q73B 5GY3A 1DOGA 2NVPA 1GLMA 1HXGA
chains in the Genus database with same CATH topology
1EGUA 3E7JA 1HV6A 1RWFA 1RWGA 4F13A 1X1HA 4OZVA 1J0NA 5JMDA 2WCOA 1OJPA 1F9GA 1N7QA 1W3YA 3VSNA 1F1SA 1N7PA 2BRWA 4OK2A 4F10A 1LXKA 4OZWA 4MMHA 2BRPA 3E80A 1QAZA 4MMIA 1LOHA 1RWHA 2FUTA 3A0OA 4E1YA 1X1JA 1N7NA 1C82A 1N7RA 1OJNA 2E22A 3NFVA 1HM3A 2BRVX 1LXMA 2X03A 1I8QA 1HN0A 3AFLA 2FUQA 4FNVA 3VSMA 1OJOA 5JMFA 1N7OA 1OJMA 1RWCA 1HM2A 3NNBA 2E24A 4OK4A 4OJZA 1RW9A 1RWAA 2WDAA 1CB8A 1X1IA 1HMWA 1HMUA 4NEIA 1J0MA 2Q1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EGU A;  3E7J A;  1HV6 A;  1RWF A;  1RWG A;  4F13 A;  1X1H A;  4OZV A;  1J0N A;  5JMD A;  2WCO A;  1OJP A;  1F9G A;  1N7Q A;  1W3Y A;  3VSN A;  1F1S A;  1N7P A;  2BRW A;  4OK2 A;  4F10 A;  1LXK A;  4OZW A;  4MMH A;  2BRP A;  3E80 A;  1QAZ A;  4MMI A;  1LOH A;  1RWH A;  2FUT A;  3A0O A;  4E1Y A;  1X1J A;  1N7N A;  1C82 A;  1N7R A;  1OJN A;  2E22 A;  3NFV A;  1HM3 A;  2BRV X;  1LXM A;  2X03 A;  1I8Q A;  1HN0 A;  3AFL A;  2FUQ A;  4FNV A;  3VSM A;  1OJO A;  5JMF A;  1N7O A;  1OJM A;  1RWC A;  1HM2 A;  3NNB A;  2E24 A;  4OK4 A;  4OJZ A;  1RW9 A;  1RWA A;  2WDA A;  1CB8 A;  1X1I A;  1HMW A;  1HMU A;  4NEI A;  1J0M A;  2Q1F A; 
#chains in the Genus database with same CATH topology
 3SFX B;  1TNU B;  1RWF A;  4OZV A;  1J0N A;  1HXA A;  1C3D A;  2EAC A;  4F10 A;  3D3I A;  4FXG B;  3DSX B;  3Q75 B;  4ZG8 A;  3Q78 B;  3EZ8 A;  3M7B A;  3HXD B;  4GTQ B;  1GSZ A;  1G9J A;  1H36 A;  1KWF A;  4AYQ A;  3A3V A;  1RWC A;  4Q2B A;  1O5M B;  3P2C A;  5EAS A;  1WU5 A;  1V7W A;  3M01 A;  2ZIS B;  4NEI A;  2DRR A;  4CE7 A;  3W7S A;  1DCE B;  3KSQ B;  3M02 A;  3E80 A;  1N1B A;  4FUS A;  5GW7 A;  5JPM B;  2F0Y B;  2I07 B;  5IM1 A;  1KZP B;  1LF9 A;  1MZC B;  3VW5 A;  5EAT A;  4ZRQ A;  3QG0 A;  1V7V A;  3S4B A;  3VXD A;  3W7X A;  1XWT A;  4J5T A;  1O79 A;  3M76 A;  2V8I A;  3QXF A;  1HMU A;  2JG0 A;  1UT9 A;  3Q7A B;  3EQA A;  4LNB B;  3QT9 A;  1RWG A;  1H39 A;  5FO7 B;  1W3Y A;  2ZBL A;  3QRY A;  3K11 A;  1O6R A;  4MMH A;  1LTX B;  2RI8 A;  3ACT A;  1HZF A;  2QNO A;  1K72 A;  4RNQ A;  1FBW A;  1KSD A;  3SQC A;  3SDR A;  1NXC A;  2ONG A;  1XWQ A;  4CJ1 A;  2ONH A;  3ON6 A;  1FO3 A;  1FT1 B;  1H13 A;  4OJZ A;  4GTS B;  1S64 B;  2A73 B;  3WKH A;  4BOK A;  3LZ9 A;  2V8J A;  3M74 A;  3WKF A;  1IS9 A;  2R2L B;  1SA5 B;  2ZIR B;  3DPY B;  3W7U A;  4GTO B;  2E22 A;  2BRV X;  1XW2 A;  1TN6 B;  2A8Z A;  5JPN B;  1OJO A;  4V1S A;  3N0G A;  2H6H B;  2GH4 A;  5ILY A;  3E30 B;  3M7L A;  3QDE A;  5FOB B;  4FJQ A;  3EU8 A;  1GXM A;  1O1T B;  2WYN A;  3KQ4 A;  4F13 A;  1OJP A;  3G6J B;  2G02 A;  4DOE A;  3N0F A;  4C1S A;  3EU5 B;  1LOH A;  3KSL B;  2FUT A;  3OED A;  3REN A;  1F9O A;  1V5D A;  5EAU A;  1V5C A;  1R76 A;  1HCU A;  4KKI A;  2JF4 A;  1OJM A;  3NNB A;  1JCS B;  5ILK A;  3M71 A;  1AGM A;  3PMM A;  3KLS A;  1H3B A;  5GZK A;  1J0M A;  3HXE B;  2V3N A;  4XUV A;  4GL3 A;  1D8E B;  2AHG A;  4KKJ A;  1N22 A;  1H35 A;  2WII B;  1GHQ A;  2AHF A;  4DOD A;  1FBO A;  1RQ5 A;  3NFV A;  4GTV B;  3WKI A;  4KTP A;  1JS4 A;  3RX7 A;  3VSM A;  1V7X A;  4TF4 A;  3E33 B;  3QXQ A;  4GTT B;  3W5M A;  2CQS A;  2BBC A;  1KFG A;  1O1R B;  5CA3 A;  1HV6 A;  1S63 B;  1N20 A;  2FUZ A;  5ILZ A;  5E2J A;  3PYA A;  4OK2 A;  2DRS A;  2NOJ A;  1QAZ A;  4GAX A;  1FT2 B;  1WU6 A;  1WZZ A;  1QBQ B;  4WVB A;  5DGQ A;  1N7R A;  5DGR A;  1LXM A;  5FO9 B;  1HN0 A;  1N4Q B;  5KKB A;  1FAE A;  3M77 A;  3SAE A;  5ILH A;  2VN4 A;  4DI5 A;  4EHM B;  2H6G B;  3OXU A;  4ZRP A;  4LNV A;  3E7J A;  2D5J A;  1EGU A;  3QSP A;  3E34 B;  3WUX A;  1KRE A;  5JMD A;  3HXB B;  3ANJ A;  3HXC B;  4YDO B;  5IL8 A;  4GTR B;  1IA6 A;  3M75 A;  2XWJ B;  2P0V A;  3K7X A;  1O6H A;  3PZ1 B;  2J5C A;  1WU4 A;  3M78 A;  1N95 B;  4YCR A;  1GXO A;  3ACS A;  3P5P A;  3ANI A;  1G9G A;  2D8L A;  5CD2 A;  2Q1F A;  1TN8 B;  2DRQ A;  1N23 A;  5ILI A;  1FMI A;  4QT9 A;  4Z4L A;  1GAI A;  3G4D A;  2EAB A;  2PN5 A;  1N4R B;  2GOX A;  1H3C A;  2PMV A;  3QT3 A;  1N9A B;  1X1J A;  1OJN A;  2FUQ A;  3SDT A;  1G87 A;  5IL3 A;  3W7T A;  3W5N A;  1ULV A;  5IK6 A;  1RWA A;  2WDA A;  1CB8 A;  3WC3 A;  1DL2 A;  4D4B A;  2XQW A;  3QPF A;  3C72 B;  3GZK A;  1X1H A;  1F9G A;  1N7Q A;  1JCQ B;  1N7P A;  1VD5 A;  4L6X A;  3RX8 A;  2BRP A;  1O6Q A;  2GZ6 A;  3GLY A;  2RGK A;  3DSS B;  3A0O A;  1D8D B;  1HX9 A;  1RWH A;  1TN7 B;  3AFJ A;  2X03 A;  1TNY B;  1FP3 A;  2V3P A;  1KSC A;  2CQT A;  3DSU B;  4ONT A;  1CLC A;  4YDE B;  5M7I A;  1N4S B;  5IKA A;  1LD8 B;  3Q79 B;  3SDQ A;  1GA2 A;  4D94 A;  4FXK B;  3PYB A;  5IK9 A;  1X81 B;  3M7C A;  4GTP B;  2DRO A;  5M7Y A;  1TNB B;  3M72 A;  2BED B;  4OZW A;  2ZZR A;  2XFG A;  4KTR A;  3SDU A;  2BB5 A;  1C82 A;  1H12 A;  1W6J A;  1HM3 A;  3P5R A;  5MEH A;  2FV1 A;  3E32 B;  2RI9 A;  4WVA A;  2VN7 A;  4V1R A;  5IK0 A;  3E73 A;  1JCR B;  2E24 A;  3DST B;  1X1I A;  4EL8 A;  3WIQ A;  3DSW B;  5C05 A;  3WIW A;  4WU0 A;  3CIH A;  4AYO A;  1W6K A;  1FO2 A;  4M76 A;  2V8K A;  3S4C A;  1N7N A;  3RX5 A;  4D4A A;  2H6I B;  4L0G A;  3S9V A;  4CJ0 A;  2WIN B;  3AFL A;  3TF4 A;  2EAD A;  4LIX A;  2BB6 A;  2FBA A;  4Q88 A;  3X17 A;  1NC5 A;  2AFA A;  3D5S A;  3SDV A;  1QSJ A;  5AGD A;  2WY8 A;  1IA7 A;  4AYR A;  5ILD A;  2WY7 A;  4TXT A;  1KZO B;  2Z07 A;  2EAE A;  3RRS A;  3DRA B;  3PZ4 B;  1X9D A;  3DSV B;  3E6U A;  4LNG B;  3D5R A;  2B4F A;  3PZ3 B;  1NL4 B;  1QQF A;  4ZH5 A;  1SQC A;  3EUV B;  1N7O A;  2XWB B;  4OK4 A;  1KKT A;  1RW9 A;  3QFZ A;  1G6I A;  3Q7F B;  5IKH A;  2YIK A;  3E37 B;  4Z4J A;  5CZL A;  1KS8 A;  3ANK A;  3RJ3 A;  4JJJ A;  2WCO A;  2SQC A;  1N94 B;  3S4D A;  4D4D A;  1TNO B;  5DHI A;  1L2A A;  4MMI A;  3T33 A;  3WKG A;  2IEJ B;  1FCE A;  3QFY A;  1I8Q A;  3M73 A;  4MU9 A;  1N4P B;  1KRF A;  1H14 A;  5JMF A;  4WVC A;  3RSY A;  1HM2 A;  1AYX A;  2JJB A;  1TNZ B;  1H54 A;  4ZH1 A;  1HMW A;  1UMP A;  3WIR A;  1UG9 A;  4BOJ A;  3CU7 A;  1GAH A;  1SA4 B;  3QWT A;  2F6D A;  2BRW A;  2H6F B;  1LXK A;  3M00 A;  3H2W A;  5DHK A;  1LF6 A;  1F9D A;  1TF4 A;  3H3K A;  4E1Y A;  5FO8 B;  4GTM B;  1HXC A;  1FPP B;  4FNV A;  2FV0 A;  2B39 A;  4AYP A;  4L9P B;  1N24 A;  3G4F A;  3H7L A;  1LD7 B;  4MBG B;  1N21 A;  1H3A A;  3VSN A;  1F1S A;  3W7W A;  1O1S B;  3M7E A;  3S4A A;  3SFY B;  5ILJ A;  1GXN A;  2OKX A;  1H37 A;  3PZ2 B;  3HXF B;  4D4C A;  3GT5 A;  1CEM A;  1NI1 B;  1L1Y A;  2G0D A;  1N1Z A;  3Q73 B;  5GY3 A;  1DOG A;  2NVP A;  1GLM A;  1HXG A; 
#chains in the Genus database with same CATH homology
 1EGU A;  3E7J A;  1HV6 A;  1RWF A;  1RWG A;  4F13 A;  1X1H A;  4OZV A;  1J0N A;  5JMD A;  2WCO A;  1OJP A;  1F9G A;  1N7Q A;  1W3Y A;  3VSN A;  1F1S A;  1N7P A;  2BRW A;  4OK2 A;  4F10 A;  1LXK A;  4OZW A;  4MMH A;  2BRP A;  3E80 A;  1QAZ A;  4MMI A;  1LOH A;  1RWH A;  2FUT A;  3A0O A;  4E1Y A;  1X1J A;  1N7N A;  1C82 A;  1N7R A;  1OJN A;  2E22 A;  3NFV A;  1HM3 A;  2BRV X;  1LXM A;  2X03 A;  1I8Q A;  1HN0 A;  3AFL A;  2FUQ A;  4FNV A;  3VSM A;  1OJO A;  5JMF A;  1N7O A;  1OJM A;  1RWC A;  1HM2 A;  3NNB A;  2E24 A;  4OK4 A;  4OJZ A;  1RW9 A;  1RWA A;  2WDA A;  1CB8 A;  1X1I A;  1HMW A;  1HMU A;  4NEI A;  1J0M A;  2Q1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...