1QQFA

N-terminally truncated c3d,g fragment of the complement system
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
276
structure length
276
Chain Sequence
GEQNMIGMTPTVIAVHYLDQTEQWEKFGLEKRQEALELIKKGYTQQLAFKQPISAYAAFNNRPPSTWLTAYVSRVFSLAANLIAIDSQVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNTKEADVSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYLEASYLNLQRPYTVAIAGYALALMNKLEEPYLTKFLNTAKDRNRWEEPGQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNDERYYGGGYGSTQATFMVFQALAQYRADV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords PROTEIN (COMPLEMENT C3DG)
publication title Structure at 1.44 A resolution of an N-terminally truncated form of the rat serum complement C3d fragment.
pubmed doi rcsb
total genus 106
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 1999-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1qqfA00
1W6JA 2G0DA 3Q7FB 4LNBB 1TNBB 1GXMA 2PN5A 4KKIA 1QBQB 1O1TB 2BB5A 4BOJA 3HXEB 2H6GB 1H3BA 1SQCA 3EUVB 3DPYB 1SA4B 1H37A 4MBGB 1N4RB 3DSVB 1TN8B 3EU5B 4ZRQA 1O79A 1LTXB 3D5SA 2SQCA 1KZOB 3G6JB 3K7XA 2XWBB 3Q75B 1FT2B 1N94B 1NL4B 2NOJA 3KQ4A 1D8EB 2XQWA 1S63B 1O5MB 2V8IA 4GTQB 1FPPB 3Q73B 2WY8A 3DSUB 1TN6B 4KKJA 4GTRB 3KSLB 5AGDA 4D4BA 4D4DA 4M76A 5JPNB 3E37B 1TN7B 4ONTA 4YDEB 1UMPA 1FT1B 1JCSB 3E30B 4YDOB 3PZ4B 4D94A 2WY7A 1S64B 2A73B 4GTSB 1O1SB 3KLSA 1JCRB 1X81B 3E32B 2WIIB 3SFYB 2BB6A 1H3AA 2ZIRB 1LD8B 3OXUA 3Q7AB 1O6RA 1GHQA 4V1RA 4GTVB 4D4CA 1QQFA 3DRAB 3DSTB 4MU9A 1O6HA 1H35A 3HXBB 4GTMB 1QSJA 3Q78B 1O6QA 2H6HB 2IEJB 4V1SA 2ZISB 2G02A 3PZ1B 1R76A 4LNGB 1D8DB 1NI1B 5FOBB 3C72B 1SA5B 3HXCB 1N4SB 1C3DA 2V3NA 3DSXB 1JCQB 1H39A 1N95B 4FXGB 3Q79B 1GXNA 4GTOB 1GXOA 2V3PA 1H3CA 2V8JA 3SQCA 2H6FB 2V8KA 2XWJB 1N9AB 3PZ2B 1TNUB 4D4AA 5FO8B 1GSZA 2I07B 3KSQB 4BOKA 4ZH1A 3PZ3B 4GTTB 1H36A 3DSWB 4C1SA 2BBCA 4EHMB 3SFXB 2R2LB 3HXDB 3DSSB 1TNZB 1MZCB 3RJ3A 2B39A 3E34B 4L9PB 2F0YB 2H6IB 1TNYB 1N4QB 1HZFA 2PMVA 1LD7B 4LNVA 2WINB 1W6KA 1DCEB 2GOXA 4ZRPA 3D5RA 4FXKB 3E33B 5FO7B 5FO9B 4GTPB 1KZPB 5JPMB 3OEDA 1O1RB 1N4PB 1TNOB 3CU7A 2BEDB 3HXFB
chains in the Genus database with same CATH superfamily
3EU8A 2FBAA 3E80A 3M71A 1N7OA 1J0NA 4MMHA 1N21A 4Q2BA 4BOJA 3S4AA 1FP3A 4OZWA 3AFJA 2AFAA 1SQCA 3RENA 4OK4A 3DPYB 1SA4B 3RRSA 4XUVA 2D8LA 3EU5B 1LXKA 1XW2A 1FBOA 3WKIA 5IKAA 1N7RA 5JMFA 4TF4A 4GTQB 1XWTA 3M02A 3QXFA 3SDQA 1F9DA 3WUXA 3M75A 1HXGA 3DSUB 2JJBA 4GTRB 3SDTA 4M76A 4CE7A 1KS8A 1TN7B 4YDEB 1V7WA 4YDOB 3W7TA 3PZ4B 4WVAA 2A73B 1LOHA 4GTSB 4GL3A 1L1YA 1X81B 3W7WA 4DOEA 3E32B 3ANJA 2WIIB 3W7XA 2QNOA 3QSPA 4L0GA 1H3AA 1O6RA 4AYOA 3E6UA 3DSTB 3QFZA 1QAZA 1HM3A 3HXBB 3GT5A 1LF9A 1VD5A 2WDAA 1H13A 2ZISB 4L6XA 5M7IA 1NC5A 1X9DA 1G87A 1LXMA 4LNGB 3VSMA 1AGMA 5FOBB 4KTPA 1HMWA 3DSXB 4F13A 2JF4A 3M01A 1RQ5A 1GXNA 2DRSA 1H3CA 2XWJB 2V8KA 3PZ2B 3W7UA 4D4AA 3VXDA 2I07B 2VN7A 4LIXA 4BOKA 2AHFA 1N7NA 1GAHA 1KSCA 3N0FA 4WVCA 5M7YA 3M78A 4C1SA 5EATA 3HXDB 3RJ3A 1RWAA 1RWHA 2EACA 2B39A 5GY3A 2ONHA 3QPFA 1TNYB 4E1YA 1HZFA 4EL8A 4LNVA 2WINB 4YCRA 4RNQA 5C05A 1N7PA 2CQTA 5FO9B 1KZPB 1O1RB 3CIHA 4CJ0A 1TNOB 3SDVA 1W6JA 3P5PA 3Q7FB 1TNBB 1GXMA 2PN5A 3P2CA 3A3VA 1F9GA 3QT3A 3SAEA 3SDRA 1H3BA 1GA2A 2A8ZA 3EUVB 5ILKA 2EAEA 5ILHA 3P5RA 4OZVA 4WU0A 1N4RB 3RX5A 1TN8B 1KRFA 3WKFA 1KZOB 2XWBB 3W7SA 1WU4A 1FT2B 1N94B 3KQ4A 2XQWA 5DHIA 2E22A 2YIKA 5MEHA 1TN6B 5KKBA 4GAXA 1RWCA 3ANKA 3KSLB 4D4BA 1N24A 4FNVA 3M00A 1IA7A 3WIRA 1UMPA 1OJPA 1JCSB 2WYNA 3E30B 1V7XA 2BB6A 1LD8B 3OXUA 3ACSA 4D4CA 1QQFA 3EQAA 5IK9A 1GAIA 3PMMA 4OJZA 1JS4A 1DL2A 3ON6A 3G4DA 3WKHA 3Q78B 5IKHA 3M7CA 2JG0A 4WVBA 4V1SA 5GZKA 2BRVX 1DOGA 1D8DB 1NI1B 4OK2A 3M76A 3EZ8A 1N4SB 1C3DA 1HN0A 2ZZRA 4FXGB 3Q79B 4JJJA 2FUTA 2V3PA 2F6DA 1N9AB 1RWGA 1TNUB 2DRQA 1HM2A 5IL3A 3T33A 1FAEA 3PZ3B 4GTTB 1CLCA 3QG0A 1TNZB 1W3YA 3M77A 4L9PB 2F0YB 2H6IB 1G9GA 3A0OA 2NVPA 3M7BA 1L2AA 2GOXA 3VW5A 1N4PB 1V5CA 3WIQA 1KKTA 2E24A 4LNBB 5JMDA 1QBQB 1UG9A 2D5JA 1O1TB 3H2WA 2H6GB 3M73A 2AHGA 4FUSA 1H37A 4MBGB 2VN4A 4ZRQA 2FUQA 1O79A 3X17A 1LTXB 3K7XA 3G6JB 3M7EA 3Q75B 1FMIA 1D8EB 1FCEA 1NXCA 1O5MB 3NFVA 1KSDA 1UT9A 3RX7A 3GLYA 3LZ9A 4ONTA 2P0VA 1I8QA 2CQSA 1GLMA 4D94A 2BRPA 3S4CA 3QFYA 3SDUA 3H3KA 3W5NA 1O1SB 3KLSA 3QDEA 5ILZA 1TF4A 3SFYB 1WZZA 2GH4A 3E73A 4V1RA 4GTVB 4MU9A 1XWQA 1O6HA 1H35A 1FO2A 5IL8A 1QSJA 4F10A 2B4FA 2H6HB 2IEJB 3M72A 3PZ1B 1X1JA 2WCOA 5CD2A 1G6IA 1X1IA 3C72B 4J5TA 4GTOB 3SQCA 1OJNA 2V8JA 5DHKA 1RW9A 2J5CA 1HCUA 1CB8A 1C82A 3AFLA 1V7VA 5FO8B 3D3IA 3RX8A 1N20A 4DI5A 1K72A 2BBCA 1WU6A 3SFXB 1WU5A 3QT9A 2R2LB 5ILIA 5IM1A 3QXQA 1MZCB 1HXAA 2XFGA 3W5MA 1KREA 4AYRA 5EAUA 2PMVA 1LD7B 4KTRA 1IA6A 4FXKB 5GW7A 3TF4A 3E33B 4GTPB 3OEDA 2RI9A 1N23A 1H14A 3CU7A 1N22A 5IK0A 2BEDB 5AGDA 3HXFB 2BRWA 2Z07A 2G0DA 4TXTA 1IS9A 3G4FA 2EABA 4KKIA 1KFGA 2BB5A 3HXEB 3K11A 5CZLA 5ILYA 2ONGA 3WKGA 3DSVB 4Z4LA 3ANIA 1G9JA 3D5SA 2SQCA 3ACTA 1NL4B 2NOJA 1OJMA 1S63B 3M7LA 2V8IA 1HV6A 1FPPB 3Q73B 4Q88A 1KWFA 2WY8A 1V5DA 2GZ6A 4KKJA 4ZH5A 1CEMA 4D4DA 5ILJA 1H12A 4ZG8A 1HXCA 5JPNB 3E37B 1FBWA 3WC3A 5E2JA 3S9VA 1LF6A 1F9OA 4Z4JA 1FT1B 5IK6A 2WY7A 3E7JA 1S64B 1JCRB 2FV0A 1F1SA 2ZIRB 3Q7AB 3S4BA 1GHQA 1N7QA 3H7LA 2ZBLA 3DRAB 3RSYA 3WIWA 5EASA 4GTMB 3VSNA 1H54A 1OJOA 2RGKA 1O6QA 5DGRA 2RI8A 4AYQA 3N0GA 4FJQA 1HMUA 2G02A 2OKXA 1R76A 4MMIA 5CA3A 1EGUA 1SA5B 3HXCB 2EADA 2V3NA 1JCQB 1H39A 4CJ1A 1N95B 2DROA 3PYBA 4QT9A 2FV1A 3NNBA 1GXOA 2H6FB 3GZKA 3QWTA 1N1ZA 1ULVA 1GSZA 3KSQB 4NEIA 4ZH1A 1H36A 3DSWB 4EHMB 2Q1FA 3QRYA 3DSSB 3E34B 1RWFA 3M74A 5DGQA 1N4QB 5ILDA 4DODA 2FUZA 1W6KA 1DCEB 4ZRPA 3D5RA 4AYPA 5FO7B 2X03A 1FO3A 1J0MA 5JPMB 1HX9A 2DRRA 1X1HA 3PYAA 3S4DA 1N1BA 1AYXA
chains in the Genus database with same CATH topology
3EU8A 2FBAA 3M71A 4Q2BA 4BOJA 3S4AA 1FP3A 3AFJA 2AFAA 1SQCA 3RENA 3DPYB 1SA4B 3RRSA 4XUVA 2D8LA 3EU5B 1XW2A 1FBOA 3WKIA 4TF4A 4GTQB 1XWTA 3QXFA 3SDQA 1F9DA 3WUXA 3M75A 3DSUB 2JJBA 4GTRB 3SDTA 4M76A 4CE7A 1KS8A 1TN7B 4YDEB 1V7WA 4YDOB 3W7TA 3PZ4B 4WVAA 2A73B 4GTSB 4GL3A 1L1YA 1X81B 3W7WA 4DOEA 3E32B 3ANJA 2WIIB 3W7XA 2QNOA 3QSPA 4L0GA 1H3AA 1O6RA 4AYOA 3E6UA 3DSTB 3QFZA 3HXBB 3GT5A 1LF9A 1VD5A 1H13A 2ZISB 4L6XA 5M7IA 1NC5A 1X9DA 1G87A 4LNGB 1AGMA 5FOBB 4KTPA 3DSXB 2JF4A 1RQ5A 1GXNA 2DRSA 1H3CA 2V8KA 2XWJB 3PZ2B 3W7UA 4D4AA 3VXDA 2I07B 2VN7A 4LIXA 4BOKA 2AHFA 1GAHA 1KSCA 4WVCA 5M7YA 3M78A 4C1SA 3HXDB 3RJ3A 5GY3A 2EACA 2B39A 3QPFA 1TNYB 1HZFA 4EL8A 4LNVA 2WINB 4YCRA 2CQTA 5FO9B 1KZPB 1O1RB 3CIHA 4CJ0A 1TNOB 3SDVA 1W6JA 3P5PA 3Q7FB 1TNBB 1GXMA 2PN5A 3P2CA 3A3VA 3QT3A 3SAEA 3SDRA 1H3BA 1GA2A 2A8ZA 3EUVB 2EAEA 3P5RA 4WU0A 1N4RB 3RX5A 1TN8B 1KRFA 3WKFA 1KZOB 2XWBB 3W7SA 1WU4A 1FT2B 1N94B 3KQ4A 2XQWA 2YIKA 5MEHA 1TN6B 5KKBA 3ANKA 3KSLB 4D4BA 1IA7A 3WIRA 1UMPA 2WYNA 1JCSB 3E30B 1V7XA 2BB6A 1LD8B 3OXUA 3ACSA 4D4CA 1QQFA 3EQAA 1GAIA 3PMMA 1JS4A 1DL2A 3ON6A 3WKHA 3Q78B 3M7CA 2JG0A 4WVBA 4V1SA 5GZKA 1DOGA 1D8DB 1NI1B 3M76A 3EZ8A 1N4SB 1C3DA 2ZZRA 4FXGB 3Q79B 4JJJA 2V3PA 2F6DA 1N9AB 1TNUB 2DRQA 3T33A 1FAEA 3PZ3B 4GTTB 1CLCA 3QG0A 1TNZB 3M77A 4L9PB 2F0YB 2H6IB 1G9GA 2NVPA 3M7BA 1L2AA 2GOXA 3VW5A 1N4PB 1V5CA 3WIQA 1KKTA 4LNBB 1QBQB 1UG9A 2D5JA 1O1TB 3H2WA 2H6GB 3M73A 2AHGA 4FUSA 1H37A 4MBGB 2VN4A 4ZRQA 1O79A 3X17A 1LTXB 3K7XA 3G6JB 3M7EA 3Q75B 1FMIA 1D8EB 1FCEA 1NXCA 1O5MB 1KSDA 1UT9A 3RX7A 3GLYA 4ONTA 2P0VA 2CQSA 1GLMA 4D94A 3S4CA 3QFYA 3SDUA 3H3KA 3W5NA 1O1SB 3KLSA 3QDEA 1TF4A 3SFYB 1WZZA 2GH4A 3E73A 4V1RA 4GTVB 4MU9A 1XWQA 1O6HA 1H35A 1FO2A 1QSJA 2B4FA 2H6HB 2IEJB 3M72A 3PZ1B 5CD2A 1G6IA 3C72B 4J5TA 4GTOB 3SQCA 2V8JA 1HCUA 1V7VA 5FO8B 3D3IA 3RX8A 1K72A 2BBCA 1WU6A 3SFXB 1WU5A 3QT9A 2R2LB 3QXQA 1MZCB 2XFGA 3W5MA 1KREA 4AYRA 2PMVA 1LD7B 4KTRA 1IA6A 4FXKB 5GW7A 3TF4A 3E33B 4GTPB 3OEDA 2RI9A 1H14A 3CU7A 2BEDB 5AGDA 3HXFB 2Z07A 2G0DA 4TXTA 1IS9A 2EABA 4KKIA 1KFGA 2BB5A 3HXEB 3K11A 5CZLA 3WKGA 3DSVB 4Z4LA 3ANIA 1G9JA 3D5SA 2SQCA 3ACTA 1NL4B 2NOJA 1S63B 3M7LA 2V8IA 1FPPB 3Q73B 4Q88A 1KWFA 2WY8A 1V5DA 2GZ6A 4KKJA 4ZH5A 1CEMA 4D4DA 1H12A 4ZG8A 5JPNB 3E37B 1FBWA 3WC3A 5E2JA 3S9VA 1LF6A 1F9OA 4Z4JA 1FT1B 2WY7A 1S64B 1JCRB 2FV0A 2ZIRB 3Q7AB 3S4BA 1GHQA 3H7LA 2ZBLA 3DRAB 3RSYA 3WIWA 4GTMB 1H54A 2RGKA 1O6QA 5DGRA 2RI8A 4AYQA 2G02A 2OKXA 1R76A 5CA3A 1SA5B 3HXCB 2EADA 2V3NA 1JCQB 1H39A 4CJ1A 1N95B 2DROA 3PYBA 4QT9A 2FV1A 1GXOA 2H6FB 3GZKA 3QWTA 1ULVA 1GSZA 3KSQB 4ZH1A 1H36A 3DSWB 4EHMB 3QRYA 3DSSB 3E34B 5DGQA 3M74A 1N4QB 4DODA 2FUZA 1W6KA 1DCEB 4ZRPA 3D5RA 4AYPA 5FO7B 1FO3A 5JPMB 2DRRA 3PYAA 3S4DA 1AYXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6J A;  2G0D A;  3Q7F B;  4LNB B;  1TNB B;  1GXM A;  2PN5 A;  4KKI A;  1QBQ B;  1O1T B;  2BB5 A;  4BOJ A;  3HXE B;  2H6G B;  1H3B A;  1SQC A;  3EUV B;  3DPY B;  1SA4 B;  1H37 A;  4MBG B;  1N4R B;  3DSV B;  1TN8 B;  3EU5 B;  4ZRQ A;  1O79 A;  1LTX B;  3D5S A;  2SQC A;  1KZO B;  3G6J B;  3K7X A;  2XWB B;  3Q75 B;  1FT2 B;  1N94 B;  1NL4 B;  2NOJ A;  3KQ4 A;  1D8E B;  2XQW A;  1S63 B;  1O5M B;  2V8I A;  4GTQ B;  1FPP B;  3Q73 B;  2WY8 A;  3DSU B;  1TN6 B;  4KKJ A;  4GTR B;  3KSL B;  5AGD A;  4D4B A;  4D4D A;  4M76 A;  5JPN B;  3E37 B;  1TN7 B;  4ONT A;  4YDE B;  1UMP A;  1FT1 B;  1JCS B;  3E30 B;  4YDO B;  3PZ4 B;  4D94 A;  2WY7 A;  1S64 B;  2A73 B;  4GTS B;  1O1S B;  3KLS A;  1JCR B;  1X81 B;  3E32 B;  2WII B;  3SFY B;  2BB6 A;  1H3A A;  2ZIR B;  1LD8 B;  3OXU A;  3Q7A B;  1O6R A;  1GHQ A;  4V1R A;  4GTV B;  4D4C A;  1QQF A;  3DRA B;  3DST B;  4MU9 A;  1O6H A;  1H35 A;  3HXB B;  4GTM B;  1QSJ A;  3Q78 B;  1O6Q A;  2H6H B;  2IEJ B;  4V1S A;  2ZIS B;  2G02 A;  3PZ1 B;  1R76 A;  4LNG B;  1D8D B;  1NI1 B;  5FOB B;  3C72 B;  1SA5 B;  3HXC B;  1N4S B;  1C3D A;  2V3N A;  3DSX B;  1JCQ B;  1H39 A;  1N95 B;  4FXG B;  3Q79 B;  1GXN A;  4GTO B;  1GXO A;  2V3P A;  1H3C A;  2V8J A;  3SQC A;  2H6F B;  2V8K A;  2XWJ B;  1N9A B;  3PZ2 B;  1TNU B;  4D4A A;  5FO8 B;  1GSZ A;  2I07 B;  3KSQ B;  4BOK A;  4ZH1 A;  3PZ3 B;  4GTT B;  1H36 A;  3DSW B;  4C1S A;  2BBC A;  4EHM B;  3SFX B;  2R2L B;  3HXD B;  3DSS B;  1TNZ B;  1MZC B;  3RJ3 A;  2B39 A;  3E34 B;  4L9P B;  2F0Y B;  2H6I B;  1TNY B;  1N4Q B;  1HZF A;  2PMV A;  1LD7 B;  4LNV A;  2WIN B;  1W6K A;  1DCE B;  2GOX A;  4ZRP A;  3D5R A;  4FXK B;  3E33 B;  5FO7 B;  5FO9 B;  4GTP B;  1KZP B;  5JPM B;  3OED A;  1O1R B;  1N4P B;  1TNO B;  3CU7 A;  2BED B;  3HXF B; 
#chains in the Genus database with same CATH topology
 3EU8 A;  2FBA A;  3E80 A;  3M71 A;  1N7O A;  1J0N A;  4MMH A;  1N21 A;  4Q2B A;  4BOJ A;  3S4A A;  1FP3 A;  4OZW A;  3AFJ A;  2AFA A;  1SQC A;  3REN A;  4OK4 A;  3DPY B;  1SA4 B;  3RRS A;  4XUV A;  2D8L A;  3EU5 B;  1LXK A;  1XW2 A;  1FBO A;  3WKI A;  5IKA A;  1N7R A;  5JMF A;  4TF4 A;  4GTQ B;  1XWT A;  3M02 A;  3QXF A;  3SDQ A;  1F9D A;  3WUX A;  3M75 A;  1HXG A;  3DSU B;  2JJB A;  4GTR B;  3SDT A;  4M76 A;  4CE7 A;  1KS8 A;  1TN7 B;  4YDE B;  1V7W A;  4YDO B;  3W7T A;  3PZ4 B;  4WVA A;  2A73 B;  1LOH A;  4GTS B;  4GL3 A;  1L1Y A;  1X81 B;  3W7W A;  4DOE A;  3E32 B;  3ANJ A;  2WII B;  3W7X A;  2QNO A;  3QSP A;  4L0G A;  1H3A A;  1O6R A;  4AYO A;  3E6U A;  3DST B;  3QFZ A;  1QAZ A;  1HM3 A;  3HXB B;  3GT5 A;  1LF9 A;  1VD5 A;  2WDA A;  1H13 A;  2ZIS B;  4L6X A;  5M7I A;  1NC5 A;  1X9D A;  1G87 A;  1LXM A;  4LNG B;  3VSM A;  1AGM A;  5FOB B;  4KTP A;  1HMW A;  3DSX B;  4F13 A;  2JF4 A;  3M01 A;  1RQ5 A;  1GXN A;  2DRS A;  1H3C A;  2XWJ B;  2V8K A;  3PZ2 B;  3W7U A;  4D4A A;  3VXD A;  2I07 B;  2VN7 A;  4LIX A;  4BOK A;  2AHF A;  1N7N A;  1GAH A;  1KSC A;  3N0F A;  4WVC A;  5M7Y A;  3M78 A;  4C1S A;  5EAT A;  3HXD B;  3RJ3 A;  1RWA A;  1RWH A;  2EAC A;  2B39 A;  5GY3 A;  2ONH A;  3QPF A;  1TNY B;  4E1Y A;  1HZF A;  4EL8 A;  4LNV A;  2WIN B;  4YCR A;  4RNQ A;  5C05 A;  1N7P A;  2CQT A;  5FO9 B;  1KZP B;  1O1R B;  3CIH A;  4CJ0 A;  1TNO B;  3SDV A;  1W6J A;  3P5P A;  3Q7F B;  1TNB B;  1GXM A;  2PN5 A;  3P2C A;  3A3V A;  1F9G A;  3QT3 A;  3SAE A;  3SDR A;  1H3B A;  1GA2 A;  2A8Z A;  3EUV B;  5ILK A;  2EAE A;  5ILH A;  3P5R A;  4OZV A;  4WU0 A;  1N4R B;  3RX5 A;  1TN8 B;  1KRF A;  3WKF A;  1KZO B;  2XWB B;  3W7S A;  1WU4 A;  1FT2 B;  1N94 B;  3KQ4 A;  2XQW A;  5DHI A;  2E22 A;  2YIK A;  5MEH A;  1TN6 B;  5KKB A;  4GAX A;  1RWC A;  3ANK A;  3KSL B;  4D4B A;  1N24 A;  4FNV A;  3M00 A;  1IA7 A;  3WIR A;  1UMP A;  1OJP A;  1JCS B;  2WYN A;  3E30 B;  1V7X A;  2BB6 A;  1LD8 B;  3OXU A;  3ACS A;  4D4C A;  1QQF A;  3EQA A;  5IK9 A;  1GAI A;  3PMM A;  4OJZ A;  1JS4 A;  1DL2 A;  3ON6 A;  3G4D A;  3WKH A;  3Q78 B;  5IKH A;  3M7C A;  2JG0 A;  4WVB A;  4V1S A;  5GZK A;  2BRV X;  1DOG A;  1D8D B;  1NI1 B;  4OK2 A;  3M76 A;  3EZ8 A;  1N4S B;  1C3D A;  1HN0 A;  2ZZR A;  4FXG B;  3Q79 B;  4JJJ A;  2FUT A;  2V3P A;  2F6D A;  1N9A B;  1RWG A;  1TNU B;  2DRQ A;  1HM2 A;  5IL3 A;  3T33 A;  1FAE A;  3PZ3 B;  4GTT B;  1CLC A;  3QG0 A;  1TNZ B;  1W3Y A;  3M77 A;  4L9P B;  2F0Y B;  2H6I B;  1G9G A;  3A0O A;  2NVP A;  3M7B A;  1L2A A;  2GOX A;  3VW5 A;  1N4P B;  1V5C A;  3WIQ A;  1KKT A;  2E24 A;  4LNB B;  5JMD A;  1QBQ B;  1UG9 A;  2D5J A;  1O1T B;  3H2W A;  2H6G B;  3M73 A;  2AHG A;  4FUS A;  1H37 A;  4MBG B;  2VN4 A;  4ZRQ A;  2FUQ A;  1O79 A;  3X17 A;  1LTX B;  3K7X A;  3G6J B;  3M7E A;  3Q75 B;  1FMI A;  1D8E B;  1FCE A;  1NXC A;  1O5M B;  3NFV A;  1KSD A;  1UT9 A;  3RX7 A;  3GLY A;  3LZ9 A;  4ONT A;  2P0V A;  1I8Q A;  2CQS A;  1GLM A;  4D94 A;  2BRP A;  3S4C A;  3QFY A;  3SDU A;  3H3K A;  3W5N A;  1O1S B;  3KLS A;  3QDE A;  5ILZ A;  1TF4 A;  3SFY B;  1WZZ A;  2GH4 A;  3E73 A;  4V1R A;  4GTV B;  4MU9 A;  1XWQ A;  1O6H A;  1H35 A;  1FO2 A;  5IL8 A;  1QSJ A;  4F10 A;  2B4F A;  2H6H B;  2IEJ B;  3M72 A;  3PZ1 B;  1X1J A;  2WCO A;  5CD2 A;  1G6I A;  1X1I A;  3C72 B;  4J5T A;  4GTO B;  3SQC A;  1OJN A;  2V8J A;  5DHK A;  1RW9 A;  2J5C A;  1HCU A;  1CB8 A;  1C82 A;  3AFL A;  1V7V A;  5FO8 B;  3D3I A;  3RX8 A;  1N20 A;  4DI5 A;  1K72 A;  2BBC A;  1WU6 A;  3SFX B;  1WU5 A;  3QT9 A;  2R2L B;  5ILI A;  5IM1 A;  3QXQ A;  1MZC B;  1HXA A;  2XFG A;  3W5M A;  1KRE A;  4AYR A;  5EAU A;  2PMV A;  1LD7 B;  4KTR A;  1IA6 A;  4FXK B;  5GW7 A;  3TF4 A;  3E33 B;  4GTP B;  3OED A;  2RI9 A;  1N23 A;  1H14 A;  3CU7 A;  1N22 A;  5IK0 A;  2BED B;  5AGD A;  3HXF B;  2BRW A;  2Z07 A;  2G0D A;  4TXT A;  1IS9 A;  3G4F A;  2EAB A;  4KKI A;  1KFG A;  2BB5 A;  3HXE B;  3K11 A;  5CZL A;  5ILY A;  2ONG A;  3WKG A;  3DSV B;  4Z4L A;  3ANI A;  1G9J A;  3D5S A;  2SQC A;  3ACT A;  1NL4 B;  2NOJ A;  1OJM A;  1S63 B;  3M7L A;  2V8I A;  1HV6 A;  1FPP B;  3Q73 B;  4Q88 A;  1KWF A;  2WY8 A;  1V5D A;  2GZ6 A;  4KKJ A;  4ZH5 A;  1CEM A;  4D4D A;  5ILJ A;  1H12 A;  4ZG8 A;  1HXC A;  5JPN B;  3E37 B;  1FBW A;  3WC3 A;  5E2J A;  3S9V A;  1LF6 A;  1F9O A;  4Z4J A;  1FT1 B;  5IK6 A;  2WY7 A;  3E7J A;  1S64 B;  1JCR B;  2FV0 A;  1F1S A;  2ZIR B;  3Q7A B;  3S4B A;  1GHQ A;  1N7Q A;  3H7L A;  2ZBL A;  3DRA B;  3RSY A;  3WIW A;  5EAS A;  4GTM B;  3VSN A;  1H54 A;  1OJO A;  2RGK A;  1O6Q A;  5DGR A;  2RI8 A;  4AYQ A;  3N0G A;  4FJQ A;  1HMU A;  2G02 A;  2OKX A;  1R76 A;  4MMI A;  5CA3 A;  1EGU A;  1SA5 B;  3HXC B;  2EAD A;  2V3N A;  1JCQ B;  1H39 A;  4CJ1 A;  1N95 B;  2DRO A;  3PYB A;  4QT9 A;  2FV1 A;  3NNB A;  1GXO A;  2H6F B;  3GZK A;  3QWT A;  1N1Z A;  1ULV A;  1GSZ A;  3KSQ B;  4NEI A;  4ZH1 A;  1H36 A;  3DSW B;  4EHM B;  2Q1F A;  3QRY A;  3DSS B;  3E34 B;  1RWF A;  3M74 A;  5DGQ A;  1N4Q B;  5ILD A;  4DOD A;  2FUZ A;  1W6K A;  1DCE B;  4ZRP A;  3D5R A;  4AYP A;  5FO7 B;  2X03 A;  1FO3 A;  1J0M A;  5JPM B;  1HX9 A;  2DRR A;  1X1H A;  3PYA A;  3S4D A;  1N1B A;  1AYX A; 
#chains in the Genus database with same CATH homology
 3EU8 A;  2FBA A;  3M71 A;  4Q2B A;  4BOJ A;  3S4A A;  1FP3 A;  3AFJ A;  2AFA A;  1SQC A;  3REN A;  3DPY B;  1SA4 B;  3RRS A;  4XUV A;  2D8L A;  3EU5 B;  1XW2 A;  1FBO A;  3WKI A;  4TF4 A;  4GTQ B;  1XWT A;  3QXF A;  3SDQ A;  1F9D A;  3WUX A;  3M75 A;  3DSU B;  2JJB A;  4GTR B;  3SDT A;  4M76 A;  4CE7 A;  1KS8 A;  1TN7 B;  4YDE B;  1V7W A;  4YDO B;  3W7T A;  3PZ4 B;  4WVA A;  2A73 B;  4GTS B;  4GL3 A;  1L1Y A;  1X81 B;  3W7W A;  4DOE A;  3E32 B;  3ANJ A;  2WII B;  3W7X A;  2QNO A;  3QSP A;  4L0G A;  1H3A A;  1O6R A;  4AYO A;  3E6U A;  3DST B;  3QFZ A;  3HXB B;  3GT5 A;  1LF9 A;  1VD5 A;  1H13 A;  2ZIS B;  4L6X A;  5M7I A;  1NC5 A;  1X9D A;  1G87 A;  4LNG B;  1AGM A;  5FOB B;  4KTP A;  3DSX B;  2JF4 A;  1RQ5 A;  1GXN A;  2DRS A;  1H3C A;  2V8K A;  2XWJ B;  3PZ2 B;  3W7U A;  4D4A A;  3VXD A;  2I07 B;  2VN7 A;  4LIX A;  4BOK A;  2AHF A;  1GAH A;  1KSC A;  4WVC A;  5M7Y A;  3M78 A;  4C1S A;  3HXD B;  3RJ3 A;  5GY3 A;  2EAC A;  2B39 A;  3QPF A;  1TNY B;  1HZF A;  4EL8 A;  4LNV A;  2WIN B;  4YCR A;  2CQT A;  5FO9 B;  1KZP B;  1O1R B;  3CIH A;  4CJ0 A;  1TNO B;  3SDV A;  1W6J A;  3P5P A;  3Q7F B;  1TNB B;  1GXM A;  2PN5 A;  3P2C A;  3A3V A;  3QT3 A;  3SAE A;  3SDR A;  1H3B A;  1GA2 A;  2A8Z A;  3EUV B;  2EAE A;  3P5R A;  4WU0 A;  1N4R B;  3RX5 A;  1TN8 B;  1KRF A;  3WKF A;  1KZO B;  2XWB B;  3W7S A;  1WU4 A;  1FT2 B;  1N94 B;  3KQ4 A;  2XQW A;  2YIK A;  5MEH A;  1TN6 B;  5KKB A;  3ANK A;  3KSL B;  4D4B A;  1IA7 A;  3WIR A;  1UMP A;  2WYN A;  1JCS B;  3E30 B;  1V7X A;  2BB6 A;  1LD8 B;  3OXU A;  3ACS A;  4D4C A;  1QQF A;  3EQA A;  1GAI A;  3PMM A;  1JS4 A;  1DL2 A;  3ON6 A;  3WKH A;  3Q78 B;  3M7C A;  2JG0 A;  4WVB A;  4V1S A;  5GZK A;  1DOG A;  1D8D B;  1NI1 B;  3M76 A;  3EZ8 A;  1N4S B;  1C3D A;  2ZZR A;  4FXG B;  3Q79 B;  4JJJ A;  2V3P A;  2F6D A;  1N9A B;  1TNU B;  2DRQ A;  3T33 A;  1FAE A;  3PZ3 B;  4GTT B;  1CLC A;  3QG0 A;  1TNZ B;  3M77 A;  4L9P B;  2F0Y B;  2H6I B;  1G9G A;  2NVP A;  3M7B A;  1L2A A;  2GOX A;  3VW5 A;  1N4P B;  1V5C A;  3WIQ A;  1KKT A;  4LNB B;  1QBQ B;  1UG9 A;  2D5J A;  1O1T B;  3H2W A;  2H6G B;  3M73 A;  2AHG A;  4FUS A;  1H37 A;  4MBG B;  2VN4 A;  4ZRQ A;  1O79 A;  3X17 A;  1LTX B;  3K7X A;  3G6J B;  3M7E A;  3Q75 B;  1FMI A;  1D8E B;  1FCE A;  1NXC A;  1O5M B;  1KSD A;  1UT9 A;  3RX7 A;  3GLY A;  4ONT A;  2P0V A;  2CQS A;  1GLM A;  4D94 A;  3S4C A;  3QFY A;  3SDU A;  3H3K A;  3W5N A;  1O1S B;  3KLS A;  3QDE A;  1TF4 A;  3SFY B;  1WZZ A;  2GH4 A;  3E73 A;  4V1R A;  4GTV B;  4MU9 A;  1XWQ A;  1O6H A;  1H35 A;  1FO2 A;  1QSJ A;  2B4F A;  2H6H B;  2IEJ B;  3M72 A;  3PZ1 B;  5CD2 A;  1G6I A;  3C72 B;  4J5T A;  4GTO B;  3SQC A;  2V8J A;  1HCU A;  1V7V A;  5FO8 B;  3D3I A;  3RX8 A;  1K72 A;  2BBC A;  1WU6 A;  3SFX B;  1WU5 A;  3QT9 A;  2R2L B;  3QXQ A;  1MZC B;  2XFG A;  3W5M A;  1KRE A;  4AYR A;  2PMV A;  1LD7 B;  4KTR A;  1IA6 A;  4FXK B;  5GW7 A;  3TF4 A;  3E33 B;  4GTP B;  3OED A;  2RI9 A;  1H14 A;  3CU7 A;  2BED B;  5AGD A;  3HXF B;  2Z07 A;  2G0D A;  4TXT A;  1IS9 A;  2EAB A;  4KKI A;  1KFG A;  2BB5 A;  3HXE B;  3K11 A;  5CZL A;  3WKG A;  3DSV B;  4Z4L A;  3ANI A;  1G9J A;  3D5S A;  2SQC A;  3ACT A;  1NL4 B;  2NOJ A;  1S63 B;  3M7L A;  2V8I A;  1FPP B;  3Q73 B;  4Q88 A;  1KWF A;  2WY8 A;  1V5D A;  2GZ6 A;  4KKJ A;  4ZH5 A;  1CEM A;  4D4D A;  1H12 A;  4ZG8 A;  5JPN B;  3E37 B;  1FBW A;  3WC3 A;  5E2J A;  3S9V A;  1LF6 A;  1F9O A;  4Z4J A;  1FT1 B;  2WY7 A;  1S64 B;  1JCR B;  2FV0 A;  2ZIR B;  3Q7A B;  3S4B A;  1GHQ A;  3H7L A;  2ZBL A;  3DRA B;  3RSY A;  3WIW A;  4GTM B;  1H54 A;  2RGK A;  1O6Q A;  5DGR A;  2RI8 A;  4AYQ A;  2G02 A;  2OKX A;  1R76 A;  5CA3 A;  1SA5 B;  3HXC B;  2EAD A;  2V3N A;  1JCQ B;  1H39 A;  4CJ1 A;  1N95 B;  2DRO A;  3PYB A;  4QT9 A;  2FV1 A;  1GXO A;  2H6F B;  3GZK A;  3QWT A;  1ULV A;  1GSZ A;  3KSQ B;  4ZH1 A;  1H36 A;  3DSW B;  4EHM B;  3QRY A;  3DSS B;  3E34 B;  5DGQ A;  3M74 A;  1N4Q B;  4DOD A;  2FUZ A;  1W6K A;  1DCE B;  4ZRP A;  3D5R A;  4AYP A;  5FO7 B;  1FO3 A;  5JPM B;  2DRR A;  3PYA A;  3S4D A;  1AYX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...