4OZVA

Crystal structure of the periplasmic alginate lyase algl
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
335
structure length
333
Chain Sequence
ADLVPPPGYYAAVGERKAGSCPAVPPPYTGSLVFTSKYEGSDSARATLNVKAEKTFRSQIKDITDMERGATKLVTQYMRSGRDGDLACALNWMSAWARAGALQSDDFNHTGKSMRKWALGSLSGAYMRLKFSSSRPLAAHAEQSREIEDWFARLGTQVVRDWSGLPLKKINNHSYWAAWSVMSTAVVTNRRDLFDWAVSEFKVAANQVDEQGFLPNELKRRQRALAYHNYALPPLAMIAAFAQVNGVDLRQENHGALQRLAERVMKGVDDEETFEEKTGEDQDMTDLKVDNKYAWLEPYCALYRCEPKMLEAKKDREPFNSFRLGGEVTRVFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate lyase
publication title Crystal Structure of the periplasmic alginate lyase AlgL
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 140
structure length 333
sequence length 335
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4ozvA00
4OJZA 1HN0A 4E1YA 1OJNA 1J0NA 1OJMA 3NFVA 2E24A 4MMHA 1HM3A 4OK4A 1X1HA 4F13A 5JMDA 1N7RA 1X1JA 2FUTA 1RWGA 1J0MA 1LXMA 1HMUA 4OK2A 1I8QA 3VSNA 1F9GA 3E7JA 1F1SA 1OJOA 1HM2A 1HMWA 2E22A 3VSMA 1N7PA 1RW9A 1QAZA 1CB8A 1RWCA 1N7OA 2Q1FA 4MMIA 5JMFA 1RWFA 2WCOA 2BRWA 4F10A 2BRPA 3E80A 2BRVX 4OZWA 1LOHA 1EGUA 3AFLA 1HV6A 1N7NA 1N7QA 3NNBA 4NEIA 4FNVA 1RWAA 1OJPA 2FUQA 1C82A 1W3YA 3A0OA 2X03A 1LXKA 4OZVA 1X1IA 2WDAA 1RWHA
chains in the Genus database with same CATH superfamily
1JCSB 2JG0A 3M01A 2CQTA 4OK4A 1O5MB 3M76A 1NC5A 3H7LA 3GT5A 3K11A 2FUTA 1RWGA 1HMUA 4FJQA 3S4BA 1F9GA 5IKHA 3M02A 3H3KA 1AGMA 3PYAA 2H6IB 4DOEA 1JS4A 2SQCA 2EABA 2XFGA 1FP3A 3NNBA 1GAIA 5FO8B 3X17A 1NL4B 2EACA 1IS9A 3Q78B 1TN6B 2FV1A 1LF9A 4CE7A 4Z4JA 3Q7AB 3SDTA 2ONHA 2F0YB 4KKJA 1H3AA 1FCEA 3SDRA 1LF6A 4ZH5A 2XWBB 1RWCA 3E6UA 2Q1FA 3LZ9A 3PZ2B 2BRPA 2A8ZA 1SA4B 1O6RA 1N24A 3KLSA 2WY8A 2NOJA 4OJZA 1KZPB 1OJNA 3EU8A 3PYBA 3QFYA 3WKFA 3HXBB 1N23A 3SDQA 4LNVA 2FUZA 4TXTA 3W7WA 2GOXA 3EZ8A 4DODA 1K72A 5IKAA 4GTPB 1CB8A 1HX9A 2XQWA 4MMIA 2WIIB 2WCOA 1EGUA 5IL3A 1HCUA 1N7QA 4EHMB 5ILKA 4ONTA 3WUXA 3D3IA 1X1IA 4YDOB 2G02A 1KRFA 1UT9A 3E33B 1VD5A 3GZKA 3PZ3B 1I8QA 1FMIA 1SA5B 4LIXA 2B4FA 1TF4A 1RQ5A 3EUVB 4ZH1A 3D5RA 3WC3A 1WU4A 5CD2A 1N4RB 3E80A 1LOHA 3RX7A 1NXCA 3QSPA 5FO7B 1N95B 1N22A 1TNYB 5IK9A 4Q88A 1QSJA 3ON6A 1G9GA 4MMHA 3N0GA 4WVCA 5IK0A 3KSQB 3QXFA 1J0MA 2P0VA 1UMPA 1QBQB 1SQCA 3M00A 4GAXA 4WU0A 2E22A 2WY7A 4RNQA 3QFZA 3QXQA 4D4AA 3EU5B 4OZWA 1D8DB 3Q79B 1KFGA 3HXCB 3S4CA 3WKIA 3TF4A 5DGQA 1H37A 1D8EB 3CU7A 3M7EA 3H2WA 1N7RA 3KSLB 3T33A 1X81B 1KKTA 3RX8A 2VN7A 1LTXB 3E7JA 1DCEB 1H54A 3M71A 4ZRPA 2DROA 1FO3A 1KS8A 2B39A 3QG0A 5JPNB 4GL3A 5JMFA 1JCQB 1CEMA 4JJJA 4Q2BA 5FOBB 1O79A 3DRAB 5IK6A 2FUQA 1OJPA 1C3DA 1C82A 1KSDA 3ACSA 1ULVA 1V7XA 3HXEB 3S4AA 4ZG8A 3WKGA 1W6KA 2E24A 3DSWB 4M76A 4GTTB 5JMDA 1CLCA 1O1TB 4YCRA 3RSYA 3A3VA 5M7IA 1JCRB 1F1SA 1LD8B 4GTOB 1S64B 2H6HB 3W7SA 1HXAA 3WIQA 2JJBA 2Z07A 3E34B 4FUSA 1KSCA 4KTPA 4FXKB 5ILYA 1GSZA 2PMVA 1IA6A 2EAEA 1H13A 2QNOA 1GXMA 5ILIA 1OJMA 1FT2B 5M7YA 1FAEA 4EL8A 1X1JA 4C1SA 4WVAA 3E30B 3K7XA 5C05A 1QAZA 2ZISB 5ILZA 3AFJA 2V3NA 2BB6A 1RWAA 3G6JB 1AYXA 3M72A 3RRSA 3SDVA 1UG9A 3P5PA 4MBGB 2NVPA 3E32B 1V5CA 1H12A 1O6QA 2ZZRA 1FPPB 1N1ZA 5DGRA 4V1SA 1XWQA 1KZOB 4QT9A 3M7LA 3Q73B 2AHFA 1TN8B 1XWTA 1V7WA 2AHGA 5AGDA 1IA7A 1N4PB 3RX5A 3M75A 1N7NA 4NEIA 3S9VA 5GW7A 2YIKA 3SAEA 3VW5A 5E2JA 3SFYB 4LNBB 2GH4A 3QRYA 4LNGB 2RGKA 3VXDA 3DPYB 3WIRA 1HMWA 3QDEA 3M73A 1GXNA 5JPMB 3W7XA 3ANJA 4GTRB 1O1SB 2V8KA 1DL2A 4L6XA 1KREA 1HXCA 4J5TA 2D5JA 1GLMA 1RWHA 2DRSA 4D4DA 4E1YA 3SQCA 3Q7FB 3S4DA 3QT3A 4ZRQA 1HM3A 1FO2A 3CIHA 4TF4A 2D8LA 1KWFA 2XWJB 2CQSA 3HXDB 4GTQB 4CJ0A 3E73A 3QT9A 1S63B 2R2LB 4BOJA 4AYQA 1H39A 1N7OA 5FO9B 4DI5A 3DSTB 1TNOB 1V5DA 4F10A 2ZIRB 1MZCB 1TNUB 2I07B 2V8JA 1N94B 3D5SA 1H36A 1N1BA 2EADA 3EQAA 3NFVA 3WKHA 4D94A 3W5NA 1R76A 3ANKA 3E37B 1L2AA 3HXFB 2J5CA 3M7BA 3VSNA 3N0FA 2AFAA 1RW9A 3M74A 4WVBA 4L0GA 2GZ6A 3M78A 3M77A 1HV6A 1N4QB 2V8IA 4AYRA 3RENA 1O6HA 1N4SB 1FBWA 1HN0A 1GHQA 3SFXB 1FT1B 2WYNA 4V1RA 4XUVA 4Z4LA 4GTSB 4OK2A 4D4BA 2DRQA 1L1YA 3VSMA 1N7PA 1WZZA 3M7CA 4AYOA 4L9PB 3KQ4A 3G4DA 5CZLA 1G6IA 1N9AB 1GXOA 4FNVA 3WIWA 4BOKA 5EAUA 3DSXB 2BB5A 1WU6A 2WDAA 2ZBLA 3QPFA 3DSSB 1TNBB 1XW2A 1FBOA 1LD7B 4F13A 5GZKA 2H6GB 3DSVB 3OXUA 5GY3A 5MEHA 5ILDA 4CJ1A 1F9OA 4AYPA 3QWTA 1N20A 4KKIA 2FBAA 5IL8A 1H3CA 2BRWA 3P5RA 3AFLA 3ACTA 2OKXA 3W7UA 1W3YA 2ONGA 4FXGB 3G4FA 1LXKA 1G87A 2BEDB 5CA3A 1J0NA 1GA2A 1X1HA 1TNZB 2G0DA 2IEJB 5ILJA 4GTMB 2RI9A 2FV0A 5DHIA 2V3PA 1G9JA 2PN5A 1OJOA 1HM2A 1H3BA 1GAHA 1TN7B 5EASA 4GTVB 2F6DA 1RWFA 5EATA 1DOGA 2WINB 3A0OA 2A73B 4OZVA 5ILHA 3GLYA 5IM1A 1QQFA 3OEDA 5DHKA 3P2CA 4YDEB 1HZFA 3PZ4B 4D4CA 1F9DA 2JF4A 1LXMA 1W6JA 1N21A 1WU5A 3RJ3A 3PZ1B 1H14A 1H35A 3DSUB 2BBCA 3C72B 3ANIA 3SDUA 1V7VA 1O1RB 2DRRA 1NI1B 2BRVX 2VN4A 4KTRA 3PMMA 4MU9A 1HXGA 2RI8A 2X03A 3W5MA 5KKBA 1X9DA 3W7TA 2H6FB 3Q75B
chains in the Genus database with same CATH topology
4OJZA 1HN0A 4E1YA 1OJNA 1J0NA 1OJMA 3NFVA 2E24A 4MMHA 1HM3A 4OK4A 1X1HA 4F13A 5JMDA 1N7RA 1X1JA 2FUTA 1RWGA 1J0MA 1LXMA 1HMUA 4OK2A 1I8QA 3VSNA 1F9GA 3E7JA 1F1SA 1OJOA 1HM2A 1HMWA 2E22A 3VSMA 1N7PA 1RW9A 1QAZA 1CB8A 1RWCA 1N7OA 2Q1FA 4MMIA 5JMFA 1RWFA 2WCOA 2BRWA 4F10A 2BRPA 3E80A 2BRVX 4OZWA 1LOHA 1EGUA 3AFLA 1HV6A 1N7NA 1N7QA 3NNBA 4NEIA 4FNVA 1RWAA 1OJPA 2FUQA 1C82A 1W3YA 3A0OA 2X03A 1LXKA 4OZVA 1X1IA 2WDAA 1RWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJZ A;  1HN0 A;  4E1Y A;  1OJN A;  1J0N A;  1OJM A;  3NFV A;  2E24 A;  4MMH A;  1HM3 A;  4OK4 A;  1X1H A;  4F13 A;  5JMD A;  1N7R A;  1X1J A;  2FUT A;  1RWG A;  1J0M A;  1LXM A;  1HMU A;  4OK2 A;  1I8Q A;  3VSN A;  1F9G A;  3E7J A;  1F1S A;  1OJO A;  1HM2 A;  1HMW A;  2E22 A;  3VSM A;  1N7P A;  1RW9 A;  1QAZ A;  1CB8 A;  1RWC A;  1N7O A;  2Q1F A;  4MMI A;  5JMF A;  1RWF A;  2WCO A;  2BRW A;  4F10 A;  2BRP A;  3E80 A;  2BRV X;  4OZW A;  1LOH A;  1EGU A;  3AFL A;  1HV6 A;  1N7N A;  1N7Q A;  3NNB A;  4NEI A;  4FNV A;  1RWA A;  1OJP A;  2FUQ A;  1C82 A;  1W3Y A;  3A0O A;  2X03 A;  1LXK A;  4OZV A;  1X1I A;  2WDA A;  1RWH A; 
#chains in the Genus database with same CATH topology
 1JCS B;  2JG0 A;  3M01 A;  2CQT A;  4OK4 A;  1O5M B;  3M76 A;  1NC5 A;  3H7L A;  3GT5 A;  3K11 A;  2FUT A;  1RWG A;  1HMU A;  4FJQ A;  3S4B A;  1F9G A;  5IKH A;  3M02 A;  3H3K A;  1AGM A;  3PYA A;  2H6I B;  4DOE A;  1JS4 A;  2SQC A;  2EAB A;  2XFG A;  1FP3 A;  3NNB A;  1GAI A;  5FO8 B;  3X17 A;  1NL4 B;  2EAC A;  1IS9 A;  3Q78 B;  1TN6 B;  2FV1 A;  1LF9 A;  4CE7 A;  4Z4J A;  3Q7A B;  3SDT A;  2ONH A;  2F0Y B;  4KKJ A;  1H3A A;  1FCE A;  3SDR A;  1LF6 A;  4ZH5 A;  2XWB B;  1RWC A;  3E6U A;  2Q1F A;  3LZ9 A;  3PZ2 B;  2BRP A;  2A8Z A;  1SA4 B;  1O6R A;  1N24 A;  3KLS A;  2WY8 A;  2NOJ A;  4OJZ A;  1KZP B;  1OJN A;  3EU8 A;  3PYB A;  3QFY A;  3WKF A;  3HXB B;  1N23 A;  3SDQ A;  4LNV A;  2FUZ A;  4TXT A;  3W7W A;  2GOX A;  3EZ8 A;  4DOD A;  1K72 A;  5IKA A;  4GTP B;  1CB8 A;  1HX9 A;  2XQW A;  4MMI A;  2WII B;  2WCO A;  1EGU A;  5IL3 A;  1HCU A;  1N7Q A;  4EHM B;  5ILK A;  4ONT A;  3WUX A;  3D3I A;  1X1I A;  4YDO B;  2G02 A;  1KRF A;  1UT9 A;  3E33 B;  1VD5 A;  3GZK A;  3PZ3 B;  1I8Q A;  1FMI A;  1SA5 B;  4LIX A;  2B4F A;  1TF4 A;  1RQ5 A;  3EUV B;  4ZH1 A;  3D5R A;  3WC3 A;  1WU4 A;  5CD2 A;  1N4R B;  3E80 A;  1LOH A;  3RX7 A;  1NXC A;  3QSP A;  5FO7 B;  1N95 B;  1N22 A;  1TNY B;  5IK9 A;  4Q88 A;  1QSJ A;  3ON6 A;  1G9G A;  4MMH A;  3N0G A;  4WVC A;  5IK0 A;  3KSQ B;  3QXF A;  1J0M A;  2P0V A;  1UMP A;  1QBQ B;  1SQC A;  3M00 A;  4GAX A;  4WU0 A;  2E22 A;  2WY7 A;  4RNQ A;  3QFZ A;  3QXQ A;  4D4A A;  3EU5 B;  4OZW A;  1D8D B;  3Q79 B;  1KFG A;  3HXC B;  3S4C A;  3WKI A;  3TF4 A;  5DGQ A;  1H37 A;  1D8E B;  3CU7 A;  3M7E A;  3H2W A;  1N7R A;  3KSL B;  3T33 A;  1X81 B;  1KKT A;  3RX8 A;  2VN7 A;  1LTX B;  3E7J A;  1DCE B;  1H54 A;  3M71 A;  4ZRP A;  2DRO A;  1FO3 A;  1KS8 A;  2B39 A;  3QG0 A;  5JPN B;  4GL3 A;  5JMF A;  1JCQ B;  1CEM A;  4JJJ A;  4Q2B A;  5FOB B;  1O79 A;  3DRA B;  5IK6 A;  2FUQ A;  1OJP A;  1C3D A;  1C82 A;  1KSD A;  3ACS A;  1ULV A;  1V7X A;  3HXE B;  3S4A A;  4ZG8 A;  3WKG A;  1W6K A;  2E24 A;  3DSW B;  4M76 A;  4GTT B;  5JMD A;  1CLC A;  1O1T B;  4YCR A;  3RSY A;  3A3V A;  5M7I A;  1JCR B;  1F1S A;  1LD8 B;  4GTO B;  1S64 B;  2H6H B;  3W7S A;  1HXA A;  3WIQ A;  2JJB A;  2Z07 A;  3E34 B;  4FUS A;  1KSC A;  4KTP A;  4FXK B;  5ILY A;  1GSZ A;  2PMV A;  1IA6 A;  2EAE A;  1H13 A;  2QNO A;  1GXM A;  5ILI A;  1OJM A;  1FT2 B;  5M7Y A;  1FAE A;  4EL8 A;  1X1J A;  4C1S A;  4WVA A;  3E30 B;  3K7X A;  5C05 A;  1QAZ A;  2ZIS B;  5ILZ A;  3AFJ A;  2V3N A;  2BB6 A;  1RWA A;  3G6J B;  1AYX A;  3M72 A;  3RRS A;  3SDV A;  1UG9 A;  3P5P A;  4MBG B;  2NVP A;  3E32 B;  1V5C A;  1H12 A;  1O6Q A;  2ZZR A;  1FPP B;  1N1Z A;  5DGR A;  4V1S A;  1XWQ A;  1KZO B;  4QT9 A;  3M7L A;  3Q73 B;  2AHF A;  1TN8 B;  1XWT A;  1V7W A;  2AHG A;  5AGD A;  1IA7 A;  1N4P B;  3RX5 A;  3M75 A;  1N7N A;  4NEI A;  3S9V A;  5GW7 A;  2YIK A;  3SAE A;  3VW5 A;  5E2J A;  3SFY B;  4LNB B;  2GH4 A;  3QRY A;  4LNG B;  2RGK A;  3VXD A;  3DPY B;  3WIR A;  1HMW A;  3QDE A;  3M73 A;  1GXN A;  5JPM B;  3W7X A;  3ANJ A;  4GTR B;  1O1S B;  2V8K A;  1DL2 A;  4L6X A;  1KRE A;  1HXC A;  4J5T A;  2D5J A;  1GLM A;  1RWH A;  2DRS A;  4D4D A;  4E1Y A;  3SQC A;  3Q7F B;  3S4D A;  3QT3 A;  4ZRQ A;  1HM3 A;  1FO2 A;  3CIH A;  4TF4 A;  2D8L A;  1KWF A;  2XWJ B;  2CQS A;  3HXD B;  4GTQ B;  4CJ0 A;  3E73 A;  3QT9 A;  1S63 B;  2R2L B;  4BOJ A;  4AYQ A;  1H39 A;  1N7O A;  5FO9 B;  4DI5 A;  3DST B;  1TNO B;  1V5D A;  4F10 A;  2ZIR B;  1MZC B;  1TNU B;  2I07 B;  2V8J A;  1N94 B;  3D5S A;  1H36 A;  1N1B A;  2EAD A;  3EQA A;  3NFV A;  3WKH A;  4D94 A;  3W5N A;  1R76 A;  3ANK A;  3E37 B;  1L2A A;  3HXF B;  2J5C A;  3M7B A;  3VSN A;  3N0F A;  2AFA A;  1RW9 A;  3M74 A;  4WVB A;  4L0G A;  2GZ6 A;  3M78 A;  3M77 A;  1HV6 A;  1N4Q B;  2V8I A;  4AYR A;  3REN A;  1O6H A;  1N4S B;  1FBW A;  1HN0 A;  1GHQ A;  3SFX B;  1FT1 B;  2WYN A;  4V1R A;  4XUV A;  4Z4L A;  4GTS B;  4OK2 A;  4D4B A;  2DRQ A;  1L1Y A;  3VSM A;  1N7P A;  1WZZ A;  3M7C A;  4AYO A;  4L9P B;  3KQ4 A;  3G4D A;  5CZL A;  1G6I A;  1N9A B;  1GXO A;  4FNV A;  3WIW A;  4BOK A;  5EAU A;  3DSX B;  2BB5 A;  1WU6 A;  2WDA A;  2ZBL A;  3QPF A;  3DSS B;  1TNB B;  1XW2 A;  1FBO A;  1LD7 B;  4F13 A;  5GZK A;  2H6G B;  3DSV B;  3OXU A;  5GY3 A;  5MEH A;  5ILD A;  4CJ1 A;  1F9O A;  4AYP A;  3QWT A;  1N20 A;  4KKI A;  2FBA A;  5IL8 A;  1H3C A;  2BRW A;  3P5R A;  3AFL A;  3ACT A;  2OKX A;  3W7U A;  1W3Y A;  2ONG A;  4FXG B;  3G4F A;  1LXK A;  1G87 A;  2BED B;  5CA3 A;  1J0N A;  1GA2 A;  1X1H A;  1TNZ B;  2G0D A;  2IEJ B;  5ILJ A;  4GTM B;  2RI9 A;  2FV0 A;  5DHI A;  2V3P A;  1G9J A;  2PN5 A;  1OJO A;  1HM2 A;  1H3B A;  1GAH A;  1TN7 B;  5EAS A;  4GTV B;  2F6D A;  1RWF A;  5EAT A;  1DOG A;  2WIN B;  3A0O A;  2A73 B;  4OZV A;  5ILH A;  3GLY A;  5IM1 A;  1QQF A;  3OED A;  5DHK A;  3P2C A;  4YDE B;  1HZF A;  3PZ4 B;  4D4C A;  1F9D A;  2JF4 A;  1LXM A;  1W6J A;  1N21 A;  1WU5 A;  3RJ3 A;  3PZ1 B;  1H14 A;  1H35 A;  3DSU B;  2BBC A;  3C72 B;  3ANI A;  3SDU A;  1V7V A;  1O1R B;  2DRR A;  1NI1 B;  2BRV X;  2VN4 A;  4KTR A;  3PMM A;  4MU9 A;  1HXG A;  2RI8 A;  2X03 A;  3W5M A;  5KKB A;  1X9D A;  3W7T A;  2H6F B;  3Q75 B; 
#chains in the Genus database with same CATH homology
 4OJZ A;  1HN0 A;  4E1Y A;  1OJN A;  1J0N A;  1OJM A;  3NFV A;  2E24 A;  4MMH A;  1HM3 A;  4OK4 A;  1X1H A;  4F13 A;  5JMD A;  1N7R A;  1X1J A;  2FUT A;  1RWG A;  1J0M A;  1LXM A;  1HMU A;  4OK2 A;  1I8Q A;  3VSN A;  1F9G A;  3E7J A;  1F1S A;  1OJO A;  1HM2 A;  1HMW A;  2E22 A;  3VSM A;  1N7P A;  1RW9 A;  1QAZ A;  1CB8 A;  1RWC A;  1N7O A;  2Q1F A;  4MMI A;  5JMF A;  1RWF A;  2WCO A;  2BRW A;  4F10 A;  2BRP A;  3E80 A;  2BRV X;  4OZW A;  1LOH A;  1EGU A;  3AFL A;  1HV6 A;  1N7N A;  1N7Q A;  3NNB A;  4NEI A;  4FNV A;  1RWA A;  1OJP A;  2FUQ A;  1C82 A;  1W3Y A;  3A0O A;  2X03 A;  1LXK A;  4OZV A;  1X1I A;  2WDA A;  1RWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...