4OZVA

Crystal structure of the periplasmic alginate lyase algl
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
335
structure length
333
Chain Sequence
ADLVPPPGYYAAVGERKAGSCPAVPPPYTGSLVFTSKYEGSDSARATLNVKAEKTFRSQIKDITDMERGATKLVTQYMRSGRDGDLACALNWMSAWARAGALQSDDFNHTGKSMRKWALGSLSGAYMRLKFSSSRPLAAHAEQSREIEDWFARLGTQVVRDWSGLPLKKINNHSYWAAWSVMSTAVVTNRRDLFDWAVSEFKVAANQVDEQGFLPNELKRRQRALAYHNYALPPLAMIAAFAQVNGVDLRQENHGALQRLAERVMKGVDDEETFEEKTGEDQDMTDLKVDNKYAWLEPYCALYRCEPKMLEAKKDREPFNSFRLGGEVTRVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alginate lyase
publication title Crystal Structure of the periplasmic alginate lyase AlgL
rcsb
source organism Pseudomonas aeruginosa
total genus 140
structure length 333
sequence length 335
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4ozvA00
1OJNA 2E24A 1I8QA 1CB8A 4F13A 1HM3A 2BRPA 4NEIA 2FUTA 1N7QA 1HMUA 1RWGA 2X03A 1HM2A 1RW9A 1OJOA 1N7RA 1RWHA 4F10A 2BRVX 4OJZA 5JMFA 4OK4A 5JMDA 1QAZA 1F9GA 4MMIA 1OJMA 4OZWA 3NFVA 1N7OA 3VSMA 1X1JA 1LXMA 3A0OA 1RWFA 2Q1FA 4OK2A 1C82A 1LXKA 2WDAA 2FUQA 1RWAA 4OZVA 1LOHA 1RWCA 1EGUA 1W3YA 4MMHA 1N7NA 1HN0A 3NNBA 1X1HA 2WCOA 1OJPA 1F1SA 1HMWA 1N7PA 3E7JA 1X1IA 1J0NA 3E80A 4FNVA 3AFLA 1HV6A 2E22A 2BRWA 3VSNA 1J0MA 4E1YA
chains in the Genus database with same CATH superfamily
2XQWA 1TNYB 1CB8A 3M7CA 1WU4A 3QXQA 1HCUA 4AYQA 1RWGA 3M73A 3W7SA 1HM2A 4F10A 3HXCB 1F9GA 1OJMA 1QBQB 2FV0A 5CA3A 3QXFA 2H6IB 3A0OA 4GTTB 4KKJA 3ON6A 2V8KA 3W5NA 5IK9A 5MEHA 2GZ6A 1HXGA 2FBAA 3AFLA 3WIQA 3M72A 5ILZA 2D8LA 3RSYA 1KSCA 3PYAA 1UG9A 1NXCA 3DPYB 3PMMA 1HXCA 2EAEA 1LTXB 4FXGB 1O1SB 3SFXB 3G4FA 5ILKA 3P2CA 1KWFA 3TF4A 1S63B 4ZH5A 1H39A 1N95B 3M74A 3QT3A 1OJPA 1DL2A 2XWBB 2Z07A 3SFYB 2BRWA 3Q78B 4Q88A 1G6IA 3SDTA 3HXEB 1N7RA 3M7EA 5JMFA 5JMDA 1CLCA 1K72A 3WIRA 1D8DB 4BOJA 5M7IA 1GLMA 4WVAA 1RQ5A 3M01A 2NVPA 1FBWA 3PZ3B 3VSNA 1O79A 3M7LA 3D3IA 3WKFA 1H12A 2ZISB 4TXTA 1GAHA 5FO8B 3QPFA 4OJZA 1FPPB 3HXDB 4QT9A 4LIXA 3ACSA 4Z4JA 2BB6A 1H3BA 3Q7AB 4OK2A 3PZ4B 3QG0A 1IA7A 1KRFA 1N20A 4GTOB 1KKTA 4EL8A 1H14A 1J0NA 3WKIA 4AYOA 4CJ0A 1TN7B 3KSQB 3N0FA 1RW9A 1FP3A 1FO2A 2B39A 5FO7B 3M71A 3S4DA 1MZCB 2H6GB 2AHFA 2NOJA 1N7OA 1LD7B 1X1JA 3P5PA 2Q1FA 4ONTA 1RWCA 3DSUB 4AYPA 2VN4A 1XW2A 1GXOA 1H3CA 2IEJB 3RJ3A 3E80A 1SA5B 1CEMA 1X81B 2V8JA 3E37B 4FJQA 4CJ1A 4E1YA 4YCRA 1N4PB 5E2JA 4F13A 1V7VA 3EU8A 3RENA 1JCRB 1F9DA 5CD2A 3DSWB 1RWHA 1TF4A 1LF6A 2G0DA 5KKBA 4V1SA 3M7BA 5IKAA 1H13A 4KKIA 4BOKA 3M75A 3M02A 2V3NA 1O6QA 2DRSA 2WDAA 2RI8A 1L2AA 2J5CA 1GXNA 3N0GA 1N22A 2D5JA 3PZ1B 2AFAA 1H35A 1H37A 3WC3A 1LD8B 2CQTA 1V5DA 1AYXA 2A73B 4GTRB 3WKGA 2VN7A 4ZG8A 5GW7A 5ILJA 3H3KA 5ILYA 1WZZA 1XWQA 3QWTA 1TN6B 5IK6A 3SQCA 1G87A 1V5CA 1QAZA 2R2LB 4YDEB 5JPNB 3Q73B 4GTPB 1LXMA 1RWFA 3D5RA 1C82A 1IS9A 2F0YB 3NNBA 5GY3A 2A8ZA 1KSDA 3M78A 2ONHA 5JPMB 1N4QB 1HMWA 3E7JA 2OKXA 2AHGA 1HV6A 2H6FB 1TN8B 1FMIA 5CZLA 1O1RB 2EADA 1WU5A 4Q2BA 1OJOA 3ANKA 3EQAA 3W7WA 1KFGA 5IL8A 3S4AA 1N4RB 1JS4A 5ILHA 1NC5A 4MMHA 4V1RA 2ZIRB 2WCOA 4YDOB 2P0VA 3GZKA 1N7PA 4DOEA 2QNOA 1TNZB 1FCEA 2BB5A 4FXKB 4KTPA 1D8EB 2FV1A 3E6UA 3K11A 4GTQB 1KREA 3GLYA 4WVBA 2B4FA 2CQSA 3G6JB 1HZFA 1IA6A 3SDRA 3H7LA 3W7TA 2YIKA 3OXUA 3CIHA 3Q79B 1G9JA 2DRQA 4MBGB 1TNOB 1AGMA 2BEDB 4FNVA 1N9AB 2E22A 4XUVA 1H36A 3RX5A 1FT1B 1R76A 4LNGB 2E24A 4ZRQA 1GA2A 2WIIB 3QFYA 1O1TB 4KTRA 2WY8A 1N1BA 2WINB 3WIWA 1KZOB 3QRYA 4GAXA 1DCEB 5DHKA 1HXAA 3QFZA 3QT9A 1W3YA 1X1HA 4FUSA 1QQFA 2XWJB 1GHQA 2WY7A 4DI5A 3DSSB 1I8QA 3ACTA 3ANIA 2RI9A 3CU7A 3C72B 1N7QA 1HMUA 2XFGA 1GAIA 1KZPB 5IKHA 2BRVX 3HXBB 1WU6A 1FO3A 3P5RA 2GH4A 4DODA 3RRSA 3KSLB 5EASA 3RX8A 1N4SB 1S64B 1JCSB 3W5MA 1SA4B 1EGUA 3D5SA 1W6KA 5DGQA 1X1IA 1HX9A 1J0MA 1FBOA 3HXFB 3S4CA 3X17A 3KLSA 4C1SA 4GTVB 1ULVA 3RX7A 1N1ZA 2DROA 4NEIA 3SDVA 2PN5A 3E73A 1UT9A 3PYBA 2SQCA 3SDQA 4J5TA 2EABA 4ZRPA 1TNBB 2JJBA 2V8IA 3KQ4A 5ILDA 1X9DA 2JG0A 1O6RA 3DSXB 1F1SA 3PZ2B 4WVCA 3ANJA 4L0GA 1N94B 3DRAB 1N21A 2EACA 1N24A 5DHIA 2WYNA 4D4AA 2X03A 3E33B 2I07B 2ONGA 4EHMB 4D4DA 5IK0A 4MMIA 3E32B 3A3VA 3NFVA 3VSMA 1DOGA 1V7XA 1LXKA 3GT5A 4LNBB 1LOHA 3EU5B 1N7NA 3G4DA 1LF9A 4RNQA 2H6HB 3DSVB 4ZH1A 1FAEA 2FUZA 1GXMA 4D4CA 1G9GA 3M77A 2BRPA 2JF4A 2V3PA 3M76A 5IL3A 3S4BA 5FO9B 3EUVB 1VD5A 3SAEA 3EZ8A 3H2WA 3QSPA 4L6XA 1N23A 2ZBLA 4OZWA 1H3AA 3W7UA 1SQCA 3LZ9A 3WKHA 4D4BA 3T33A 5GZKA 5DGRA 1RWAA 2G02A 3WUXA 2F6DA 1GSZA 5EAUA 1C3DA 4CE7A 1OJNA 4MU9A 3OEDA 3Q75B 1HM3A 4GTSB 3QDEA 2FUTA 4TF4A 1L1YA 1H54A 4Z4LA 3E30B 3W7XA 2GOXA 1XWTA 1F9OA 1NL4B 1O6HA 3E34B 4M76A 4L9PB 3S9VA 5EATA 2FUQA 4GL3A 2RGKA 4OZVA 2BBCA 1W6JA 3DSTB 5M7YA 1KS8A 3Q7FB 2DRRA 4WU0A 1JCQB 4LNVA 3VW5A 4JJJA 5ILIA 4GTMB 4D94A 1FT2B 2PMVA 3K7XA 4OK4A 5FOBB 5AGDA 2ZZRA 3VXDA 1V7WA 1NI1B 5IM1A 1HN0A 3SDUA 1TNUB 3AFJA 3M00A 5C05A 1UMPA 1QSJA 4AYRA 1O5MB
chains in the Genus database with same CATH topology
1OJNA 2E24A 1I8QA 1CB8A 4F13A 1HM3A 2BRPA 4NEIA 2FUTA 1N7QA 1HMUA 1RWGA 2X03A 1HM2A 1RW9A 1OJOA 1N7RA 1RWHA 4F10A 2BRVX 4OJZA 5JMFA 4OK4A 5JMDA 1QAZA 1F9GA 4MMIA 1OJMA 4OZWA 3NFVA 1N7OA 3VSMA 1X1JA 1LXMA 3A0OA 1RWFA 2Q1FA 4OK2A 1C82A 1LXKA 2WDAA 2FUQA 1RWAA 4OZVA 1LOHA 1RWCA 1EGUA 1W3YA 4MMHA 1N7NA 1HN0A 3NNBA 1X1HA 2WCOA 1OJPA 1F1SA 1HMWA 1N7PA 3E7JA 1X1IA 1J0NA 3E80A 4FNVA 3AFLA 1HV6A 2E22A 2BRWA 3VSNA 1J0MA 4E1YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJN A;  2E24 A;  1I8Q A;  1CB8 A;  4F13 A;  1HM3 A;  2BRP A;  4NEI A;  2FUT A;  1N7Q A;  1HMU A;  1RWG A;  2X03 A;  1HM2 A;  1RW9 A;  1OJO A;  1N7R A;  1RWH A;  4F10 A;  2BRV X;  4OJZ A;  5JMF A;  4OK4 A;  5JMD A;  1QAZ A;  1F9G A;  4MMI A;  1OJM A;  4OZW A;  3NFV A;  1N7O A;  3VSM A;  1X1J A;  1LXM A;  3A0O A;  1RWF A;  2Q1F A;  4OK2 A;  1C82 A;  1LXK A;  2WDA A;  2FUQ A;  1RWA A;  4OZV A;  1LOH A;  1RWC A;  1EGU A;  1W3Y A;  4MMH A;  1N7N A;  1HN0 A;  3NNB A;  1X1H A;  2WCO A;  1OJP A;  1F1S A;  1HMW A;  1N7P A;  3E7J A;  1X1I A;  1J0N A;  3E80 A;  4FNV A;  3AFL A;  1HV6 A;  2E22 A;  2BRW A;  3VSN A;  1J0M A;  4E1Y A; 
#chains in the Genus database with same CATH topology
 2XQW A;  1TNY B;  1CB8 A;  3M7C A;  1WU4 A;  3QXQ A;  1HCU A;  4AYQ A;  1RWG A;  3M73 A;  3W7S A;  1HM2 A;  4F10 A;  3HXC B;  1F9G A;  1OJM A;  1QBQ B;  2FV0 A;  5CA3 A;  3QXF A;  2H6I B;  3A0O A;  4GTT B;  4KKJ A;  3ON6 A;  2V8K A;  3W5N A;  5IK9 A;  5MEH A;  2GZ6 A;  1HXG A;  2FBA A;  3AFL A;  3WIQ A;  3M72 A;  5ILZ A;  2D8L A;  3RSY A;  1KSC A;  3PYA A;  1UG9 A;  1NXC A;  3DPY B;  3PMM A;  1HXC A;  2EAE A;  1LTX B;  4FXG B;  1O1S B;  3SFX B;  3G4F A;  5ILK A;  3P2C A;  1KWF A;  3TF4 A;  1S63 B;  4ZH5 A;  1H39 A;  1N95 B;  3M74 A;  3QT3 A;  1OJP A;  1DL2 A;  2XWB B;  2Z07 A;  3SFY B;  2BRW A;  3Q78 B;  4Q88 A;  1G6I A;  3SDT A;  3HXE B;  1N7R A;  3M7E A;  5JMF A;  5JMD A;  1CLC A;  1K72 A;  3WIR A;  1D8D B;  4BOJ A;  5M7I A;  1GLM A;  4WVA A;  1RQ5 A;  3M01 A;  2NVP A;  1FBW A;  3PZ3 B;  3VSN A;  1O79 A;  3M7L A;  3D3I A;  3WKF A;  1H12 A;  2ZIS B;  4TXT A;  1GAH A;  5FO8 B;  3QPF A;  4OJZ A;  1FPP B;  3HXD B;  4QT9 A;  4LIX A;  3ACS A;  4Z4J A;  2BB6 A;  1H3B A;  3Q7A B;  4OK2 A;  3PZ4 B;  3QG0 A;  1IA7 A;  1KRF A;  1N20 A;  4GTO B;  1KKT A;  4EL8 A;  1H14 A;  1J0N A;  3WKI A;  4AYO A;  4CJ0 A;  1TN7 B;  3KSQ B;  3N0F A;  1RW9 A;  1FP3 A;  1FO2 A;  2B39 A;  5FO7 B;  3M71 A;  3S4D A;  1MZC B;  2H6G B;  2AHF A;  2NOJ A;  1N7O A;  1LD7 B;  1X1J A;  3P5P A;  2Q1F A;  4ONT A;  1RWC A;  3DSU B;  4AYP A;  2VN4 A;  1XW2 A;  1GXO A;  1H3C A;  2IEJ B;  3RJ3 A;  3E80 A;  1SA5 B;  1CEM A;  1X81 B;  2V8J A;  3E37 B;  4FJQ A;  4CJ1 A;  4E1Y A;  4YCR A;  1N4P B;  5E2J A;  4F13 A;  1V7V A;  3EU8 A;  3REN A;  1JCR B;  1F9D A;  5CD2 A;  3DSW B;  1RWH A;  1TF4 A;  1LF6 A;  2G0D A;  5KKB A;  4V1S A;  3M7B A;  5IKA A;  1H13 A;  4KKI A;  4BOK A;  3M75 A;  3M02 A;  2V3N A;  1O6Q A;  2DRS A;  2WDA A;  2RI8 A;  1L2A A;  2J5C A;  1GXN A;  3N0G A;  1N22 A;  2D5J A;  3PZ1 B;  2AFA A;  1H35 A;  1H37 A;  3WC3 A;  1LD8 B;  2CQT A;  1V5D A;  1AYX A;  2A73 B;  4GTR B;  3WKG A;  2VN7 A;  4ZG8 A;  5GW7 A;  5ILJ A;  3H3K A;  5ILY A;  1WZZ A;  1XWQ A;  3QWT A;  1TN6 B;  5IK6 A;  3SQC A;  1G87 A;  1V5C A;  1QAZ A;  2R2L B;  4YDE B;  5JPN B;  3Q73 B;  4GTP B;  1LXM A;  1RWF A;  3D5R A;  1C82 A;  1IS9 A;  2F0Y B;  3NNB A;  5GY3 A;  2A8Z A;  1KSD A;  3M78 A;  2ONH A;  5JPM B;  1N4Q B;  1HMW A;  3E7J A;  2OKX A;  2AHG A;  1HV6 A;  2H6F B;  1TN8 B;  1FMI A;  5CZL A;  1O1R B;  2EAD A;  1WU5 A;  4Q2B A;  1OJO A;  3ANK A;  3EQA A;  3W7W A;  1KFG A;  5IL8 A;  3S4A A;  1N4R B;  1JS4 A;  5ILH A;  1NC5 A;  4MMH A;  4V1R A;  2ZIR B;  2WCO A;  4YDO B;  2P0V A;  3GZK A;  1N7P A;  4DOE A;  2QNO A;  1TNZ B;  1FCE A;  2BB5 A;  4FXK B;  4KTP A;  1D8E B;  2FV1 A;  3E6U A;  3K11 A;  4GTQ B;  1KRE A;  3GLY A;  4WVB A;  2B4F A;  2CQS A;  3G6J B;  1HZF A;  1IA6 A;  3SDR A;  3H7L A;  3W7T A;  2YIK A;  3OXU A;  3CIH A;  3Q79 B;  1G9J A;  2DRQ A;  4MBG B;  1TNO B;  1AGM A;  2BED B;  4FNV A;  1N9A B;  2E22 A;  4XUV A;  1H36 A;  3RX5 A;  1FT1 B;  1R76 A;  4LNG B;  2E24 A;  4ZRQ A;  1GA2 A;  2WII B;  3QFY A;  1O1T B;  4KTR A;  2WY8 A;  1N1B A;  2WIN B;  3WIW A;  1KZO B;  3QRY A;  4GAX A;  1DCE B;  5DHK A;  1HXA A;  3QFZ A;  3QT9 A;  1W3Y A;  1X1H A;  4FUS A;  1QQF A;  2XWJ B;  1GHQ A;  2WY7 A;  4DI5 A;  3DSS B;  1I8Q A;  3ACT A;  3ANI A;  2RI9 A;  3CU7 A;  3C72 B;  1N7Q A;  1HMU A;  2XFG A;  1GAI A;  1KZP B;  5IKH A;  2BRV X;  3HXB B;  1WU6 A;  1FO3 A;  3P5R A;  2GH4 A;  4DOD A;  3RRS A;  3KSL B;  5EAS A;  3RX8 A;  1N4S B;  1S64 B;  1JCS B;  3W5M A;  1SA4 B;  1EGU A;  3D5S A;  1W6K A;  5DGQ A;  1X1I A;  1HX9 A;  1J0M A;  1FBO A;  3HXF B;  3S4C A;  3X17 A;  3KLS A;  4C1S A;  4GTV B;  1ULV A;  3RX7 A;  1N1Z A;  2DRO A;  4NEI A;  3SDV A;  2PN5 A;  3E73 A;  1UT9 A;  3PYB A;  2SQC A;  3SDQ A;  4J5T A;  2EAB A;  4ZRP A;  1TNB B;  2JJB A;  2V8I A;  3KQ4 A;  5ILD A;  1X9D A;  2JG0 A;  1O6R A;  3DSX B;  1F1S A;  3PZ2 B;  4WVC A;  3ANJ A;  4L0G A;  1N94 B;  3DRA B;  1N21 A;  2EAC A;  1N24 A;  5DHI A;  2WYN A;  4D4A A;  2X03 A;  3E33 B;  2I07 B;  2ONG A;  4EHM B;  4D4D A;  5IK0 A;  4MMI A;  3E32 B;  3A3V A;  3NFV A;  3VSM A;  1DOG A;  1V7X A;  1LXK A;  3GT5 A;  4LNB B;  1LOH A;  3EU5 B;  1N7N A;  3G4D A;  1LF9 A;  4RNQ A;  2H6H B;  3DSV B;  4ZH1 A;  1FAE A;  2FUZ A;  1GXM A;  4D4C A;  1G9G A;  3M77 A;  2BRP A;  2JF4 A;  2V3P A;  3M76 A;  5IL3 A;  3S4B A;  5FO9 B;  3EUV B;  1VD5 A;  3SAE A;  3EZ8 A;  3H2W A;  3QSP A;  4L6X A;  1N23 A;  2ZBL A;  4OZW A;  1H3A A;  3W7U A;  1SQC A;  3LZ9 A;  3WKH A;  4D4B A;  3T33 A;  5GZK A;  5DGR A;  1RWA A;  2G02 A;  3WUX A;  2F6D A;  1GSZ A;  5EAU A;  1C3D A;  4CE7 A;  1OJN A;  4MU9 A;  3OED A;  3Q75 B;  1HM3 A;  4GTS B;  3QDE A;  2FUT A;  4TF4 A;  1L1Y A;  1H54 A;  4Z4L A;  3E30 B;  3W7X A;  2GOX A;  1XWT A;  1F9O A;  1NL4 B;  1O6H A;  3E34 B;  4M76 A;  4L9P B;  3S9V A;  5EAT A;  2FUQ A;  4GL3 A;  2RGK A;  4OZV A;  2BBC A;  1W6J A;  3DST B;  5M7Y A;  1KS8 A;  3Q7F B;  2DRR A;  4WU0 A;  1JCQ B;  4LNV A;  3VW5 A;  4JJJ A;  5ILI A;  4GTM B;  4D94 A;  1FT2 B;  2PMV A;  3K7X A;  4OK4 A;  5FOB B;  5AGD A;  2ZZR A;  3VXD A;  1V7W A;  1NI1 B;  5IM1 A;  1HN0 A;  3SDU A;  1TNU B;  3AFJ A;  3M00 A;  5C05 A;  1UMP A;  1QSJ A;  4AYR A;  1O5M B; 
#chains in the Genus database with same CATH homology
 1OJN A;  2E24 A;  1I8Q A;  1CB8 A;  4F13 A;  1HM3 A;  2BRP A;  4NEI A;  2FUT A;  1N7Q A;  1HMU A;  1RWG A;  2X03 A;  1HM2 A;  1RW9 A;  1OJO A;  1N7R A;  1RWH A;  4F10 A;  2BRV X;  4OJZ A;  5JMF A;  4OK4 A;  5JMD A;  1QAZ A;  1F9G A;  4MMI A;  1OJM A;  4OZW A;  3NFV A;  1N7O A;  3VSM A;  1X1J A;  1LXM A;  3A0O A;  1RWF A;  2Q1F A;  4OK2 A;  1C82 A;  1LXK A;  2WDA A;  2FUQ A;  1RWA A;  4OZV A;  1LOH A;  1RWC A;  1EGU A;  1W3Y A;  4MMH A;  1N7N A;  1HN0 A;  3NNB A;  1X1H A;  2WCO A;  1OJP A;  1F1S A;  1HMW A;  1N7P A;  3E7J A;  1X1I A;  1J0N A;  3E80 A;  4FNV A;  3AFL A;  1HV6 A;  2E22 A;  2BRW A;  3VSN A;  1J0M A;  4E1Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...