2XFGA

Reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
446
structure length
446
Chain Sequence
TGAFNYGEALQKAIFFYECQRSGKLDSSTLRLNWRGDSGLDDGKDAGIDLTGGWYDAGDHVKFNLPMSYSAAMLGWAVYEYEDAFKQSGQYNHILNNIKWACDYFIKCHPEKDVYYYQVGDGHADHAWWGPAEVMPMERPSYKVDRSSPGSTVVAETSAALAIASIIFKKVDGEYSKECLKHAKELFEFADTTKSDDGYTAANGFYNSWSGFYDELSWAAVWLYLATNDSSYLDKAESYSDKWGYEPQTNIPKYKWAQCWDDVTYGTYLLLARIKNDNGKYKEAIERHLDWWTTGYNGERITYTPKGLAWLDQWGSLRYATTTAFLACVYSDWENGDKEKAKTYLEFARSQADYALGSTGRSFVVGFGENPPKRPHHRTAHGSWADSQMEPPEHRHVLYGALVGGPDSTDNYTDDISNYTCNEVACDYNAGFVGLLAKMYKLYGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOGLUCANASE 1
publication title Reassembly and Co-Crystallization of a Family 9 Processive Endoglucanase from its Component Parts: Structural and Functional Significance of Intermodular Linker
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase/sugar binding protein
total genus 167
structure length 446
sequence length 446
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2xfgA00
3CIHA 4J5TA 1FO2A 1XWQA 3WIQA 2DROA 1FBOA 5DGRA 3E6UA 1H12A 2ZBLA 1XW2A 1LF9A 3W7UA 4JJJA 4KTRA 3WKIA 3W7WA 3H7LA 3EQAA 3QT9A 2D8LA 2P0VA 5M7YA 4XUVA 3GT5A 3QXFA 4KTPA 4ZH5A 2EABA 3P2CA 3QDEA 4EL8A 1FO3A 1XWTA 5M7IA 3W7XA 1IA6A 4WVCA 1AYXA 4WVBA 3TF4A 1TF4A 1NXCA 2OKXA 3E73A 1GA2A 3W5NA 4Z4JA 3S4CA 1FBWA 2DRSA 3A3VA 3GLYA 2RGKA 3RX7A 4CE7A 1V7WA 1WU5A 1G87A 2VN4A 2YIKA 3D3IA 5E2JA 1KREA 1KRFA 2AHFA 3WUXA 3ANKA 1H54A 3ON6A 3X17A 4L0GA 1KKTA 2A8ZA 2Z07A 3WKFA 1KSCA 5CD2A 5KKBA 4DODA 1H14A 1GAIA 3PMMA 1FMIA 1JS4A 3W7SA 3WKGA 1UT9A 2GH4A 1FP3A 2RI8A 1WU6A 5CZLA 3K11A 1KFGA 2GZ6A 3ACSA 1CEMA 1RQ5A 3RRSA 2CQTA 1VD5A 4Q2BA 2CQSA 4TF4A 1IS9A 1UG9A 1KSDA 3VXDA 3QPFA 3RENA 5GY3A 3GZKA 3S4DA 2B4FA 3QG0A 2EAEA 3S4AA 2D5JA 1G9GA 4CJ1A 2DRQA 1WZZA 2JG0A 3ANIA 3QFYA 4TXTA 5CA3A 2DRRA 3QRYA 4Z4LA 3QSPA 2AFAA 2FBAA 1FAEA 3WIWA 3T33A 4ZG8A 2WYNA 3RX5A 3VW5A 4AYPA 3ACTA 1KS8A 3S4BA 1V7XA 3WKHA 3WIRA 3W7TA 1H13A 1WU4A 4FUSA 2FV0A 2QNOA 3EZ8A 2FUZA 2NVPA 3H3KA 2JF4A 3WC3A 1ULVA 1CLCA 1F9OA 1V5DA 4Q88A 4DOEA 2ZZRA 3QXQA 4AYOA 1V7VA 1X9DA 1LF6A 1L1YA 4AYQA 1F9DA 2EADA 3ANJA 2EACA 3W5MA 2FV1A 4WVAA 2F6DA 1FCEA 2VN7A 1G6IA 1GLMA 2XFGA 1G9JA 1DL2A 1L2AA 1HCUA 1KWFA 1GAHA 1K72A 3RX8A 1AGMA 4AYRA 3QT3A 5MEHA 5DGQA 3H2WA 5GW7A 1DOGA 3AFJA 4L6XA 1V5CA 3RSYA 2JJBA 3QFZA 4CJ0A 2RI9A 4WU0A 3QWTA 1NC5A 1IA7A 2AHGA
chains in the Genus database with same CATH superfamily
1FO2A 3WIQA 1N24A 2DROA 5FOBB 1TNOB 1HXGA 3M71A 2D8LA 2XWBB 1W6KA 1N95B 1D8DB 2EABA 2Q1FA 2FUQA 4ZH5A 3P2CA 4ZRPA 3KSQB 3D5RA 1AYXA 4F13A 3SAEA 2X03A 3E73A 1GA2A 2V8KA 3S4CA 1V7WA 1G87A 1TN7B 4GTMB 4BOJA 3LZ9A 2WY7A 2AHFA 2H6HB 2XQWA 4OK2A 1KKTA 1RWGA 5CD2A 1RW9A 3PMMA 1UT9A 3M73A 4D94A 4C1SA 1QSJA 5EAUA 4EHMB 3K11A 2GZ6A 1RQ5A 2NOJA 3SDQA 4MMIA 3EUVB 1QQFA 5JPMB 2CQSA 3Q73B 5ILJA 5IM1A 1KSDA 3GZKA 3QG0A 3M74A 1RWFA 3DSUB 2DRRA 4ZRQA 3M02A 3DSTB 4D4AA 1FAEA 1N4SB 5DHKA 4ZG8A 2WYNA 1RWAA 1KS8A 3OEDA 3P5PA 4OJZA 3WIRA 5FO8B 1H13A 3W7TA 4FUSA 2FUZA 3NNBA 1ULVA 1V5DA 3PYAA 3M01A 2ZZRA 1V7VA 4GTSB 1X9DA 1HV6A 1LOHA 2EACA 4WVAA 2F6DA 1FCEA 2VN7A 4FXKB 4DI5A 5ILKA 1G9JA 2WINB 1H36A 3RX8A 1H39A 4F10A 4AYRA 5MEHA 5DGQA 3Q7FB 1X1JA 2PN5A 2SQCA 3AFJA 3Q79B 3SDRA 3E30B 3SDTA 3HXEB 4CJ0A 1TNUB 4GTTB 4ZH1A 2RI9A 3QWTA 2Z07A 2AHGA 4J5TA 3PZ2B 5DGRA 3PYBA 1O5MB 2BBCA 1H12A 1O1RB 2ZBLA 1XW2A 1LF9A 5EASA 5IK6A 4KTRA 3EQAA 3A0OA 4MU9A 5M7YA 1LXKA 1N7PA 4KTPA 1S64B 2V8IA 5IL3A 3SDUA 2H6FB 3SFXB 1IA6A 3TF4A 2BB5A 1UMPA 1NXCA 3W5NA 1X1HA 1JCRB 3RX7A 2DRSA 3A3VA 4CE7A 5C05A 1FPPB 1QBQB 2R2LB 2VN4A 3D3IA 5IKHA 5IL8A 1KRFA 3WUXA 3ANKA 4L9PB 3AFLA 4E1YA 4V1RA 1KSCA 4DODA 1MZCB 5IK0A 2XWJB 4GTRB 3W7SA 1OJPA 3EU5B 1HX9A 2RI8A 1KFGA 3E80A 1CEMA 1LXMA 4Q2BA 3N0FA 1N1ZA 1UG9A 4OK4A 3VXDA 3QPFA 1HM2A 1C3DA 1R76A 4V1SA 5GY3A 1I8QA 3NFVA 2B4FA 3HXDB 2BRVX 2D5JA 2DRQA 1WZZA 2JG0A 3ANIA 3QFYA 5IKAA 3QRYA 3N0GA 4Z4LA 1TN8B 1N4PB 3WIWA 4FJQA 5ILZA 4AYPA 1N4QB 5JMFA 1HZFA 2BRPA 3S4BA 1V7XA 3WKHA 1N4RB 4OZVA 1WU4A 4LNGB 2QNOA 3EZ8A 2H6GB 2JF4A 3H3KA 1CLCA 1DCEB 1F9OA 2V3NA 4NEIA 4RNQA 1N21A 2EADA 3HXCB 3W5MA 2FV1A 4KKIA 2WY8A 1G6IA 1JCSB 2XFGA 2GOXA 1L2AA 1KWFA 5ILIA 1K72A 4OZWA 1N7QA 1N20A 2ONGA 2BB6A 3RSYA 2JJBA 1O6QA 1SA4B 4M76A 5JPNB 3CIHA 1SA5B 4KKJA 1HMWA 1H3CA 4JJJA 1HXCA 3W7WA 3E33B 3RJ3A 1X1IA 3H7LA 3QT9A 3EU8A 4QT9A 3SDVA 2PMVA 1NL4B 4XUVA 1H3AA 2J5CA 3QXFA 1HXAA 3QDEA 1N23A 4GTVB 4EL8A 2ZIRB 5M7IA 4WVCA 1TF4A 2ONHA 4Z4JA 1CB8A 1OJMA 1FBWA 3GLYA 3G6JB 5FO9B 4GTOB 3DPYB 3K7XA 3OXUA 4YDOB 1KREA 1LTXB 3CU7A 3M7BA 3M7LA 3ON6A 3DSWB 2A8ZA 5KKBA 5GZKA 1D8EB 1EGUA 3E7JA 1FMIA 1JS4A 3P5RA 4FXGB 2GH4A 1WU6A 1TNYB 2G02A 1NI1B 3ACSA 3VSMA 4ONTA 1TNZB 1N7RA 4YCRA 3RENA 3S4DA 3G4DA 3E32B 2WDAA 1LD8B 3G4FA 4TXTA 2AFAA 1H3BA 1X81B 3T33A 1J0NA 1HM3A 1C82A 3ACTA 3KLSA 4MMHA 1JCQB 2FV0A 3KQ4A 2NVPA 3E37B 2A73B 4Q88A 4DOEA 4AYOA 1LF6A 1L1YA 4AYQA 5DHIA 1F9DA 1FT2B 3SQCA 3M00A 1GLMA 1N7OA 1HCUA 3QT3A 3Q78B 5GW7A 1GHQA 2BRWA 2FUTA 5AGDA 1DOGA 4MBGB 3SFYB 4L6XA 2E22A 1GXNA 3DSVB 4BOKA 2WIIB 1GSZA 1NC5A 4D4BA 1W6JA 1XWQA 3Q7AB 1FBOA 1QAZA 3E6UA 3DRAB 1O1SB 1LD7B 4LNBB 3W7UA 3WKIA 1N7NA 2P0VA 3GT5A 1KZOB 1FO3A 2H6IB 3HXBB 1XWTA 1H37A 1N1BA 3W7XA 3E34B 3VSNA 4WVBA 1TN6B 1W3YA 2OKXA 1RWCA 4D4CA 2G0DA 2RGKA 4LIXA 1N94B 1WU5A 1TNBB 2YIKA 1O1TB 1SQCA 3M76A 5E2JA 1J0MA 1H54A 4GL3A 3X17A 3M75A 4L0GA 3WKFA 1H14A 1GAIA 3WKGA 1FP3A 1KZPB 5CZLA 1N22A 3PZ1B 4YDEB 3RRSA 4D4DA 5ILDA 2CQTA 1VD5A 4TF4A 1IS9A 5IK9A 2BEDB 5EATA 2EAEA 3S4AA 2ZISB 1F1SA 1G9GA 1RWHA 4CJ1A 2B39A 5CA3A 3QSPA 1HMUA 2FBAA 3KSLB 3M72A 3RX5A 2V3PA 3VW5A 3C72B 1O79A 1HN0A 2E24A 3PZ3B 3WC3A 1H35A 3M7CA 4GTPB 4LNVA 3QXQA 3M7EA 5ILHA 1F9GA 1N9AB 3Q75B 2F0YB 1GXMA 3ANJA 1S63B 3DSXB 2WCOA 2IEJB 1DL2A 1FT1B 1O6HA 1GAHA 3M78A 1OJNA 1AGMA 3PZ4B 3DSSB 2V8JA 5ILYA 3S9VA 1O6RA 1GXOA 3D5SA 3H2WA 3HXFB 5JMDA 1OJOA 4GAXA 1V5CA 3QFZA 5FO7B 2I07B 3M77A 4FNVA 4WU0A 1IA7A 4GTQB
chains in the Genus database with same CATH topology
1FO2A 3WIQA 2DROA 5FOBB 1TNOB 3M71A 2D8LA 2XWBB 1W6KA 1N95B 1D8DB 2EABA 4ZH5A 3P2CA 4ZRPA 3KSQB 3D5RA 1AYXA 3SAEA 3E73A 1GA2A 2V8KA 3S4CA 1V7WA 1G87A 1TN7B 4GTMB 4BOJA 2WY7A 2AHFA 2H6HB 2XQWA 1KKTA 5CD2A 3PMMA 1UT9A 3M73A 4D94A 4C1SA 1QSJA 4EHMB 3K11A 2GZ6A 1RQ5A 2NOJA 3SDQA 3EUVB 1QQFA 5JPMB 2CQSA 3Q73B 1KSDA 3GZKA 3QG0A 3M74A 3DSUB 2DRRA 4ZRQA 3DSTB 4D4AA 1FAEA 1N4SB 4ZG8A 2WYNA 1KS8A 3OEDA 3P5PA 3WIRA 3W7TA 5FO8B 1H13A 4FUSA 2FUZA 1ULVA 1V5DA 3PYAA 2ZZRA 1V7VA 4GTSB 1X9DA 2EACA 4WVAA 2F6DA 1FCEA 2VN7A 4FXKB 1G9JA 2WINB 1H36A 3RX8A 1H39A 4AYRA 5MEHA 5DGQA 3Q7FB 2PN5A 2SQCA 3AFJA 3Q79B 3SDRA 3E30B 3SDTA 3HXEB 4CJ0A 1TNUB 4GTTB 4ZH1A 2RI9A 3QWTA 2Z07A 2AHGA 4J5TA 3PZ2B 5DGRA 3PYBA 1O5MB 2BBCA 1H12A 1O1RB 2ZBLA 1XW2A 1LF9A 4KTRA 3EQAA 4MU9A 5M7YA 4KTPA 1S64B 2V8IA 3SDUA 2H6FB 3SFXB 1IA6A 3TF4A 2BB5A 1UMPA 1NXCA 3W5NA 1JCRB 3RX7A 2DRSA 3A3VA 4CE7A 1FPPB 1QBQB 2R2LB 2VN4A 3D3IA 1KRFA 3WUXA 3ANKA 4L9PB 4V1RA 1KSCA 4DODA 1MZCB 2XWJB 4GTRB 3W7SA 3EU5B 2RI8A 1KFGA 1CEMA 4Q2BA 1UG9A 3VXDA 3QPFA 1C3DA 1R76A 4V1SA 5GY3A 2B4FA 3HXDB 2D5JA 2DRQA 1WZZA 2JG0A 3ANIA 3QFYA 3QRYA 4Z4LA 1TN8B 1N4PB 3WIWA 4AYPA 1N4QB 1HZFA 3S4BA 1V7XA 3WKHA 1N4RB 1WU4A 4LNGB 2QNOA 3EZ8A 2H6GB 2JF4A 3H3KA 1CLCA 1DCEB 1F9OA 2V3NA 2EADA 3HXCB 3W5MA 2FV1A 4KKIA 2WY8A 1G6IA 1JCSB 2XFGA 2GOXA 1L2AA 1KWFA 1K72A 2BB6A 3RSYA 2JJBA 1O6QA 1SA4B 4M76A 5JPNB 3CIHA 1SA5B 4KKJA 1H3CA 4JJJA 3W7WA 3E33B 3RJ3A 3H7LA 3QT9A 3EU8A 4QT9A 3SDVA 2PMVA 1NL4B 4XUVA 1H3AA 3QXFA 3QDEA 4EL8A 4GTVB 2ZIRB 5M7IA 4WVCA 1TF4A 4Z4JA 1FBWA 3GLYA 3G6JB 5FO9B 4GTOB 3DPYB 3K7XA 3OXUA 4YDOB 1KREA 1LTXB 3CU7A 3M7BA 3M7LA 3ON6A 3DSWB 2A8ZA 5KKBA 5GZKA 1D8EB 1FMIA 1JS4A 3P5RA 4FXGB 2GH4A 1WU6A 1TNYB 2G02A 1NI1B 3ACSA 4ONTA 1TNZB 4YCRA 3RENA 3S4DA 3E32B 1LD8B 4TXTA 2AFAA 1H3BA 1X81B 3T33A 3ACTA 3KLSA 1JCQB 2FV0A 3KQ4A 2NVPA 3E37B 2A73B 4Q88A 4DOEA 4AYOA 1LF6A 1L1YA 4AYQA 1F9DA 1FT2B 3SQCA 1GLMA 1HCUA 3QT3A 3Q78B 5GW7A 1GHQA 5AGDA 1DOGA 4MBGB 3SFYB 4L6XA 1GXNA 3DSVB 4BOKA 2WIIB 1GSZA 1NC5A 4D4BA 1W6JA 1XWQA 3Q7AB 1FBOA 3E6UA 3DRAB 1O1SB 1LD7B 4LNBB 3W7UA 3WKIA 2P0VA 3GT5A 1KZOB 1FO3A 2H6IB 3HXBB 1XWTA 1H37A 3W7XA 3E34B 4WVBA 1TN6B 2OKXA 4D4CA 2G0DA 2RGKA 4LIXA 1N94B 1WU5A 1TNBB 2YIKA 1O1TB 1SQCA 3M76A 5E2JA 1H54A 4GL3A 3X17A 3M75A 4L0GA 3WKFA 1H14A 1GAIA 3WKGA 1FP3A 1KZPB 5CZLA 3PZ1B 4YDEB 3RRSA 4D4DA 2CQTA 1VD5A 4TF4A 1IS9A 2BEDB 2EAEA 3S4AA 2ZISB 1G9GA 4CJ1A 2B39A 5CA3A 3QSPA 2FBAA 3KSLB 3M72A 3RX5A 2V3PA 3VW5A 3C72B 1O79A 3PZ3B 3WC3A 1H35A 3M7CA 4GTPB 4LNVA 3QXQA 3M7EA 3Q75B 1N9AB 2F0YB 1GXMA 3ANJA 1S63B 3DSXB 2IEJB 1DL2A 1FT1B 1O6HA 1GAHA 3M78A 1AGMA 3PZ4B 3DSSB 2V8JA 3S9VA 1O6RA 1GXOA 3D5SA 3H2WA 3HXFB 1V5CA 3QFZA 5FO7B 2I07B 3M77A 4WU0A 1IA7A 4GTQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIH A;  4J5T A;  1FO2 A;  1XWQ A;  3WIQ A;  2DRO A;  1FBO A;  5DGR A;  3E6U A;  1H12 A;  2ZBL A;  1XW2 A;  1LF9 A;  3W7U A;  4JJJ A;  4KTR A;  3WKI A;  3W7W A;  3H7L A;  3EQA A;  3QT9 A;  2D8L A;  2P0V A;  5M7Y A;  4XUV A;  3GT5 A;  3QXF A;  4KTP A;  4ZH5 A;  2EAB A;  3P2C A;  3QDE A;  4EL8 A;  1FO3 A;  1XWT A;  5M7I A;  3W7X A;  1IA6 A;  4WVC A;  1AYX A;  4WVB A;  3TF4 A;  1TF4 A;  1NXC A;  2OKX A;  3E73 A;  1GA2 A;  3W5N A;  4Z4J A;  3S4C A;  1FBW A;  2DRS A;  3A3V A;  3GLY A;  2RGK A;  3RX7 A;  4CE7 A;  1V7W A;  1WU5 A;  1G87 A;  2VN4 A;  2YIK A;  3D3I A;  5E2J A;  1KRE A;  1KRF A;  2AHF A;  3WUX A;  3ANK A;  1H54 A;  3ON6 A;  3X17 A;  4L0G A;  1KKT A;  2A8Z A;  2Z07 A;  3WKF A;  1KSC A;  5CD2 A;  5KKB A;  4DOD A;  1H14 A;  1GAI A;  3PMM A;  1FMI A;  1JS4 A;  3W7S A;  3WKG A;  1UT9 A;  2GH4 A;  1FP3 A;  2RI8 A;  1WU6 A;  5CZL A;  3K11 A;  1KFG A;  2GZ6 A;  3ACS A;  1CEM A;  1RQ5 A;  3RRS A;  2CQT A;  1VD5 A;  4Q2B A;  2CQS A;  4TF4 A;  1IS9 A;  1UG9 A;  1KSD A;  3VXD A;  3QPF A;  3REN A;  5GY3 A;  3GZK A;  3S4D A;  2B4F A;  3QG0 A;  2EAE A;  3S4A A;  2D5J A;  1G9G A;  4CJ1 A;  2DRQ A;  1WZZ A;  2JG0 A;  3ANI A;  3QFY A;  4TXT A;  5CA3 A;  2DRR A;  3QRY A;  4Z4L A;  3QSP A;  2AFA A;  2FBA A;  1FAE A;  3WIW A;  3T33 A;  4ZG8 A;  2WYN A;  3RX5 A;  3VW5 A;  4AYP A;  3ACT A;  1KS8 A;  3S4B A;  1V7X A;  3WKH A;  3WIR A;  3W7T A;  1H13 A;  1WU4 A;  4FUS A;  2FV0 A;  2QNO A;  3EZ8 A;  2FUZ A;  2NVP A;  3H3K A;  2JF4 A;  3WC3 A;  1ULV A;  1CLC A;  1F9O A;  1V5D A;  4Q88 A;  4DOE A;  2ZZR A;  3QXQ A;  4AYO A;  1V7V A;  1X9D A;  1LF6 A;  1L1Y A;  4AYQ A;  1F9D A;  2EAD A;  3ANJ A;  2EAC A;  3W5M A;  2FV1 A;  4WVA A;  2F6D A;  1FCE A;  2VN7 A;  1G6I A;  1GLM A;  2XFG A;  1G9J A;  1DL2 A;  1L2A A;  1HCU A;  1KWF A;  1GAH A;  1K72 A;  3RX8 A;  1AGM A;  4AYR A;  3QT3 A;  5MEH A;  5DGQ A;  3H2W A;  5GW7 A;  1DOG A;  3AFJ A;  4L6X A;  1V5C A;  3RSY A;  2JJB A;  3QFZ A;  4CJ0 A;  2RI9 A;  4WU0 A;  3QWT A;  1NC5 A;  1IA7 A;  2AHG A; 
#chains in the Genus database with same CATH topology
 1FO2 A;  3WIQ A;  1N24 A;  2DRO A;  5FOB B;  1TNO B;  1HXG A;  3M71 A;  2D8L A;  2XWB B;  1W6K A;  1N95 B;  1D8D B;  2EAB A;  2Q1F A;  2FUQ A;  4ZH5 A;  3P2C A;  4ZRP A;  3KSQ B;  3D5R A;  1AYX A;  4F13 A;  3SAE A;  2X03 A;  3E73 A;  1GA2 A;  2V8K A;  3S4C A;  1V7W A;  1G87 A;  1TN7 B;  4GTM B;  4BOJ A;  3LZ9 A;  2WY7 A;  2AHF A;  2H6H B;  2XQW A;  4OK2 A;  1KKT A;  1RWG A;  5CD2 A;  1RW9 A;  3PMM A;  1UT9 A;  3M73 A;  4D94 A;  4C1S A;  1QSJ A;  5EAU A;  4EHM B;  3K11 A;  2GZ6 A;  1RQ5 A;  2NOJ A;  3SDQ A;  4MMI A;  3EUV B;  1QQF A;  5JPM B;  2CQS A;  3Q73 B;  5ILJ A;  5IM1 A;  1KSD A;  3GZK A;  3QG0 A;  3M74 A;  1RWF A;  3DSU B;  2DRR A;  4ZRQ A;  3M02 A;  3DST B;  4D4A A;  1FAE A;  1N4S B;  5DHK A;  4ZG8 A;  2WYN A;  1RWA A;  1KS8 A;  3OED A;  3P5P A;  4OJZ A;  3WIR A;  5FO8 B;  1H13 A;  3W7T A;  4FUS A;  2FUZ A;  3NNB A;  1ULV A;  1V5D A;  3PYA A;  3M01 A;  2ZZR A;  1V7V A;  4GTS B;  1X9D A;  1HV6 A;  1LOH A;  2EAC A;  4WVA A;  2F6D A;  1FCE A;  2VN7 A;  4FXK B;  4DI5 A;  5ILK A;  1G9J A;  2WIN B;  1H36 A;  3RX8 A;  1H39 A;  4F10 A;  4AYR A;  5MEH A;  5DGQ A;  3Q7F B;  1X1J A;  2PN5 A;  2SQC A;  3AFJ A;  3Q79 B;  3SDR A;  3E30 B;  3SDT A;  3HXE B;  4CJ0 A;  1TNU B;  4GTT B;  4ZH1 A;  2RI9 A;  3QWT A;  2Z07 A;  2AHG A;  4J5T A;  3PZ2 B;  5DGR A;  3PYB A;  1O5M B;  2BBC A;  1H12 A;  1O1R B;  2ZBL A;  1XW2 A;  1LF9 A;  5EAS A;  5IK6 A;  4KTR A;  3EQA A;  3A0O A;  4MU9 A;  5M7Y A;  1LXK A;  1N7P A;  4KTP A;  1S64 B;  2V8I A;  5IL3 A;  3SDU A;  2H6F B;  3SFX B;  1IA6 A;  3TF4 A;  2BB5 A;  1UMP A;  1NXC A;  3W5N A;  1X1H A;  1JCR B;  3RX7 A;  2DRS A;  3A3V A;  4CE7 A;  5C05 A;  1FPP B;  1QBQ B;  2R2L B;  2VN4 A;  3D3I A;  5IKH A;  5IL8 A;  1KRF A;  3WUX A;  3ANK A;  4L9P B;  3AFL A;  4E1Y A;  4V1R A;  1KSC A;  4DOD A;  1MZC B;  5IK0 A;  2XWJ B;  4GTR B;  3W7S A;  1OJP A;  3EU5 B;  1HX9 A;  2RI8 A;  1KFG A;  3E80 A;  1CEM A;  1LXM A;  4Q2B A;  3N0F A;  1N1Z A;  1UG9 A;  4OK4 A;  3VXD A;  3QPF A;  1HM2 A;  1C3D A;  1R76 A;  4V1S A;  5GY3 A;  1I8Q A;  3NFV A;  2B4F A;  3HXD B;  2BRV X;  2D5J A;  2DRQ A;  1WZZ A;  2JG0 A;  3ANI A;  3QFY A;  5IKA A;  3QRY A;  3N0G A;  4Z4L A;  1TN8 B;  1N4P B;  3WIW A;  4FJQ A;  5ILZ A;  4AYP A;  1N4Q B;  5JMF A;  1HZF A;  2BRP A;  3S4B A;  1V7X A;  3WKH A;  1N4R B;  4OZV A;  1WU4 A;  4LNG B;  2QNO A;  3EZ8 A;  2H6G B;  2JF4 A;  3H3K A;  1CLC A;  1DCE B;  1F9O A;  2V3N A;  4NEI A;  4RNQ A;  1N21 A;  2EAD A;  3HXC B;  3W5M A;  2FV1 A;  4KKI A;  2WY8 A;  1G6I A;  1JCS B;  2XFG A;  2GOX A;  1L2A A;  1KWF A;  5ILI A;  1K72 A;  4OZW A;  1N7Q A;  1N20 A;  2ONG A;  2BB6 A;  3RSY A;  2JJB A;  1O6Q A;  1SA4 B;  4M76 A;  5JPN B;  3CIH A;  1SA5 B;  4KKJ A;  1HMW A;  1H3C A;  4JJJ A;  1HXC A;  3W7W A;  3E33 B;  3RJ3 A;  1X1I A;  3H7L A;  3QT9 A;  3EU8 A;  4QT9 A;  3SDV A;  2PMV A;  1NL4 B;  4XUV A;  1H3A A;  2J5C A;  3QXF A;  1HXA A;  3QDE A;  1N23 A;  4GTV B;  4EL8 A;  2ZIR B;  5M7I A;  4WVC A;  1TF4 A;  2ONH A;  4Z4J A;  1CB8 A;  1OJM A;  1FBW A;  3GLY A;  3G6J B;  5FO9 B;  4GTO B;  3DPY B;  3K7X A;  3OXU A;  4YDO B;  1KRE A;  1LTX B;  3CU7 A;  3M7B A;  3M7L A;  3ON6 A;  3DSW B;  2A8Z A;  5KKB A;  5GZK A;  1D8E B;  1EGU A;  3E7J A;  1FMI A;  1JS4 A;  3P5R A;  4FXG B;  2GH4 A;  1WU6 A;  1TNY B;  2G02 A;  1NI1 B;  3ACS A;  3VSM A;  4ONT A;  1TNZ B;  1N7R A;  4YCR A;  3REN A;  3S4D A;  3G4D A;  3E32 B;  2WDA A;  1LD8 B;  3G4F A;  4TXT A;  2AFA A;  1H3B A;  1X81 B;  3T33 A;  1J0N A;  1HM3 A;  1C82 A;  3ACT A;  3KLS A;  4MMH A;  1JCQ B;  2FV0 A;  3KQ4 A;  2NVP A;  3E37 B;  2A73 B;  4Q88 A;  4DOE A;  4AYO A;  1LF6 A;  1L1Y A;  4AYQ A;  5DHI A;  1F9D A;  1FT2 B;  3SQC A;  3M00 A;  1GLM A;  1N7O A;  1HCU A;  3QT3 A;  3Q78 B;  5GW7 A;  1GHQ A;  2BRW A;  2FUT A;  5AGD A;  1DOG A;  4MBG B;  3SFY B;  4L6X A;  2E22 A;  1GXN A;  3DSV B;  4BOK A;  2WII B;  1GSZ A;  1NC5 A;  4D4B A;  1W6J A;  1XWQ A;  3Q7A B;  1FBO A;  1QAZ A;  3E6U A;  3DRA B;  1O1S B;  1LD7 B;  4LNB B;  3W7U A;  3WKI A;  1N7N A;  2P0V A;  3GT5 A;  1KZO B;  1FO3 A;  2H6I B;  3HXB B;  1XWT A;  1H37 A;  1N1B A;  3W7X A;  3E34 B;  3VSN A;  4WVB A;  1TN6 B;  1W3Y A;  2OKX A;  1RWC A;  4D4C A;  2G0D A;  2RGK A;  4LIX A;  1N94 B;  1WU5 A;  1TNB B;  2YIK A;  1O1T B;  1SQC A;  3M76 A;  5E2J A;  1J0M A;  1H54 A;  4GL3 A;  3X17 A;  3M75 A;  4L0G A;  3WKF A;  1H14 A;  1GAI A;  3WKG A;  1FP3 A;  1KZP B;  5CZL A;  1N22 A;  3PZ1 B;  4YDE B;  3RRS A;  4D4D A;  5ILD A;  2CQT A;  1VD5 A;  4TF4 A;  1IS9 A;  5IK9 A;  2BED B;  5EAT A;  2EAE A;  3S4A A;  2ZIS B;  1F1S A;  1G9G A;  1RWH A;  4CJ1 A;  2B39 A;  5CA3 A;  3QSP A;  1HMU A;  2FBA A;  3KSL B;  3M72 A;  3RX5 A;  2V3P A;  3VW5 A;  3C72 B;  1O79 A;  1HN0 A;  2E24 A;  3PZ3 B;  3WC3 A;  1H35 A;  3M7C A;  4GTP B;  4LNV A;  3QXQ A;  3M7E A;  5ILH A;  1F9G A;  1N9A B;  3Q75 B;  2F0Y B;  1GXM A;  3ANJ A;  1S63 B;  3DSX B;  2WCO A;  2IEJ B;  1DL2 A;  1FT1 B;  1O6H A;  1GAH A;  3M78 A;  1OJN A;  1AGM A;  3PZ4 B;  3DSS B;  2V8J A;  5ILY A;  3S9V A;  1O6R A;  1GXO A;  3D5S A;  3H2W A;  3HXF B;  5JMD A;  1OJO A;  4GAX A;  1V5C A;  3QFZ A;  5FO7 B;  2I07 B;  3M77 A;  4FNV A;  4WU0 A;  1IA7 A;  4GTQ B; 
#chains in the Genus database with same CATH homology
 1FO2 A;  3WIQ A;  2DRO A;  5FOB B;  1TNO B;  3M71 A;  2D8L A;  2XWB B;  1W6K A;  1N95 B;  1D8D B;  2EAB A;  4ZH5 A;  3P2C A;  4ZRP A;  3KSQ B;  3D5R A;  1AYX A;  3SAE A;  3E73 A;  1GA2 A;  2V8K A;  3S4C A;  1V7W A;  1G87 A;  1TN7 B;  4GTM B;  4BOJ A;  2WY7 A;  2AHF A;  2H6H B;  2XQW A;  1KKT A;  5CD2 A;  3PMM A;  1UT9 A;  3M73 A;  4D94 A;  4C1S A;  1QSJ A;  4EHM B;  3K11 A;  2GZ6 A;  1RQ5 A;  2NOJ A;  3SDQ A;  3EUV B;  1QQF A;  5JPM B;  2CQS A;  3Q73 B;  1KSD A;  3GZK A;  3QG0 A;  3M74 A;  3DSU B;  2DRR A;  4ZRQ A;  3DST B;  4D4A A;  1FAE A;  1N4S B;  4ZG8 A;  2WYN A;  1KS8 A;  3OED A;  3P5P A;  3WIR A;  3W7T A;  5FO8 B;  1H13 A;  4FUS A;  2FUZ A;  1ULV A;  1V5D A;  3PYA A;  2ZZR A;  1V7V A;  4GTS B;  1X9D A;  2EAC A;  4WVA A;  2F6D A;  1FCE A;  2VN7 A;  4FXK B;  1G9J A;  2WIN B;  1H36 A;  3RX8 A;  1H39 A;  4AYR A;  5MEH A;  5DGQ A;  3Q7F B;  2PN5 A;  2SQC A;  3AFJ A;  3Q79 B;  3SDR A;  3E30 B;  3SDT A;  3HXE B;  4CJ0 A;  1TNU B;  4GTT B;  4ZH1 A;  2RI9 A;  3QWT A;  2Z07 A;  2AHG A;  4J5T A;  3PZ2 B;  5DGR A;  3PYB A;  1O5M B;  2BBC A;  1H12 A;  1O1R B;  2ZBL A;  1XW2 A;  1LF9 A;  4KTR A;  3EQA A;  4MU9 A;  5M7Y A;  4KTP A;  1S64 B;  2V8I A;  3SDU A;  2H6F B;  3SFX B;  1IA6 A;  3TF4 A;  2BB5 A;  1UMP A;  1NXC A;  3W5N A;  1JCR B;  3RX7 A;  2DRS A;  3A3V A;  4CE7 A;  1FPP B;  1QBQ B;  2R2L B;  2VN4 A;  3D3I A;  1KRF A;  3WUX A;  3ANK A;  4L9P B;  4V1R A;  1KSC A;  4DOD A;  1MZC B;  2XWJ B;  4GTR B;  3W7S A;  3EU5 B;  2RI8 A;  1KFG A;  1CEM A;  4Q2B A;  1UG9 A;  3VXD A;  3QPF A;  1C3D A;  1R76 A;  4V1S A;  5GY3 A;  2B4F A;  3HXD B;  2D5J A;  2DRQ A;  1WZZ A;  2JG0 A;  3ANI A;  3QFY A;  3QRY A;  4Z4L A;  1TN8 B;  1N4P B;  3WIW A;  4AYP A;  1N4Q B;  1HZF A;  3S4B A;  1V7X A;  3WKH A;  1N4R B;  1WU4 A;  4LNG B;  2QNO A;  3EZ8 A;  2H6G B;  2JF4 A;  3H3K A;  1CLC A;  1DCE B;  1F9O A;  2V3N A;  2EAD A;  3HXC B;  3W5M A;  2FV1 A;  4KKI A;  2WY8 A;  1G6I A;  1JCS B;  2XFG A;  2GOX A;  1L2A A;  1KWF A;  1K72 A;  2BB6 A;  3RSY A;  2JJB A;  1O6Q A;  1SA4 B;  4M76 A;  5JPN B;  3CIH A;  1SA5 B;  4KKJ A;  1H3C A;  4JJJ A;  3W7W A;  3E33 B;  3RJ3 A;  3H7L A;  3QT9 A;  3EU8 A;  4QT9 A;  3SDV A;  2PMV A;  1NL4 B;  4XUV A;  1H3A A;  3QXF A;  3QDE A;  4EL8 A;  4GTV B;  2ZIR B;  5M7I A;  4WVC A;  1TF4 A;  4Z4J A;  1FBW A;  3GLY A;  3G6J B;  5FO9 B;  4GTO B;  3DPY B;  3K7X A;  3OXU A;  4YDO B;  1KRE A;  1LTX B;  3CU7 A;  3M7B A;  3M7L A;  3ON6 A;  3DSW B;  2A8Z A;  5KKB A;  5GZK A;  1D8E B;  1FMI A;  1JS4 A;  3P5R A;  4FXG B;  2GH4 A;  1WU6 A;  1TNY B;  2G02 A;  1NI1 B;  3ACS A;  4ONT A;  1TNZ B;  4YCR A;  3REN A;  3S4D A;  3E32 B;  1LD8 B;  4TXT A;  2AFA A;  1H3B A;  1X81 B;  3T33 A;  3ACT A;  3KLS A;  1JCQ B;  2FV0 A;  3KQ4 A;  2NVP A;  3E37 B;  2A73 B;  4Q88 A;  4DOE A;  4AYO A;  1LF6 A;  1L1Y A;  4AYQ A;  1F9D A;  1FT2 B;  3SQC A;  1GLM A;  1HCU A;  3QT3 A;  3Q78 B;  5GW7 A;  1GHQ A;  5AGD A;  1DOG A;  4MBG B;  3SFY B;  4L6X A;  1GXN A;  3DSV B;  4BOK A;  2WII B;  1GSZ A;  1NC5 A;  4D4B A;  1W6J A;  1XWQ A;  3Q7A B;  1FBO A;  3E6U A;  3DRA B;  1O1S B;  1LD7 B;  4LNB B;  3W7U A;  3WKI A;  2P0V A;  3GT5 A;  1KZO B;  1FO3 A;  2H6I B;  3HXB B;  1XWT A;  1H37 A;  3W7X A;  3E34 B;  4WVB A;  1TN6 B;  2OKX A;  4D4C A;  2G0D A;  2RGK A;  4LIX A;  1N94 B;  1WU5 A;  1TNB B;  2YIK A;  1O1T B;  1SQC A;  3M76 A;  5E2J A;  1H54 A;  4GL3 A;  3X17 A;  3M75 A;  4L0G A;  3WKF A;  1H14 A;  1GAI A;  3WKG A;  1FP3 A;  1KZP B;  5CZL A;  3PZ1 B;  4YDE B;  3RRS A;  4D4D A;  2CQT A;  1VD5 A;  4TF4 A;  1IS9 A;  2BED B;  2EAE A;  3S4A A;  2ZIS B;  1G9G A;  4CJ1 A;  2B39 A;  5CA3 A;  3QSP A;  2FBA A;  3KSL B;  3M72 A;  3RX5 A;  2V3P A;  3VW5 A;  3C72 B;  1O79 A;  3PZ3 B;  3WC3 A;  1H35 A;  3M7C A;  4GTP B;  4LNV A;  3QXQ A;  3M7E A;  3Q75 B;  1N9A B;  2F0Y B;  1GXM A;  3ANJ A;  1S63 B;  3DSX B;  2IEJ B;  1DL2 A;  1FT1 B;  1O6H A;  1GAH A;  3M78 A;  1AGM A;  3PZ4 B;  3DSS B;  2V8J A;  3S9V A;  1O6R A;  1GXO A;  3D5S A;  3H2W A;  3HXF B;  1V5C A;  3QFZ A;  5FO7 B;  2I07 B;  3M77 A;  4WU0 A;  1IA7 A;  4GTQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...