3OXUA

Complement components factor h ccp19-20 and c3d in complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
295
structure length
295
Chain Sequence
EFRDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C3
publication title Structural basis for engagement by complement factor H of C3b on a self surface.
pubmed doi rcsb
source organism Homo sapiens
total genus 117
structure length 295
sequence length 295
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3oxuA00
4D4CA 2A73B 4M76A 3KSQB 1O6QA 1NI1B 2R2LB 1D8EB 1LD7B 3Q7AB 4ZH1A 1FPPB 2XWBB 3E33B 4GTVB 2G0DA 1H3AA 1N9AB 2B39A 2GOXA 1HZFA 1KZPB 4MU9A 1O1SB 4EHMB 1N4RB 5JPNB 3Q75B 3Q73B 3DSTB 1X81B 4BOKA 2XQWA 3CU7A 3HXBB 4KKJA 1GHQA 2G02A 4FXKB 4V1SA 2V8IA 5JPMB 3DSXB 4LNVA 1O1RB 1N4QB 1JCQB 3DRAB 3DPYB 3HXEB 1JCRB 1QBQB 4GTOB 2WIIB 4D4AA 2PN5A 1H36A 3OEDA 3DSWB 1O6RA 1O79A 4GTRB 1N4SB 2F0YB 5AGDA 4D4BA 2V3PA 2H6HB 4ZRQA 1H37A 1N4PB 2BB6A 3Q78B 5FO7B 3OXUA 1O6HA 4D94A 1JCSB 4GTTB 4D4DA 3HXCB 2V8JA 1O5MB 3KSLB 3E34B 4GTQB 4GTMB 1FT1B 4C1SA 3HXDB 3KLSA 3D5RA 1TNUB 1QSJA 3PZ1B 1R76A 1GSZA 2XWJB 3SFYB 4YDEB 3Q79B 3Q7FB 1DCEB 1MZCB 3DSVB 1TN7B 3DSSB 3HXFB 4BOJA 3E37B 5FO9B 1NL4B 3PZ3B 3RJ3A 3KQ4A 2V8KA 1GXNA 3DSUB 1W6KA 1GXMA 5FOBB 2WY8A 2WINB 1H39A 1TNYB 2H6IB 4LNGB 1TNBB 2ZISB 2V3NA 1KZOB 4L9PB 1LD8B 1QQFA 3PZ4B 3EU5B 2H6GB 4LNBB 1SA5B 3SQCA 1C3DA 1GXOA 1TNOB 1D8DB 1SQCA 1N94B 1TN6B 1H3BA 1TNZB 1FT2B 2ZIRB 4FXGB 4MBGB 4KKIA 2I07B 1S64B 2BB5A 2SQCA 1SA4B 3G6JB 1LTXB 3EUVB 3SFXB 2PMVA 1O1TB 3K7XA 1N95B 2NOJA 3PZ2B 1W6JA 1H3CA 4GTPB 2BEDB 3D5SA 4V1RA 1TN8B 4ONTA 4GTSB 2WY7A 1S63B 2BBCA 5FO8B 3C72B 2H6FB 2IEJB 3E32B 3E30B 4ZRPA 4YDOB 1H35A 1UMPA
chains in the Genus database with same CATH superfamily
4D4CA 3P5RA 3KSQB 3QPFA 4LIXA 3P5PA 3M73A 3SAEA 1G9GA 4FJQA 4Q2BA 3QSPA 3X17A 1RWHA 2BRVX 2ZBLA 1N7QA 1KS8A 2B39A 3RENA 3QFZA 2DRRA 1X1IA 1HZFA 1KZPB 2Q1FA 3EZ8A 3QWTA 1ULVA 5JPNB 3DSTB 2XQWA 3M7LA 3VSNA 1HM3A 1GAIA 1FBOA 3M7CA 3E7JA 1G87A 1O1RB 1N4QB 1VD5A 1V7XA 3HXEB 3PYAA 2FV0A 1C82A 2PN5A 3S4AA 3WKHA 3ANKA 1XWQA 3QT3A 1O6RA 2WYNA 1FBWA 3M00A 3TF4A 1N4SB 1CLCA 2V3PA 2H6HB 1N4PB 2FUQA 3M71A 3OXUA 1X9DA 2P0VA 4D94A 2RI8A 4GTTB 4D4DA 1N24A 4ZG8A 3W5MA 1RWCA 2GH4A 2EABA 3KSLB 1N7NA 2GZ6A 3PZ1B 4CE7A 1V5DA 1GSZA 2XWJB 1HXCA 3A3VA 3ANJA 1HXAA 3Q7FB 5EASA 3HXFB 3N0FA 3AFJA 4GAXA 3KQ4A 3DSUB 2AHGA 4OZVA 5GZKA 2FUTA 3ANIA 5FOBB 1V7WA 2WINB 3GZKA 2V3NA 1KSDA 1LD8B 1QQFA 1H12A 3EU5B 3WIQA 1GXOA 3H3KA 1SQCA 2BRWA 1H3BA 5EATA 5IK0A 4FXGB 2BB5A 3PYBA 3RX7A 2FUZA 3SDRA 3WKFA 4WU0A 5CA3A 1HN0A 2NOJA 2WDAA 3PZ2B 3M02A 4FUSA 2F6DA 4F13A 3AFLA 1F9DA 1LF9A 5ILZA 1GAHA 3P2CA 2VN4A 1UMPA 4V1SA 2A73B 1J0MA 1N22A 1H14A 2R2LB 5ILDA 4J5TA 5CD2A 3PMMA 4ZH1A 1FPPB 5IL3A 2XWBB 4JJJA 4E1YA 2A8ZA 2BRPA 2GOXA 1WU4A 2X03A 4MU9A 5CZLA 4EHMB 1N4RB 1N21A 1X1JA 3RX5A 3Q73B 3RSYA 4BOKA 4QT9A 1F9GA 1GHQA 1JS4A 1N7PA 4OK2A 1L1YA 1FO3A 2ONHA 3NNBA 1UG9A 1JCRB 1QBQB 5EAUA 2D5JA 4RNQA 3QXFA 3WC3A 1H36A 1RQ5A 1IS9A 1XW2A 1OJNA 3WKGA 2RI9A 1HM2A 4FNVA 4GTRB 3VW5A 2EAEA 5JMFA 2CQSA 5IL8A 3GLYA 1QAZA 1JCSB 2E22A 5ILJA 4WVCA 4AYOA 4OZWA 2V8JA 3E34B 1FT1B 3S4DA 3HXDB 3D5RA 2DRSA 1R76A 3SFYB 1L2AA 2QNOA 5KKBA 1MZCB 4L6XA 4CJ1A 4BOJA 3E37B 1NL4B 3PZ3B 3SDQA 2V8KA 3M76A 1V7VA 1TNYB 1TNBB 1KRFA 1F9OA 3PZ4B 1OJMA 5GY3A 2JF4A 1TN6B 1RWAA 4L0GA 2I07B 1S64B 3W7TA 1KKTA 1FP3A 2SQCA 1SA4B 3EUVB 3SFXB 1LF6A 2PMVA 4NEIA 2RGKA 3H2WA 1O1TB 1I8QA 3K7XA 4GTSB 2WY7A 4DODA 3NFVA 1DL2A 1H35A 3SDVA 5IKAA 1HMWA 1HX9A 2XFGA 4M76A 1NXCA 1O6QA 1NI1B 1HV6A 1D8EB 1LD7B 1RWFA 1V5CA 5JMDA 1W3YA 3E33B 4GTVB 3M78A 2G0DA 3WIRA 1O1SB 4Z4LA 4WVAA 3M01A 3S9VA 2G02A 4FXKB 5C05A 3WIWA 5DHIA 3LZ9A 1H54A 3QXQA 4TF4A 1JCQB 3DPYB 4D4AA 3OEDA 4KTRA 3DSWB 3SDTA 3EQAA 1O79A 3ON6A 1HMUA 2F0YB 4F10A 5AGDA 4D4BA 3S4CA 2ONGA 3Q78B 5FO7B 1KWFA 1K72A 2E24A 3CIHA 3G4DA 3WUXA 5MEHA 1FCEA 1IA7A 3HXCB 3QDEA 4AYPA 4MMHA 4GTMB 4C1SA 3KLSA 1IA6A 5M7YA 3QRYA 3QG0A 4WVBA 3VXDA 5DGQA 1F1SA 1N1ZA 1OJPA 3DSVB 1TN7B 1GLMA 3M7EA 3RJ3A 1GXNA 1W6KA 4ZH5A 4LNGB 2H6IB 4OJZA 1HXGA 2ZISB 1XWTA 3GT5A 3M7BA 2NVPA 4LNBB 1SA5B 3SQCA 1TNOB 1GA2A 4YCRA 1TNZB 1FT2B 2DROA 2ZIRB 4MBGB 4EL8A 3EU8A 3G6JB 3VSMA 1LTXB 4AYQA 1AYXA 4KTPA 2Z07A 1N95B 1W6JA 5ILHA 4V1RA 2EACA 5IK9A 3S4BA 5FO8B 3E32B 3E80A 4YDOB 1FO2A 1G6IA 4DOEA 2CQTA 2FBAA 4CJ0A 1WZZA 3SDUA 1N20A 3Q7AB 1RW9A 1LOHA 3W7SA 1H3AA 1N9AB 3H7LA 3W7XA 3M75A 3M77A 2DRQA 4TXTA 1N23A 3WKIA 3Q75B 1X81B 1EGUA 3CU7A 3HXBB 4KKJA 3K11A 1G9JA 2V8IA 5JPMB 4GL3A 4DI5A 3DSXB 4LNVA 3D3IA 3DRAB 4GTOB 1KREA 1LXMA 2WIIB 3N0GA 1N7OA 4XUVA 1N1BA 3E6UA 2AHFA 2J5CA 5ILYA 5IK6A 4OK4A 4ZRQA 1H37A 2BB6A 1X1HA 1O6HA 3G4FA 2OKXA 1CB8A 3E73A 4GTQB 1O5MB 5ILKA 1RWGA 1OJOA 5ILIA 3W7UA 1TNUB 1QSJA 1KFGA 2JJBA 3RRSA 1WU5A 2ZZRA 2FV1A 3ACSA 3Q79B 4YDEB 1TF4A 1DCEB 1WU6A 1FMIA 3DSSB 2AFAA 5FO9B 1DOGA 2VN7A 3W7WA 1LXKA 5IKHA 1J0NA 4AYRA 2WCOA 2YIKA 1GXMA 5GW7A 2WY8A 1H39A 2EADA 1KSCA 1KZOB 4L9PB 2D8LA 2H6GB 3T33A 1FAEA 3ACTA 1C3DA 4Z4JA 1D8DB 1N94B 5DGRA 3QFYA 3RX8A 3M72A 3A0OA 4KKIA 2JG0A 1UT9A 1N7RA 1H13A 5IM1A 1HCUA 4MMIA 2B4FA 1H3CA 4GTPB 5E2JA 2BEDB 3D5SA 1NC5A 1TN8B 4ONTA 1AGMA 5DHKA 3W5NA 1S63B 2BBCA 3QT9A 1CEMA 3C72B 2H6FB 3M74A 4Q88A 2IEJB 4ZRPA 3E30B 5M7IA
chains in the Genus database with same CATH topology
4D4CA 3P5RA 3KSQB 3QPFA 4LIXA 3P5PA 3M73A 3SAEA 1G9GA 4Q2BA 3QSPA 3X17A 2ZBLA 1KS8A 2B39A 3RENA 3QFZA 2DRRA 1HZFA 1KZPB 3EZ8A 3QWTA 1ULVA 5JPNB 3DSTB 2XQWA 3M7LA 1GAIA 1FBOA 3M7CA 1G87A 1O1RB 1N4QB 1VD5A 1V7XA 3HXEB 3PYAA 2FV0A 2PN5A 3WKHA 3S4AA 3ANKA 1XWQA 3QT3A 1O6RA 2WYNA 1FBWA 3TF4A 1N4SB 1CLCA 2V3PA 2H6HB 1N4PB 3M71A 3OXUA 1X9DA 2P0VA 4D94A 2RI8A 4GTTB 4D4DA 4ZG8A 3W5MA 2GH4A 2EABA 3KSLB 2GZ6A 3PZ1B 4CE7A 1V5DA 1GSZA 2XWJB 3A3VA 3ANJA 3Q7FB 3HXFB 3AFJA 3KQ4A 3DSUB 2AHGA 5GZKA 3ANIA 5FOBB 1V7WA 2WINB 3GZKA 2V3NA 1KSDA 1LD8B 1QQFA 1H12A 3EU5B 3WIQA 1GXOA 3H3KA 1SQCA 1H3BA 4FXGB 2BB5A 3PYBA 3RX7A 2FUZA 3SDRA 3WKFA 4WU0A 5CA3A 2NOJA 3PZ2B 4FUSA 2F6DA 1F9DA 1LF9A 1GAHA 3P2CA 2VN4A 1UMPA 4V1SA 2A73B 1H14A 2R2LB 4J5TA 5CD2A 3PMMA 4ZH1A 1FPPB 2XWBB 4JJJA 2A8ZA 2GOXA 1WU4A 4MU9A 5CZLA 4EHMB 1N4RB 3RX5A 3Q73B 3RSYA 4BOKA 4QT9A 1GHQA 1JS4A 1L1YA 1FO3A 1UG9A 1JCRB 1QBQB 2D5JA 3QXFA 3WC3A 1H36A 1RQ5A 1IS9A 1XW2A 3WKGA 2RI9A 4GTRB 3VW5A 2EAEA 2CQSA 3GLYA 1JCSB 4WVCA 4AYOA 2V8JA 3E34B 1FT1B 3S4DA 3HXDB 3D5RA 2DRSA 1R76A 3SFYB 1L2AA 2QNOA 5KKBA 1MZCB 4L6XA 4CJ1A 4BOJA 3E37B 1NL4B 3PZ3B 3SDQA 2V8KA 3M76A 1V7VA 1TNYB 1TNBB 1KRFA 1F9OA 3PZ4B 5GY3A 2JF4A 1TN6B 4L0GA 2I07B 1S64B 3W7TA 1KKTA 1FP3A 2SQCA 1SA4B 3EUVB 3SFXB 1LF6A 2PMVA 2RGKA 3H2WA 1O1TB 3K7XA 4GTSB 2WY7A 4DODA 1DL2A 1H35A 3SDVA 2XFGA 4M76A 1NXCA 1O6QA 1NI1B 1D8EB 1LD7B 1V5CA 3E33B 4GTVB 3M78A 2G0DA 3WIRA 1O1SB 4Z4LA 4WVAA 3S9VA 2G02A 4FXKB 3WIWA 1H54A 3QXQA 4TF4A 1JCQB 3DPYB 4D4AA 3OEDA 4KTRA 3DSWB 3SDTA 3EQAA 1O79A 3ON6A 2F0YB 5AGDA 4D4BA 3S4CA 3Q78B 5FO7B 1KWFA 1K72A 5MEHA 3CIHA 3WUXA 1FCEA 1IA7A 3HXCB 3QDEA 4AYPA 4GTMB 4C1SA 3KLSA 1IA6A 5M7YA 3QRYA 3QG0A 4WVBA 3VXDA 5DGQA 3DSVB 1TN7B 1GLMA 3M7EA 3RJ3A 1GXNA 1W6KA 4ZH5A 4LNGB 2H6IB 2ZISB 1XWTA 3GT5A 3M7BA 2NVPA 4LNBB 1SA5B 3SQCA 1TNOB 1GA2A 4YCRA 1TNZB 1FT2B 2DROA 2ZIRB 4MBGB 4EL8A 3EU8A 3G6JB 1LTXB 4AYQA 1AYXA 4KTPA 2Z07A 1N95B 1W6JA 4V1RA 2EACA 3S4BA 5FO8B 3E32B 4YDOB 1FO2A 1G6IA 4DOEA 2CQTA 2FBAA 4CJ0A 1WZZA 3SDUA 3Q7AB 3W7SA 1H3AA 1N9AB 3H7LA 3W7XA 3M75A 3M77A 2DRQA 4TXTA 3WKIA 3Q75B 1X81B 3CU7A 3HXBB 4KKJA 3K11A 1G9JA 2V8IA 5JPMB 4GL3A 3DSXB 4LNVA 3D3IA 3DRAB 4GTOB 1KREA 2WIIB 4XUVA 3E6UA 2AHFA 4ZRQA 1H37A 2BB6A 1O6HA 2OKXA 3E73A 4GTQB 1O5MB 3W7UA 1TNUB 1QSJA 1KFGA 2JJBA 3RRSA 1WU5A 2ZZRA 2FV1A 3ACSA 3Q79B 4YDEB 1TF4A 1DCEB 1WU6A 1FMIA 3DSSB 2AFAA 5FO9B 1DOGA 2VN7A 3W7WA 4AYRA 2YIKA 1GXMA 5GW7A 2WY8A 1H39A 2EADA 1KSCA 1KZOB 4L9PB 2D8LA 2H6GB 3T33A 1FAEA 3ACTA 1C3DA 4Z4JA 1D8DB 1N94B 5DGRA 3QFYA 3RX8A 3M72A 4KKIA 2JG0A 1UT9A 1H13A 1HCUA 2B4FA 1H3CA 4GTPB 5E2JA 2BEDB 3D5SA 1NC5A 1TN8B 4ONTA 1AGMA 3W5NA 1S63B 2BBCA 3QT9A 1CEMA 3C72B 2H6FB 3M74A 4Q88A 2IEJB 4ZRPA 3E30B 5M7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4C A;  2A73 B;  4M76 A;  3KSQ B;  1O6Q A;  1NI1 B;  2R2L B;  1D8E B;  1LD7 B;  3Q7A B;  4ZH1 A;  1FPP B;  2XWB B;  3E33 B;  4GTV B;  2G0D A;  1H3A A;  1N9A B;  2B39 A;  2GOX A;  1HZF A;  1KZP B;  4MU9 A;  1O1S B;  4EHM B;  1N4R B;  5JPN B;  3Q75 B;  3Q73 B;  3DST B;  1X81 B;  4BOK A;  2XQW A;  3CU7 A;  3HXB B;  4KKJ A;  1GHQ A;  2G02 A;  4FXK B;  4V1S A;  2V8I A;  5JPM B;  3DSX B;  4LNV A;  1O1R B;  1N4Q B;  1JCQ B;  3DRA B;  3DPY B;  3HXE B;  1JCR B;  1QBQ B;  4GTO B;  2WII B;  4D4A A;  2PN5 A;  1H36 A;  3OED A;  3DSW B;  1O6R A;  1O79 A;  4GTR B;  1N4S B;  2F0Y B;  5AGD A;  4D4B A;  2V3P A;  2H6H B;  4ZRQ A;  1H37 A;  1N4P B;  2BB6 A;  3Q78 B;  5FO7 B;  3OXU A;  1O6H A;  4D94 A;  1JCS B;  4GTT B;  4D4D A;  3HXC B;  2V8J A;  1O5M B;  3KSL B;  3E34 B;  4GTQ B;  4GTM B;  1FT1 B;  4C1S A;  3HXD B;  3KLS A;  3D5R A;  1TNU B;  1QSJ A;  3PZ1 B;  1R76 A;  1GSZ A;  2XWJ B;  3SFY B;  4YDE B;  3Q79 B;  3Q7F B;  1DCE B;  1MZC B;  3DSV B;  1TN7 B;  3DSS B;  3HXF B;  4BOJ A;  3E37 B;  5FO9 B;  1NL4 B;  3PZ3 B;  3RJ3 A;  3KQ4 A;  2V8K A;  1GXN A;  3DSU B;  1W6K A;  1GXM A;  5FOB B;  2WY8 A;  2WIN B;  1H39 A;  1TNY B;  2H6I B;  4LNG B;  1TNB B;  2ZIS B;  2V3N A;  1KZO B;  4L9P B;  1LD8 B;  1QQF A;  3PZ4 B;  3EU5 B;  2H6G B;  4LNB B;  1SA5 B;  3SQC A;  1C3D A;  1GXO A;  1TNO B;  1D8D B;  1SQC A;  1N94 B;  1TN6 B;  1H3B A;  1TNZ B;  1FT2 B;  2ZIR B;  4FXG B;  4MBG B;  4KKI A;  2I07 B;  1S64 B;  2BB5 A;  2SQC A;  1SA4 B;  3G6J B;  1LTX B;  3EUV B;  3SFX B;  2PMV A;  1O1T B;  3K7X A;  1N95 B;  2NOJ A;  3PZ2 B;  1W6J A;  1H3C A;  4GTP B;  2BED B;  3D5S A;  4V1R A;  1TN8 B;  4ONT A;  4GTS B;  2WY7 A;  1S63 B;  2BBC A;  5FO8 B;  3C72 B;  2H6F B;  2IEJ B;  3E32 B;  3E30 B;  4ZRP A;  4YDO B;  1H35 A;  1UMP A; 
#chains in the Genus database with same CATH topology
 4D4C A;  3P5R A;  3KSQ B;  3QPF A;  4LIX A;  3P5P A;  3M73 A;  3SAE A;  1G9G A;  4FJQ A;  4Q2B A;  3QSP A;  3X17 A;  1RWH A;  2BRV X;  2ZBL A;  1N7Q A;  1KS8 A;  2B39 A;  3REN A;  3QFZ A;  2DRR A;  1X1I A;  1HZF A;  1KZP B;  2Q1F A;  3EZ8 A;  3QWT A;  1ULV A;  5JPN B;  3DST B;  2XQW A;  3M7L A;  3VSN A;  1HM3 A;  1GAI A;  1FBO A;  3M7C A;  3E7J A;  1G87 A;  1O1R B;  1N4Q B;  1VD5 A;  1V7X A;  3HXE B;  3PYA A;  2FV0 A;  1C82 A;  2PN5 A;  3S4A A;  3WKH A;  3ANK A;  1XWQ A;  3QT3 A;  1O6R A;  2WYN A;  1FBW A;  3M00 A;  3TF4 A;  1N4S B;  1CLC A;  2V3P A;  2H6H B;  1N4P B;  2FUQ A;  3M71 A;  3OXU A;  1X9D A;  2P0V A;  4D94 A;  2RI8 A;  4GTT B;  4D4D A;  1N24 A;  4ZG8 A;  3W5M A;  1RWC A;  2GH4 A;  2EAB A;  3KSL B;  1N7N A;  2GZ6 A;  3PZ1 B;  4CE7 A;  1V5D A;  1GSZ A;  2XWJ B;  1HXC A;  3A3V A;  3ANJ A;  1HXA A;  3Q7F B;  5EAS A;  3HXF B;  3N0F A;  3AFJ A;  4GAX A;  3KQ4 A;  3DSU B;  2AHG A;  4OZV A;  5GZK A;  2FUT A;  3ANI A;  5FOB B;  1V7W A;  2WIN B;  3GZK A;  2V3N A;  1KSD A;  1LD8 B;  1QQF A;  1H12 A;  3EU5 B;  3WIQ A;  1GXO A;  3H3K A;  1SQC A;  2BRW A;  1H3B A;  5EAT A;  5IK0 A;  4FXG B;  2BB5 A;  3PYB A;  3RX7 A;  2FUZ A;  3SDR A;  3WKF A;  4WU0 A;  5CA3 A;  1HN0 A;  2NOJ A;  2WDA A;  3PZ2 B;  3M02 A;  4FUS A;  2F6D A;  4F13 A;  3AFL A;  1F9D A;  1LF9 A;  5ILZ A;  1GAH A;  3P2C A;  2VN4 A;  1UMP A;  4V1S A;  2A73 B;  1J0M A;  1N22 A;  1H14 A;  2R2L B;  5ILD A;  4J5T A;  5CD2 A;  3PMM A;  4ZH1 A;  1FPP B;  5IL3 A;  2XWB B;  4JJJ A;  4E1Y A;  2A8Z A;  2BRP A;  2GOX A;  1WU4 A;  2X03 A;  4MU9 A;  5CZL A;  4EHM B;  1N4R B;  1N21 A;  1X1J A;  3RX5 A;  3Q73 B;  3RSY A;  4BOK A;  4QT9 A;  1F9G A;  1GHQ A;  1JS4 A;  1N7P A;  4OK2 A;  1L1Y A;  1FO3 A;  2ONH A;  3NNB A;  1UG9 A;  1JCR B;  1QBQ B;  5EAU A;  2D5J A;  4RNQ A;  3QXF A;  3WC3 A;  1H36 A;  1RQ5 A;  1IS9 A;  1XW2 A;  1OJN A;  3WKG A;  2RI9 A;  1HM2 A;  4FNV A;  4GTR B;  3VW5 A;  2EAE A;  5JMF A;  2CQS A;  5IL8 A;  3GLY A;  1QAZ A;  1JCS B;  2E22 A;  5ILJ A;  4WVC A;  4AYO A;  4OZW A;  2V8J A;  3E34 B;  1FT1 B;  3S4D A;  3HXD B;  3D5R A;  2DRS A;  1R76 A;  3SFY B;  1L2A A;  2QNO A;  5KKB A;  1MZC B;  4L6X A;  4CJ1 A;  4BOJ A;  3E37 B;  1NL4 B;  3PZ3 B;  3SDQ A;  2V8K A;  3M76 A;  1V7V A;  1TNY B;  1TNB B;  1KRF A;  1F9O A;  3PZ4 B;  1OJM A;  5GY3 A;  2JF4 A;  1TN6 B;  1RWA A;  4L0G A;  2I07 B;  1S64 B;  3W7T A;  1KKT A;  1FP3 A;  2SQC A;  1SA4 B;  3EUV B;  3SFX B;  1LF6 A;  2PMV A;  4NEI A;  2RGK A;  3H2W A;  1O1T B;  1I8Q A;  3K7X A;  4GTS B;  2WY7 A;  4DOD A;  3NFV A;  1DL2 A;  1H35 A;  3SDV A;  5IKA A;  1HMW A;  1HX9 A;  2XFG A;  4M76 A;  1NXC A;  1O6Q A;  1NI1 B;  1HV6 A;  1D8E B;  1LD7 B;  1RWF A;  1V5C A;  5JMD A;  1W3Y A;  3E33 B;  4GTV B;  3M78 A;  2G0D A;  3WIR A;  1O1S B;  4Z4L A;  4WVA A;  3M01 A;  3S9V A;  2G02 A;  4FXK B;  5C05 A;  3WIW A;  5DHI A;  3LZ9 A;  1H54 A;  3QXQ A;  4TF4 A;  1JCQ B;  3DPY B;  4D4A A;  3OED A;  4KTR A;  3DSW B;  3SDT A;  3EQA A;  1O79 A;  3ON6 A;  1HMU A;  2F0Y B;  4F10 A;  5AGD A;  4D4B A;  3S4C A;  2ONG A;  3Q78 B;  5FO7 B;  1KWF A;  1K72 A;  2E24 A;  3CIH A;  3G4D A;  3WUX A;  5MEH A;  1FCE A;  1IA7 A;  3HXC B;  3QDE A;  4AYP A;  4MMH A;  4GTM B;  4C1S A;  3KLS A;  1IA6 A;  5M7Y A;  3QRY A;  3QG0 A;  4WVB A;  3VXD A;  5DGQ A;  1F1S A;  1N1Z A;  1OJP A;  3DSV B;  1TN7 B;  1GLM A;  3M7E A;  3RJ3 A;  1GXN A;  1W6K A;  4ZH5 A;  4LNG B;  2H6I B;  4OJZ A;  1HXG A;  2ZIS B;  1XWT A;  3GT5 A;  3M7B A;  2NVP A;  4LNB B;  1SA5 B;  3SQC A;  1TNO B;  1GA2 A;  4YCR A;  1TNZ B;  1FT2 B;  2DRO A;  2ZIR B;  4MBG B;  4EL8 A;  3EU8 A;  3G6J B;  3VSM A;  1LTX B;  4AYQ A;  1AYX A;  4KTP A;  2Z07 A;  1N95 B;  1W6J A;  5ILH A;  4V1R A;  2EAC A;  5IK9 A;  3S4B A;  5FO8 B;  3E32 B;  3E80 A;  4YDO B;  1FO2 A;  1G6I A;  4DOE A;  2CQT A;  2FBA A;  4CJ0 A;  1WZZ A;  3SDU A;  1N20 A;  3Q7A B;  1RW9 A;  1LOH A;  3W7S A;  1H3A A;  1N9A B;  3H7L A;  3W7X A;  3M75 A;  3M77 A;  2DRQ A;  4TXT A;  1N23 A;  3WKI A;  3Q75 B;  1X81 B;  1EGU A;  3CU7 A;  3HXB B;  4KKJ A;  3K11 A;  1G9J A;  2V8I A;  5JPM B;  4GL3 A;  4DI5 A;  3DSX B;  4LNV A;  3D3I A;  3DRA B;  4GTO B;  1KRE A;  1LXM A;  2WII B;  3N0G A;  1N7O A;  4XUV A;  1N1B A;  3E6U A;  2AHF A;  2J5C A;  5ILY A;  5IK6 A;  4OK4 A;  4ZRQ A;  1H37 A;  2BB6 A;  1X1H A;  1O6H A;  3G4F A;  2OKX A;  1CB8 A;  3E73 A;  4GTQ B;  1O5M B;  5ILK A;  1RWG A;  1OJO A;  5ILI A;  3W7U A;  1TNU B;  1QSJ A;  1KFG A;  2JJB A;  3RRS A;  1WU5 A;  2ZZR A;  2FV1 A;  3ACS A;  3Q79 B;  4YDE B;  1TF4 A;  1DCE B;  1WU6 A;  1FMI A;  3DSS B;  2AFA A;  5FO9 B;  1DOG A;  2VN7 A;  3W7W A;  1LXK A;  5IKH A;  1J0N A;  4AYR A;  2WCO A;  2YIK A;  1GXM A;  5GW7 A;  2WY8 A;  1H39 A;  2EAD A;  1KSC A;  1KZO B;  4L9P B;  2D8L A;  2H6G B;  3T33 A;  1FAE A;  3ACT A;  1C3D A;  4Z4J A;  1D8D B;  1N94 B;  5DGR A;  3QFY A;  3RX8 A;  3M72 A;  3A0O A;  4KKI A;  2JG0 A;  1UT9 A;  1N7R A;  1H13 A;  5IM1 A;  1HCU A;  4MMI A;  2B4F A;  1H3C A;  4GTP B;  5E2J A;  2BED B;  3D5S A;  1NC5 A;  1TN8 B;  4ONT A;  1AGM A;  5DHK A;  3W5N A;  1S63 B;  2BBC A;  3QT9 A;  1CEM A;  3C72 B;  2H6F B;  3M74 A;  4Q88 A;  2IEJ B;  4ZRP A;  3E30 B;  5M7I A; 
#chains in the Genus database with same CATH homology
 4D4C A;  3P5R A;  3KSQ B;  3QPF A;  4LIX A;  3P5P A;  3M73 A;  3SAE A;  1G9G A;  4Q2B A;  3QSP A;  3X17 A;  2ZBL A;  1KS8 A;  2B39 A;  3REN A;  3QFZ A;  2DRR A;  1HZF A;  1KZP B;  3EZ8 A;  3QWT A;  1ULV A;  5JPN B;  3DST B;  2XQW A;  3M7L A;  1GAI A;  1FBO A;  3M7C A;  1G87 A;  1O1R B;  1N4Q B;  1VD5 A;  1V7X A;  3HXE B;  3PYA A;  2FV0 A;  2PN5 A;  3WKH A;  3S4A A;  3ANK A;  1XWQ A;  3QT3 A;  1O6R A;  2WYN A;  1FBW A;  3TF4 A;  1N4S B;  1CLC A;  2V3P A;  2H6H B;  1N4P B;  3M71 A;  3OXU A;  1X9D A;  2P0V A;  4D94 A;  2RI8 A;  4GTT B;  4D4D A;  4ZG8 A;  3W5M A;  2GH4 A;  2EAB A;  3KSL B;  2GZ6 A;  3PZ1 B;  4CE7 A;  1V5D A;  1GSZ A;  2XWJ B;  3A3V A;  3ANJ A;  3Q7F B;  3HXF B;  3AFJ A;  3KQ4 A;  3DSU B;  2AHG A;  5GZK A;  3ANI A;  5FOB B;  1V7W A;  2WIN B;  3GZK A;  2V3N A;  1KSD A;  1LD8 B;  1QQF A;  1H12 A;  3EU5 B;  3WIQ A;  1GXO A;  3H3K A;  1SQC A;  1H3B A;  4FXG B;  2BB5 A;  3PYB A;  3RX7 A;  2FUZ A;  3SDR A;  3WKF A;  4WU0 A;  5CA3 A;  2NOJ A;  3PZ2 B;  4FUS A;  2F6D A;  1F9D A;  1LF9 A;  1GAH A;  3P2C A;  2VN4 A;  1UMP A;  4V1S A;  2A73 B;  1H14 A;  2R2L B;  4J5T A;  5CD2 A;  3PMM A;  4ZH1 A;  1FPP B;  2XWB B;  4JJJ A;  2A8Z A;  2GOX A;  1WU4 A;  4MU9 A;  5CZL A;  4EHM B;  1N4R B;  3RX5 A;  3Q73 B;  3RSY A;  4BOK A;  4QT9 A;  1GHQ A;  1JS4 A;  1L1Y A;  1FO3 A;  1UG9 A;  1JCR B;  1QBQ B;  2D5J A;  3QXF A;  3WC3 A;  1H36 A;  1RQ5 A;  1IS9 A;  1XW2 A;  3WKG A;  2RI9 A;  4GTR B;  3VW5 A;  2EAE A;  2CQS A;  3GLY A;  1JCS B;  4WVC A;  4AYO A;  2V8J A;  3E34 B;  1FT1 B;  3S4D A;  3HXD B;  3D5R A;  2DRS A;  1R76 A;  3SFY B;  1L2A A;  2QNO A;  5KKB A;  1MZC B;  4L6X A;  4CJ1 A;  4BOJ A;  3E37 B;  1NL4 B;  3PZ3 B;  3SDQ A;  2V8K A;  3M76 A;  1V7V A;  1TNY B;  1TNB B;  1KRF A;  1F9O A;  3PZ4 B;  5GY3 A;  2JF4 A;  1TN6 B;  4L0G A;  2I07 B;  1S64 B;  3W7T A;  1KKT A;  1FP3 A;  2SQC A;  1SA4 B;  3EUV B;  3SFX B;  1LF6 A;  2PMV A;  2RGK A;  3H2W A;  1O1T B;  3K7X A;  4GTS B;  2WY7 A;  4DOD A;  1DL2 A;  1H35 A;  3SDV A;  2XFG A;  4M76 A;  1NXC A;  1O6Q A;  1NI1 B;  1D8E B;  1LD7 B;  1V5C A;  3E33 B;  4GTV B;  3M78 A;  2G0D A;  3WIR A;  1O1S B;  4Z4L A;  4WVA A;  3S9V A;  2G02 A;  4FXK B;  3WIW A;  1H54 A;  3QXQ A;  4TF4 A;  1JCQ B;  3DPY B;  4D4A A;  3OED A;  4KTR A;  3DSW B;  3SDT A;  3EQA A;  1O79 A;  3ON6 A;  2F0Y B;  5AGD A;  4D4B A;  3S4C A;  3Q78 B;  5FO7 B;  1KWF A;  1K72 A;  5MEH A;  3CIH A;  3WUX A;  1FCE A;  1IA7 A;  3HXC B;  3QDE A;  4AYP A;  4GTM B;  4C1S A;  3KLS A;  1IA6 A;  5M7Y A;  3QRY A;  3QG0 A;  4WVB A;  3VXD A;  5DGQ A;  3DSV B;  1TN7 B;  1GLM A;  3M7E A;  3RJ3 A;  1GXN A;  1W6K A;  4ZH5 A;  4LNG B;  2H6I B;  2ZIS B;  1XWT A;  3GT5 A;  3M7B A;  2NVP A;  4LNB B;  1SA5 B;  3SQC A;  1TNO B;  1GA2 A;  4YCR A;  1TNZ B;  1FT2 B;  2DRO A;  2ZIR B;  4MBG B;  4EL8 A;  3EU8 A;  3G6J B;  1LTX B;  4AYQ A;  1AYX A;  4KTP A;  2Z07 A;  1N95 B;  1W6J A;  4V1R A;  2EAC A;  3S4B A;  5FO8 B;  3E32 B;  4YDO B;  1FO2 A;  1G6I A;  4DOE A;  2CQT A;  2FBA A;  4CJ0 A;  1WZZ A;  3SDU A;  3Q7A B;  3W7S A;  1H3A A;  1N9A B;  3H7L A;  3W7X A;  3M75 A;  3M77 A;  2DRQ A;  4TXT A;  3WKI A;  3Q75 B;  1X81 B;  3CU7 A;  3HXB B;  4KKJ A;  3K11 A;  1G9J A;  2V8I A;  5JPM B;  4GL3 A;  3DSX B;  4LNV A;  3D3I A;  3DRA B;  4GTO B;  1KRE A;  2WII B;  4XUV A;  3E6U A;  2AHF A;  4ZRQ A;  1H37 A;  2BB6 A;  1O6H A;  2OKX A;  3E73 A;  4GTQ B;  1O5M B;  3W7U A;  1TNU B;  1QSJ A;  1KFG A;  2JJB A;  3RRS A;  1WU5 A;  2ZZR A;  2FV1 A;  3ACS A;  3Q79 B;  4YDE B;  1TF4 A;  1DCE B;  1WU6 A;  1FMI A;  3DSS B;  2AFA A;  5FO9 B;  1DOG A;  2VN7 A;  3W7W A;  4AYR A;  2YIK A;  1GXM A;  5GW7 A;  2WY8 A;  1H39 A;  2EAD A;  1KSC A;  1KZO B;  4L9P B;  2D8L A;  2H6G B;  3T33 A;  1FAE A;  3ACT A;  1C3D A;  4Z4J A;  1D8D B;  1N94 B;  5DGR A;  3QFY A;  3RX8 A;  3M72 A;  4KKI A;  2JG0 A;  1UT9 A;  1H13 A;  1HCU A;  2B4F A;  1H3C A;  4GTP B;  5E2J A;  2BED B;  3D5S A;  1NC5 A;  1TN8 B;  4ONT A;  1AGM A;  3W5N A;  1S63 B;  2BBC A;  3QT9 A;  1CEM A;  3C72 B;  2H6F B;  3M74 A;  4Q88 A;  2IEJ B;  4ZRP A;  3E30 B;  5M7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...