3OXUA

Complement components factor h ccp19-20 and c3d in complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
295
structure length
295
Chain Sequence
EFRDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Structural basis for engagement by complement factor H of C3b on a self surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 117
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3oxuA00
4ZH1A 1D8DB 3E33B 3Q78B 3EUVB 2PMVA 1R76A 1FT2B 2V3NA 1N4RB 1O6RA 4D4AA 3DRAB 1O1TB 2H6HB 2SQCA 3KLSA 4GTVB 5FOBB 2IEJB 2BB6A 3HXFB 3HXDB 4BOJA 1KZOB 4C1SA 2B39A 1N4PB 2G02A 1JCRB 1H3BA 1O6HA 1TNYB 3DSXB 5FO8B 1TNOB 2R2LB 1O1SB 1O6QA 3D5RA 4LNVA 5JPNB 4LNGB 4V1RA 2XWJB 1O1RB 2I07B 1TN6B 1NI1B 1NL4B 1S63B 3C72B 3DSSB 1FPPB 4GTSB 1DCEB 4ZRPA 1TNBB 3DSVB 3DSWB 4M76A 2V8JA 1W6JA 3SFXB 3SQCA 3HXEB 1N4QB 4D4BA 3PZ4B 4EHMB 2ZIRB 3HXCB 3E30B 1H36A 1JCSB 2XWBB 3G6JB 4D4DA 1H35A 2WY7A 2V3PA 1C3DA 2BB5A 1GHQA 2ZISB 3KQ4A 4GTMB 4KKIA 3RJ3A 1N95B 3KSQB 1JCQB 4FXKB 3KSLB 1QSJA 4ZRQA 4LNBB 1H39A 2V8IA 3PZ3B 1LTXB 1MZCB 1UMPA 5FO7B 4KKJA 3Q75B 2BBCA 1S64B 4D4CA 1H3CA 1TNUB 1GXOA 2NOJA 3DSTB 3OEDA 1LD8B 3DPYB 4L9PB 1SA5B 3E34B 1KZPB 2A73B 2H6GB 4YDOB 1SA4B 4GTOB 3Q7AB 3Q7FB 3SFYB 1GXMA 2H6FB 3PZ2B 3D5SA 2PN5A 1N9AB 1O79A 1TNZB 3OXUA 3HXBB 4D94A 4V1SA 1SQCA 3K7XA 5FO9B 4YDEB 4MBGB 3Q73B 1N4SB 3EU5B 1H37A 1GXNA 1QBQB 1TN8B 2BEDB 2G0DA 2WINB 3CU7A 3Q79B 1TN7B 2H6IB 5JPMB 1O5MB 4GTPB 3E32B 4GTTB 2WIIB 1LD7B 4GTRB 4FXGB 4BOKA 1QQFA 4ONTA 4GTQB 3E37B 1D8EB 1W6KA 2WY8A 3PZ1B 1H3AA 1X81B 2F0YB 2GOXA 4MU9A 1GSZA 3DSUB 2XQWA 2V8KA 1FT1B 5AGDA 1HZFA 1N94B
chains in the Genus database with same CATH superfamily
3M73A 1FAEA 1N7RA 4MMIA 5FOBB 4DODA 4OZWA 2D8LA 3HXFB 3HXDB 4FJQA 1KREA 4LIXA 1NC5A 1HCUA 1FP3A 1IS9A 2B39A 3NFVA 1N4PB 4ZG8A 1H3BA 3RRSA 3W5MA 3QXFA 3QT3A 4LNVA 4AYQA 4V1RA 5JMDA 2YIKA 1FO3A 1O1RB 2I07B 3DSSB 4ZRPA 1VD5A 1TNBB 2CQSA 1W3YA 3SQCA 3PZ4B 2EAEA 4EHMB 2ZIRB 2JF4A 3T33A 4D4DA 1N21A 1GHQA 3KQ4A 4GTMB 1JCQB 4FXKB 3M00A 3WIQA 2FBAA 3SDRA 3PZ3B 3W7SA 1MZCB 2EADA 4AYRA 1WU4A 2FV0A 1N7OA 1OJOA 3N0GA 3Q75B 3ACTA 2BBCA 1H3CA 3PMMA 3DPYB 3M77A 2H6GB 4AYOA 3ANKA 1N20A 3Q7FB 1KSDA 4FNVA 2CQTA 4Q88A 4AYPA 1O79A 1HM3A 2ONHA 4D94A 2DROA 3K7XA 2XFGA 3A3VA 4MBGB 3Q73B 3EU5B 1QBQB 1XWTA 3N0FA 5E2JA 2B4FA 1X1IA 5JPMB 4F10A 2VN4A 3E32B 1FO2A 2DRRA 1AYXA 1UT9A 2ONGA 5MEHA 3E37B 1DOGA 3ANJA 1V7VA 3SDTA 3W7UA 3DSUB 3PYBA 3ON6A 1H12A 2V8KA 1RQ5A 3QDEA 4WVCA 5GW7A 1HMUA 2J5CA 3WIRA 1CLCA 2OKXA 1N22A 3H3KA 3VSMA 1FBOA 5IKAA 1CB8A 2SQCA 4GTVB 1GAIA 2IEJB 2BB6A 2JG0A 4KTPA 1LXKA 5IKHA 5KKBA 3ANIA 1N7PA 1NXCA 3QXQA 2G02A 1LOHA 3RX5A 1XWQA 3WIWA 1TNYB 5FO8B 5DHIA 2R2LB 2RI8A 3D5RA 3RSYA 3M76A 2AHFA 4MMHA 3VW5A 4GTSB 4KTRA 5ILJA 3DSVB 1KRFA 3M7LA 3M72A 2FV1A 4RNQA 2V8JA 1KWFA 3SFXB 3HXEB 1N4QB 3QFZA 1GLMA 2FUQA 1H35A 3S4CA 1KFGA 2RI9A 1H14A 1G9JA 5DHKA 1N95B 1LF6A 2ZBLA 5ILIA 4ZRQA 4GL3A 3SDVA 3W7XA 1X1HA 1XW2A 4CJ0A 4KKJA 5DGQA 4D4CA 1TNUB 1FCEA 3A0OA 3S4BA 1GXOA 2NOJA 3DSTB 1LD8B 4OK4A 5DGRA 2GZ6A 4L9PB 1FBWA 1CEMA 1KZPB 1N24A 1N7NA 4TXTA 4YDOB 3VXDA 1F9GA 3SFYB 1GXMA 3ACSA 2PN5A 3QFYA 4J5TA 1TNZB 1OJPA 2A8ZA 4FUSA 1H54A 1WU5A 1UG9A 1SQCA 4DOEA 1GXNA 1TN8B 3WC3A 2G0DA 4OZVA 1TN7B 1RW9A 1O5MB 1TF4A 4GTPB 3M7BA 4XUVA 3H2WA 3S4AA 4GTRB 1N1BA 1X1JA 4GTQB 1ULVA 5GY3A 1RWGA 3PZ1B 1H3AA 1WZZA 1HV6A 2NVPA 1GSZA 2DRQA 3S4DA 2XQWA 2Z07A 4YCRA 1HZFA 1D8DB 1G9GA 5ILYA 3Q78B 2PMVA 1FT2B 2V3NA 1N4RB 1O6RA 5ILZA 5CD2A 4D4AA 3M7EA 2RGKA 1V7WA 4BOJA 2AFAA 3M74A 2E24A 1G6IA 1EGUA 1JCRB 5JMFA 1O6HA 4Z4LA 3M75A 4L6XA 4Q2BA 3WKIA 1OJNA 5JPNB 1JS4A 2XWJB 1L2AA 1TN6B 3C72B 1NL4B 1S63B 1IA7A 1RWCA 1DCEB 1RWFA 4ZH5A 4Z4JA 4QT9A 5CA3A 3SAEA 4D4BA 2EACA 2FUZA 3E30B 1JCSB 3P2CA 2XWBB 3G6JB 2V3PA 4KKIA 2ZISB 2WYNA 3RJ3A 1HN0A 4CE7A 3KSLB 1QSJA 1RWAA 1GA2A 3K11A 1H39A 3CIHA 2WCOA 3QRYA 3GLYA 3QG0A 3W5NA 4TF4A 1UMPA 5FO7B 3QPFA 4DI5A 2AHGA 3OEDA 3M78A 3WUXA 1F1SA 1HXCA 3W7TA 5IM1A 3E34B 2A73B 3QWTA 1GAHA 1HMWA 2BRWA 2H6FB 2FUTA 3NNBA 4E1YA 1KSCA 3EZ8A 2DRSA 1QAZA 3AFJA 4V1SA 5FO9B 4YDEB 1N4SB 3E80A 1HXAA 2WINB 3LZ9A 2BRVX 1RWHA 1N7QA 1L1YA 1IA6A 3TF4A 2QNOA 4GTTB 1N23A 2WIIB 3S9VA 3D3IA 1X9DA 3WKHA 2F6DA 1AGMA 5GZKA 1N1ZA 1F9OA 1D8EB 5IK9A 5ILKA 1X81B 1H13A 2Q1FA 3H7LA 4NEIA 3EQAA 3W7WA 1V7XA 1F9DA 1HM2A 1FT1B 2BRPA 5AGDA 1N94B 4ZH1A 3E33B 3EUVB 1R76A 2JJBA 5C05A 3DRAB 1O1TB 2H6HB 4OJZA 3KLSA 1KKTA 3RX7A 5ILHA 3SDUA 1KZOB 2D5JA 1LXMA 4C1SA 3GT5A 3DSXB 1TNOB 1O1SB 1O6QA 3M01A 3M7CA 2P0VA 3G4DA 3QT9A 4LNGB 3AFLA 1NI1B 1V5CA 4GAXA 1FPPB 3DSWB 4M76A 3GZKA 4JJJA 1W6JA 3M02A 5EATA 3RENA 3HXCB 1H36A 2WY7A 3SDQA 3G4FA 5M7YA 2GH4A 4WVAA 1DL2A 1C3DA 2BB5A 2EABA 1HX9A 3KSQB 4OK2A 1I8QA 1HXGA 2VN7A 3RX8A 1G87A 4LNBB 2V8IA 1LTXB 4L0GA 3WKGA 1KS8A 1S64B 3M71A 4EL8A 2E22A 4CJ1A 1LF9A 1SA5B 3P5RA 3VSNA 1SA4B 4GTOB 3Q7AB 2WDAA 3PZ2B 3D5SA 4WU0A 1N9AB 1C82A 3OXUA 3E73A 3HXBB 5M7IA 4F13A 3E6UA 3X17A 3QSPA 3CU7A 1H37A 2BEDB 3P5PA 3Q79B 5ILDA 1WU6A 3WKFA 2H6IB 5IK0A 5IK6A 1K72A 1LD7B 3PYAA 1J0MA 4FXGB 1V5DA 4BOKA 1QQFA 4ONTA 1J0NA 1OJMA 1W6KA 4WVBA 2WY8A 3EU8A 2F0YB 5EAUA 5IL8A 2GOXA 4MU9A 1FMIA 5EASA 3E7JA 5CZLA 2X03A 2ZZRA 5IL3A
chains in the Genus database with same CATH topology
3M73A 1FAEA 5FOBB 4DODA 2D8LA 3HXFB 3HXDB 4LIXA 1KREA 1NC5A 1HCUA 1FP3A 1IS9A 2B39A 4ZG8A 1N4PB 1H3BA 3RRSA 3W5MA 3QXFA 3QT3A 4LNVA 4AYQA 4V1RA 2YIKA 1FO3A 1O1RB 2I07B 3DSSB 4ZRPA 1VD5A 1TNBB 2CQSA 3SQCA 3PZ4B 2EAEA 4EHMB 2ZIRB 2JF4A 3T33A 4D4DA 1GHQA 3KQ4A 4GTMB 1JCQB 4FXKB 3WIQA 2FBAA 3SDRA 3PZ3B 3W7SA 1MZCB 2EADA 4AYRA 1WU4A 2FV0A 3Q75B 3ACTA 2BBCA 1H3CA 3PMMA 3DPYB 3M77A 2H6GB 4AYOA 3ANKA 3Q7FB 1KSDA 4Q88A 2CQTA 4AYPA 1O79A 4D94A 2DROA 3K7XA 2XFGA 3A3VA 4MBGB 3Q73B 3EU5B 1QBQB 1XWTA 5E2JA 2B4FA 5JPMB 2VN4A 3E32B 1FO2A 2DRRA 1AYXA 1UT9A 5MEHA 3E37B 1DOGA 3ANJA 1V7VA 3SDTA 3W7UA 3DSUB 3PYBA 3ON6A 1H12A 2V8KA 1RQ5A 3QDEA 4WVCA 5GW7A 3WIRA 1CLCA 2OKXA 3H3KA 1FBOA 2SQCA 4GTVB 1GAIA 2IEJB 2BB6A 2JG0A 4KTPA 5KKBA 3ANIA 1NXCA 3QXQA 2G02A 3RX5A 1XWQA 3WIWA 1TNYB 5FO8B 2R2LB 2RI8A 3D5RA 3RSYA 3M76A 2AHFA 3VW5A 4GTSB 4KTRA 3DSVB 1KRFA 3M7LA 3M72A 2FV1A 2V8JA 1KWFA 3SFXB 3HXEB 1N4QB 3QFZA 1GLMA 1H35A 3S4CA 1KFGA 2RI9A 1H14A 1G9JA 1N95B 1LF6A 2ZBLA 4ZRQA 4GL3A 3SDVA 3W7XA 1XW2A 4CJ0A 4KKJA 5DGQA 4D4CA 1TNUB 1FCEA 3S4BA 1GXOA 2NOJA 3DSTB 1LD8B 5DGRA 2GZ6A 4L9PB 1FBWA 1CEMA 1KZPB 4TXTA 4YDOB 3VXDA 3SFYB 1GXMA 3ACSA 2PN5A 3QFYA 4J5TA 1TNZB 2A8ZA 4FUSA 1H54A 1WU5A 1UG9A 1SQCA 4DOEA 1GXNA 1TN8B 3WC3A 2G0DA 1TN7B 1O5MB 1TF4A 4GTPB 3M7BA 4XUVA 3H2WA 3S4AA 4GTRB 4GTQB 1ULVA 5GY3A 3PZ1B 1H3AA 1WZZA 2NVPA 1GSZA 2DRQA 3S4DA 2XQWA 2Z07A 4YCRA 1HZFA 1D8DB 1G9GA 3Q78B 2PMVA 1FT2B 2V3NA 1N4RB 1O6RA 5CD2A 4D4AA 3M7EA 2RGKA 1V7WA 4BOJA 2AFAA 3M74A 1G6IA 1JCRB 1O6HA 4Z4LA 3M75A 4L6XA 4Q2BA 3WKIA 5JPNB 1JS4A 2XWJB 1L2AA 1TN6B 3C72B 1NL4B 1S63B 1IA7A 1DCEB 4ZH5A 4Z4JA 4QT9A 5CA3A 3SAEA 4D4BA 2EACA 2FUZA 3E30B 1JCSB 3P2CA 2XWBB 3G6JB 2V3PA 4KKIA 2ZISB 2WYNA 3RJ3A 4CE7A 3KSLB 1QSJA 1GA2A 3K11A 1H39A 3CIHA 3QRYA 3GLYA 3QG0A 3W5NA 4TF4A 1UMPA 5FO7B 3QPFA 2AHGA 3OEDA 3M78A 3WUXA 3W7TA 3E34B 2A73B 3QWTA 1GAHA 2H6FB 1KSCA 3EZ8A 2DRSA 3AFJA 4V1SA 5FO9B 4YDEB 1N4SB 2WINB 1L1YA 1IA6A 3TF4A 2QNOA 4GTTB 3S9VA 2WIIB 3WKHA 3D3IA 1X9DA 2F6DA 1AGMA 5GZKA 1F9OA 1D8EB 1X81B 1H13A 3H7LA 3EQAA 3W7WA 1V7XA 1F9DA 1FT1B 5AGDA 1N94B 4ZH1A 3E33B 3EUVB 1R76A 2JJBA 3DRAB 1O1TB 2H6HB 3KLSA 1KKTA 3RX7A 3SDUA 1KZOB 2D5JA 4C1SA 3GT5A 3DSXB 1TNOB 1O1SB 1O6QA 3M7CA 2P0VA 3QT9A 4LNGB 1NI1B 1V5CA 1FPPB 3DSWB 4M76A 3GZKA 4JJJA 1W6JA 3RENA 3HXCB 1H36A 2WY7A 3SDQA 5M7YA 2GH4A 4WVAA 1DL2A 1C3DA 2BB5A 2EABA 3KSQB 2VN7A 3RX8A 1G87A 4LNBB 2V8IA 1LTXB 4L0GA 3WKGA 1KS8A 1S64B 3M71A 4EL8A 4CJ1A 1LF9A 1SA5B 3P5RA 1SA4B 4GTOB 3Q7AB 3PZ2B 3D5SA 4WU0A 1N9AB 3OXUA 3E73A 3HXBB 5M7IA 3E6UA 3X17A 3QSPA 1H37A 3CU7A 2BEDB 3P5PA 3Q79B 1WU6A 3WKFA 2H6IB 1K72A 1LD7B 3PYAA 4FXGB 1V5DA 4BOKA 1QQFA 4ONTA 1W6KA 4WVBA 2WY8A 3EU8A 2F0YB 2GOXA 4MU9A 1FMIA 5CZLA 2ZZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZH1 A;  1D8D B;  3E33 B;  3Q78 B;  3EUV B;  2PMV A;  1R76 A;  1FT2 B;  2V3N A;  1N4R B;  1O6R A;  4D4A A;  3DRA B;  1O1T B;  2H6H B;  2SQC A;  3KLS A;  4GTV B;  5FOB B;  2IEJ B;  2BB6 A;  3HXF B;  3HXD B;  4BOJ A;  1KZO B;  4C1S A;  2B39 A;  1N4P B;  2G02 A;  1JCR B;  1H3B A;  1O6H A;  1TNY B;  3DSX B;  5FO8 B;  1TNO B;  2R2L B;  1O1S B;  1O6Q A;  3D5R A;  4LNV A;  5JPN B;  4LNG B;  4V1R A;  2XWJ B;  1O1R B;  2I07 B;  1TN6 B;  1NI1 B;  1NL4 B;  1S63 B;  3C72 B;  3DSS B;  1FPP B;  4GTS B;  1DCE B;  4ZRP A;  1TNB B;  3DSV B;  3DSW B;  4M76 A;  2V8J A;  1W6J A;  3SFX B;  3SQC A;  3HXE B;  1N4Q B;  4D4B A;  3PZ4 B;  4EHM B;  2ZIR B;  3HXC B;  3E30 B;  1H36 A;  1JCS B;  2XWB B;  3G6J B;  4D4D A;  1H35 A;  2WY7 A;  2V3P A;  1C3D A;  2BB5 A;  1GHQ A;  2ZIS B;  3KQ4 A;  4GTM B;  4KKI A;  3RJ3 A;  1N95 B;  3KSQ B;  1JCQ B;  4FXK B;  3KSL B;  1QSJ A;  4ZRQ A;  4LNB B;  1H39 A;  2V8I A;  3PZ3 B;  1LTX B;  1MZC B;  1UMP A;  5FO7 B;  4KKJ A;  3Q75 B;  2BBC A;  1S64 B;  4D4C A;  1H3C A;  1TNU B;  1GXO A;  2NOJ A;  3DST B;  3OED A;  1LD8 B;  3DPY B;  4L9P B;  1SA5 B;  3E34 B;  1KZP B;  2A73 B;  2H6G B;  4YDO B;  1SA4 B;  4GTO B;  3Q7A B;  3Q7F B;  3SFY B;  1GXM A;  2H6F B;  3PZ2 B;  3D5S A;  2PN5 A;  1N9A B;  1O79 A;  1TNZ B;  3OXU A;  3HXB B;  4D94 A;  4V1S A;  1SQC A;  3K7X A;  5FO9 B;  4YDE B;  4MBG B;  3Q73 B;  1N4S B;  3EU5 B;  1H37 A;  1GXN A;  1QBQ B;  1TN8 B;  2BED B;  2G0D A;  2WIN B;  3CU7 A;  3Q79 B;  1TN7 B;  2H6I B;  5JPM B;  1O5M B;  4GTP B;  3E32 B;  4GTT B;  2WII B;  1LD7 B;  4GTR B;  4FXG B;  4BOK A;  1QQF A;  4ONT A;  4GTQ B;  3E37 B;  1D8E B;  1W6K A;  2WY8 A;  3PZ1 B;  1H3A A;  1X81 B;  2F0Y B;  2GOX A;  4MU9 A;  1GSZ A;  3DSU B;  2XQW A;  2V8K A;  1FT1 B;  5AGD A;  1HZF A;  1N94 B; 
#chains in the Genus database with same CATH topology
 3M73 A;  1FAE A;  1N7R A;  4MMI A;  5FOB B;  4DOD A;  4OZW A;  2D8L A;  3HXF B;  3HXD B;  4FJQ A;  1KRE A;  4LIX A;  1NC5 A;  1HCU A;  1FP3 A;  1IS9 A;  2B39 A;  3NFV A;  1N4P B;  4ZG8 A;  1H3B A;  3RRS A;  3W5M A;  3QXF A;  3QT3 A;  4LNV A;  4AYQ A;  4V1R A;  5JMD A;  2YIK A;  1FO3 A;  1O1R B;  2I07 B;  3DSS B;  4ZRP A;  1VD5 A;  1TNB B;  2CQS A;  1W3Y A;  3SQC A;  3PZ4 B;  2EAE A;  4EHM B;  2ZIR B;  2JF4 A;  3T33 A;  4D4D A;  1N21 A;  1GHQ A;  3KQ4 A;  4GTM B;  1JCQ B;  4FXK B;  3M00 A;  3WIQ A;  2FBA A;  3SDR A;  3PZ3 B;  3W7S A;  1MZC B;  2EAD A;  4AYR A;  1WU4 A;  2FV0 A;  1N7O A;  1OJO A;  3N0G A;  3Q75 B;  3ACT A;  2BBC A;  1H3C A;  3PMM A;  3DPY B;  3M77 A;  2H6G B;  4AYO A;  3ANK A;  1N20 A;  3Q7F B;  1KSD A;  4FNV A;  2CQT A;  4Q88 A;  4AYP A;  1O79 A;  1HM3 A;  2ONH A;  4D94 A;  2DRO A;  3K7X A;  2XFG A;  3A3V A;  4MBG B;  3Q73 B;  3EU5 B;  1QBQ B;  1XWT A;  3N0F A;  5E2J A;  2B4F A;  1X1I A;  5JPM B;  4F10 A;  2VN4 A;  3E32 B;  1FO2 A;  2DRR A;  1AYX A;  1UT9 A;  2ONG A;  5MEH A;  3E37 B;  1DOG A;  3ANJ A;  1V7V A;  3SDT A;  3W7U A;  3DSU B;  3PYB A;  3ON6 A;  1H12 A;  2V8K A;  1RQ5 A;  3QDE A;  4WVC A;  5GW7 A;  1HMU A;  2J5C A;  3WIR A;  1CLC A;  2OKX A;  1N22 A;  3H3K A;  3VSM A;  1FBO A;  5IKA A;  1CB8 A;  2SQC A;  4GTV B;  1GAI A;  2IEJ B;  2BB6 A;  2JG0 A;  4KTP A;  1LXK A;  5IKH A;  5KKB A;  3ANI A;  1N7P A;  1NXC A;  3QXQ A;  2G02 A;  1LOH A;  3RX5 A;  1XWQ A;  3WIW A;  1TNY B;  5FO8 B;  5DHI A;  2R2L B;  2RI8 A;  3D5R A;  3RSY A;  3M76 A;  2AHF A;  4MMH A;  3VW5 A;  4GTS B;  4KTR A;  5ILJ A;  3DSV B;  1KRF A;  3M7L A;  3M72 A;  2FV1 A;  4RNQ A;  2V8J A;  1KWF A;  3SFX B;  3HXE B;  1N4Q B;  3QFZ A;  1GLM A;  2FUQ A;  1H35 A;  3S4C A;  1KFG A;  2RI9 A;  1H14 A;  1G9J A;  5DHK A;  1N95 B;  1LF6 A;  2ZBL A;  5ILI A;  4ZRQ A;  4GL3 A;  3SDV A;  3W7X A;  1X1H A;  1XW2 A;  4CJ0 A;  4KKJ A;  5DGQ A;  4D4C A;  1TNU B;  1FCE A;  3A0O A;  3S4B A;  1GXO A;  2NOJ A;  3DST B;  1LD8 B;  4OK4 A;  5DGR A;  2GZ6 A;  4L9P B;  1FBW A;  1CEM A;  1KZP B;  1N24 A;  1N7N A;  4TXT A;  4YDO B;  3VXD A;  1F9G A;  3SFY B;  1GXM A;  3ACS A;  2PN5 A;  3QFY A;  4J5T A;  1TNZ B;  1OJP A;  2A8Z A;  4FUS A;  1H54 A;  1WU5 A;  1UG9 A;  1SQC A;  4DOE A;  1GXN A;  1TN8 B;  3WC3 A;  2G0D A;  4OZV A;  1TN7 B;  1RW9 A;  1O5M B;  1TF4 A;  4GTP B;  3M7B A;  4XUV A;  3H2W A;  3S4A A;  4GTR B;  1N1B A;  1X1J A;  4GTQ B;  1ULV A;  5GY3 A;  1RWG A;  3PZ1 B;  1H3A A;  1WZZ A;  1HV6 A;  2NVP A;  1GSZ A;  2DRQ A;  3S4D A;  2XQW A;  2Z07 A;  4YCR A;  1HZF A;  1D8D B;  1G9G A;  5ILY A;  3Q78 B;  2PMV A;  1FT2 B;  2V3N A;  1N4R B;  1O6R A;  5ILZ A;  5CD2 A;  4D4A A;  3M7E A;  2RGK A;  1V7W A;  4BOJ A;  2AFA A;  3M74 A;  2E24 A;  1G6I A;  1EGU A;  1JCR B;  5JMF A;  1O6H A;  4Z4L A;  3M75 A;  4L6X A;  4Q2B A;  3WKI A;  1OJN A;  5JPN B;  1JS4 A;  2XWJ B;  1L2A A;  1TN6 B;  3C72 B;  1NL4 B;  1S63 B;  1IA7 A;  1RWC A;  1DCE B;  1RWF A;  4ZH5 A;  4Z4J A;  4QT9 A;  5CA3 A;  3SAE A;  4D4B A;  2EAC A;  2FUZ A;  3E30 B;  1JCS B;  3P2C A;  2XWB B;  3G6J B;  2V3P A;  4KKI A;  2ZIS B;  2WYN A;  3RJ3 A;  1HN0 A;  4CE7 A;  3KSL B;  1QSJ A;  1RWA A;  1GA2 A;  3K11 A;  1H39 A;  3CIH A;  2WCO A;  3QRY A;  3GLY A;  3QG0 A;  3W5N A;  4TF4 A;  1UMP A;  5FO7 B;  3QPF A;  4DI5 A;  2AHG A;  3OED A;  3M78 A;  3WUX A;  1F1S A;  1HXC A;  3W7T A;  5IM1 A;  3E34 B;  2A73 B;  3QWT A;  1GAH A;  1HMW A;  2BRW A;  2H6F B;  2FUT A;  3NNB A;  4E1Y A;  1KSC A;  3EZ8 A;  2DRS A;  1QAZ A;  3AFJ A;  4V1S A;  5FO9 B;  4YDE B;  1N4S B;  3E80 A;  1HXA A;  2WIN B;  3LZ9 A;  2BRV X;  1RWH A;  1N7Q A;  1L1Y A;  1IA6 A;  3TF4 A;  2QNO A;  4GTT B;  1N23 A;  2WII B;  3S9V A;  3D3I A;  1X9D A;  3WKH A;  2F6D A;  1AGM A;  5GZK A;  1N1Z A;  1F9O A;  1D8E B;  5IK9 A;  5ILK A;  1X81 B;  1H13 A;  2Q1F A;  3H7L A;  4NEI A;  3EQA A;  3W7W A;  1V7X A;  1F9D A;  1HM2 A;  1FT1 B;  2BRP A;  5AGD A;  1N94 B;  4ZH1 A;  3E33 B;  3EUV B;  1R76 A;  2JJB A;  5C05 A;  3DRA B;  1O1T B;  2H6H B;  4OJZ A;  3KLS A;  1KKT A;  3RX7 A;  5ILH A;  3SDU A;  1KZO B;  2D5J A;  1LXM A;  4C1S A;  3GT5 A;  3DSX B;  1TNO B;  1O1S B;  1O6Q A;  3M01 A;  3M7C A;  2P0V A;  3G4D A;  3QT9 A;  4LNG B;  3AFL A;  1NI1 B;  1V5C A;  4GAX A;  1FPP B;  3DSW B;  4M76 A;  3GZK A;  4JJJ A;  1W6J A;  3M02 A;  5EAT A;  3REN A;  3HXC B;  1H36 A;  2WY7 A;  3SDQ A;  3G4F A;  5M7Y A;  2GH4 A;  4WVA A;  1DL2 A;  1C3D A;  2BB5 A;  2EAB A;  1HX9 A;  3KSQ B;  4OK2 A;  1I8Q A;  1HXG A;  2VN7 A;  3RX8 A;  1G87 A;  4LNB B;  2V8I A;  1LTX B;  4L0G A;  3WKG A;  1KS8 A;  1S64 B;  3M71 A;  4EL8 A;  2E22 A;  4CJ1 A;  1LF9 A;  1SA5 B;  3P5R A;  3VSN A;  1SA4 B;  4GTO B;  3Q7A B;  2WDA A;  3PZ2 B;  3D5S A;  4WU0 A;  1N9A B;  1C82 A;  3OXU A;  3E73 A;  3HXB B;  5M7I A;  4F13 A;  3E6U A;  3X17 A;  3QSP A;  3CU7 A;  1H37 A;  2BED B;  3P5P A;  3Q79 B;  5ILD A;  1WU6 A;  3WKF A;  2H6I B;  5IK0 A;  5IK6 A;  1K72 A;  1LD7 B;  3PYA A;  1J0M A;  4FXG B;  1V5D A;  4BOK A;  1QQF A;  4ONT A;  1J0N A;  1OJM A;  1W6K A;  4WVB A;  2WY8 A;  3EU8 A;  2F0Y B;  5EAU A;  5IL8 A;  2GOX A;  4MU9 A;  1FMI A;  5EAS A;  3E7J A;  5CZL A;  2X03 A;  2ZZR A;  5IL3 A; 
#chains in the Genus database with same CATH homology
 3M73 A;  1FAE A;  5FOB B;  4DOD A;  2D8L A;  3HXF B;  3HXD B;  4LIX A;  1KRE A;  1NC5 A;  1HCU A;  1FP3 A;  1IS9 A;  2B39 A;  4ZG8 A;  1N4P B;  1H3B A;  3RRS A;  3W5M A;  3QXF A;  3QT3 A;  4LNV A;  4AYQ A;  4V1R A;  2YIK A;  1FO3 A;  1O1R B;  2I07 B;  3DSS B;  4ZRP A;  1VD5 A;  1TNB B;  2CQS A;  3SQC A;  3PZ4 B;  2EAE A;  4EHM B;  2ZIR B;  2JF4 A;  3T33 A;  4D4D A;  1GHQ A;  3KQ4 A;  4GTM B;  1JCQ B;  4FXK B;  3WIQ A;  2FBA A;  3SDR A;  3PZ3 B;  3W7S A;  1MZC B;  2EAD A;  4AYR A;  1WU4 A;  2FV0 A;  3Q75 B;  3ACT A;  2BBC A;  1H3C A;  3PMM A;  3DPY B;  3M77 A;  2H6G B;  4AYO A;  3ANK A;  3Q7F B;  1KSD A;  4Q88 A;  2CQT A;  4AYP A;  1O79 A;  4D94 A;  2DRO A;  3K7X A;  2XFG A;  3A3V A;  4MBG B;  3Q73 B;  3EU5 B;  1QBQ B;  1XWT A;  5E2J A;  2B4F A;  5JPM B;  2VN4 A;  3E32 B;  1FO2 A;  2DRR A;  1AYX A;  1UT9 A;  5MEH A;  3E37 B;  1DOG A;  3ANJ A;  1V7V A;  3SDT A;  3W7U A;  3DSU B;  3PYB A;  3ON6 A;  1H12 A;  2V8K A;  1RQ5 A;  3QDE A;  4WVC A;  5GW7 A;  3WIR A;  1CLC A;  2OKX A;  3H3K A;  1FBO A;  2SQC A;  4GTV B;  1GAI A;  2IEJ B;  2BB6 A;  2JG0 A;  4KTP A;  5KKB A;  3ANI A;  1NXC A;  3QXQ A;  2G02 A;  3RX5 A;  1XWQ A;  3WIW A;  1TNY B;  5FO8 B;  2R2L B;  2RI8 A;  3D5R A;  3RSY A;  3M76 A;  2AHF A;  3VW5 A;  4GTS B;  4KTR A;  3DSV B;  1KRF A;  3M7L A;  3M72 A;  2FV1 A;  2V8J A;  1KWF A;  3SFX B;  3HXE B;  1N4Q B;  3QFZ A;  1GLM A;  1H35 A;  3S4C A;  1KFG A;  2RI9 A;  1H14 A;  1G9J A;  1N95 B;  1LF6 A;  2ZBL A;  4ZRQ A;  4GL3 A;  3SDV A;  3W7X A;  1XW2 A;  4CJ0 A;  4KKJ A;  5DGQ A;  4D4C A;  1TNU B;  1FCE A;  3S4B A;  1GXO A;  2NOJ A;  3DST B;  1LD8 B;  5DGR A;  2GZ6 A;  4L9P B;  1FBW A;  1CEM A;  1KZP B;  4TXT A;  4YDO B;  3VXD A;  3SFY B;  1GXM A;  3ACS A;  2PN5 A;  3QFY A;  4J5T A;  1TNZ B;  2A8Z A;  4FUS A;  1H54 A;  1WU5 A;  1UG9 A;  1SQC A;  4DOE A;  1GXN A;  1TN8 B;  3WC3 A;  2G0D A;  1TN7 B;  1O5M B;  1TF4 A;  4GTP B;  3M7B A;  4XUV A;  3H2W A;  3S4A A;  4GTR B;  4GTQ B;  1ULV A;  5GY3 A;  3PZ1 B;  1H3A A;  1WZZ A;  2NVP A;  1GSZ A;  2DRQ A;  3S4D A;  2XQW A;  2Z07 A;  4YCR A;  1HZF A;  1D8D B;  1G9G A;  3Q78 B;  2PMV A;  1FT2 B;  2V3N A;  1N4R B;  1O6R A;  5CD2 A;  4D4A A;  3M7E A;  2RGK A;  1V7W A;  4BOJ A;  2AFA A;  3M74 A;  1G6I A;  1JCR B;  1O6H A;  4Z4L A;  3M75 A;  4L6X A;  4Q2B A;  3WKI A;  5JPN B;  1JS4 A;  2XWJ B;  1L2A A;  1TN6 B;  3C72 B;  1NL4 B;  1S63 B;  1IA7 A;  1DCE B;  4ZH5 A;  4Z4J A;  4QT9 A;  5CA3 A;  3SAE A;  4D4B A;  2EAC A;  2FUZ A;  3E30 B;  1JCS B;  3P2C A;  2XWB B;  3G6J B;  2V3P A;  4KKI A;  2ZIS B;  2WYN A;  3RJ3 A;  4CE7 A;  3KSL B;  1QSJ A;  1GA2 A;  3K11 A;  1H39 A;  3CIH A;  3QRY A;  3GLY A;  3QG0 A;  3W5N A;  4TF4 A;  1UMP A;  5FO7 B;  3QPF A;  2AHG A;  3OED A;  3M78 A;  3WUX A;  3W7T A;  3E34 B;  2A73 B;  3QWT A;  1GAH A;  2H6F B;  1KSC A;  3EZ8 A;  2DRS A;  3AFJ A;  4V1S A;  5FO9 B;  4YDE B;  1N4S B;  2WIN B;  1L1Y A;  1IA6 A;  3TF4 A;  2QNO A;  4GTT B;  3S9V A;  2WII B;  3WKH A;  3D3I A;  1X9D A;  2F6D A;  1AGM A;  5GZK A;  1F9O A;  1D8E B;  1X81 B;  1H13 A;  3H7L A;  3EQA A;  3W7W A;  1V7X A;  1F9D A;  1FT1 B;  5AGD A;  1N94 B;  4ZH1 A;  3E33 B;  3EUV B;  1R76 A;  2JJB A;  3DRA B;  1O1T B;  2H6H B;  3KLS A;  1KKT A;  3RX7 A;  3SDU A;  1KZO B;  2D5J A;  4C1S A;  3GT5 A;  3DSX B;  1TNO B;  1O1S B;  1O6Q A;  3M7C A;  2P0V A;  3QT9 A;  4LNG B;  1NI1 B;  1V5C A;  1FPP B;  3DSW B;  4M76 A;  3GZK A;  4JJJ A;  1W6J A;  3REN A;  3HXC B;  1H36 A;  2WY7 A;  3SDQ A;  5M7Y A;  2GH4 A;  4WVA A;  1DL2 A;  1C3D A;  2BB5 A;  2EAB A;  3KSQ B;  2VN7 A;  3RX8 A;  1G87 A;  4LNB B;  2V8I A;  1LTX B;  4L0G A;  3WKG A;  1KS8 A;  1S64 B;  3M71 A;  4EL8 A;  4CJ1 A;  1LF9 A;  1SA5 B;  3P5R A;  1SA4 B;  4GTO B;  3Q7A B;  3PZ2 B;  3D5S A;  4WU0 A;  1N9A B;  3OXU A;  3E73 A;  3HXB B;  5M7I A;  3E6U A;  3X17 A;  3QSP A;  1H37 A;  3CU7 A;  2BED B;  3P5P A;  3Q79 B;  1WU6 A;  3WKF A;  2H6I B;  1K72 A;  1LD7 B;  3PYA A;  4FXG B;  1V5D A;  4BOK A;  1QQF A;  4ONT A;  1W6K A;  4WVB A;  2WY8 A;  3EU8 A;  2F0Y B;  2GOX A;  4MU9 A;  1FMI A;  5CZL A;  2ZZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...