2XFGA

Reassembly and co-crystallization of a family 9 processive endoglucanase from separately expressed gh9 and cbm3c modules
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
446
structure length
446
Chain Sequence
TGAFNYGEALQKAIFFYECQRSGKLDSSTLRLNWRGDSGLDDGKDAGIDLTGGWYDAGDHVKFNLPMSYSAAMLGWAVYEYEDAFKQSGQYNHILNNIKWACDYFIKCHPEKDVYYYQVGDGHADHAWWGPAEVMPMERPSYKVDRSSPGSTVVAETSAALAIASIIFKKVDGEYSKECLKHAKELFEFADTTKSDDGYTAANGFYNSWSGFYDELSWAAVWLYLATNDSSYLDKAESYSDKWGYEPQTNIPKYKWAQCWDDVTYGTYLLLARIKNDNGKYKEAIERHLDWWTTGYNGERITYTPKGLAWLDQWGSLRYATTTAFLACVYSDWENGDKEKAKTYLEFARSQADYALGSTGRSFVVGFGENPPKRPHHRTAHGSWADSQMEPPEHRHVLYGALVGGPDSTDNYTDDISNYTCNEVACDYNAGFVGLLAKMYKLYGEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/sugar binding protein
molecule keywords ENDOGLUCANASE 1
publication title Reassembly and Co-Crystallization of a Family 9 Processive Endoglucanase from its Component Parts: Structural and Functional Significance of Intermodular Linker
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 167
structure length 446
sequence length 446
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2xfgA00
1KFGA 1F9OA 2JJBA 4Q88A 1L1YA 1VD5A 2AHFA 1H14A 2FV0A 2NVPA 3W5MA 2RI9A 1UT9A 3ACTA 1FMIA 1XW2A 5CA3A 4J5TA 4CJ0A 2CQSA 4KTPA 4XUVA 4FUSA 4CJ1A 1AGMA 1L2AA 2VN4A 4TXTA 4Z4JA 1GAHA 1CEMA 5KKBA 2A8ZA 2B4FA 2JF4A 4AYRA 4Z4LA 4WU0A 4WVCA 3S4DA 3W7WA 3WKIA 3ON6A 3A3VA 1UG9A 3QDEA 3ACSA 1F9DA 3VXDA 1AYXA 1FO3A 1XWTA 1KKTA 3S4CA 1WU6A 3RRSA 3QXFA 5GW7A 1FCEA 1DL2A 2FUZA 1RQ5A 3W7UA 3WUXA 1G9GA 3GLYA 1IA6A 4ZH5A 4AYPA 3QG0A 3ANKA 1LF9A 1KS8A 4L6XA 3RSYA 5E2JA 3WIRA 4DOEA 1TF4A 3S4AA 3WIQA 2OKXA 5GY3A 3QFYA 2RGKA 3ANIA 4L0GA 5M7YA 4CE7A 1G6IA 3QFZA 1FAEA 1V7VA 3AFJA 5DGQA 1NXCA 3WKFA 4AYQA 2RI8A 3QXQA 3X17A 3W7XA 5DGRA 2AFAA 1V7WA 1JS4A 2EADA 1IA7A 1IS9A 3GT5A 2YIKA 3EQAA 1HCUA 2ZBLA 3TF4A 1ULVA 2P0VA 3QT3A 2ZZRA 2CQTA 4TF4A 3VW5A 1G9JA 1NC5A 1V7XA 2EABA 2WYNA 3T33A 2D8LA 1KSCA 5M7IA 4DODA 4ZG8A 3GZKA 1GAIA 3QSPA 5MEHA 3QWTA 1G87A 2GH4A 3H7LA 1GLMA 1WU5A 3D3IA 1FP3A 2Z07A 2D5JA 3H3KA 1FO2A 2AHGA 3RX5A 1FBWA 3P2CA 3E73A 1XWQA 2DRRA 1K72A 2EACA 2VN7A 3QT9A 5CD2A 3WKHA 4JJJA 2DRSA 3RX8A 1KRFA 1WZZA 2GZ6A 2QNOA 1X9DA 3WC3A 1WU4A 1H54A 2DROA 1H13A 2DRQA 1FBOA 4WVBA 3W5NA 1KREA 2JG0A 1LF6A 3PMMA 2FBAA 2XFGA 4KTRA 3K11A 1KWFA 3QPFA 2F6DA 1V5CA 5CZLA 3ANJA 3H2WA 3E6UA 1CLCA 3W7SA 1H12A 3W7TA 1V5DA 3WKGA 3RENA 4EL8A 2EAEA 4Q2BA 2FV1A 1GA2A 4WVAA 3S4BA 3WIWA 4AYOA 1KSDA 1DOGA 3QRYA 3EZ8A 3CIHA 3RX7A
chains in the Genus database with same CATH superfamily
2JJBA 1X1HA 3PZ2B 1VD5A 2G02A 3W5MA 3PYAA 1D8EB 1FMIA 4L9PB 5IM1A 5IK6A 4DI5A 2CQSA 3DSXB 4XUVA 2WCOA 1H36A 1GAHA 1CEMA 2B4FA 2JF4A 2V8KA 3PZ1B 3RJ3A 4WVCA 3KQ4A 4GTOB 5EAUA 3SQCA 4GTQB 1F9GA 1H39A 1UG9A 4D4AA 5IKHA 1F9DA 1AYXA 1XWTA 1WU6A 3HXBB 3PYBA 1FCEA 1DL2A 2FUZA 1MZCB 3D5RA 3WUXA 3GLYA 4ZH5A 1JCQB 1O1TB 1KS8A 1CB8A 3WIRA 4DOEA 3S4AA 1N7NA 4D94A 1OJPA 1GHQA 2OKXA 4L0GA 3G4FA 3SFYB 2B39A 5DGQA 2RI8A 1LD7B 3QXQA 1HX9A 2ZIRB 1O1RB 1V7WA 1NL4B 3PZ4B 4GTMB 3EQAA 3M7CA 2ZBLA 3M76A 2P0VA 4LNGB 2H6IB 5DHKA 4GTRB 1G9JA 1V7XA 2EABA 1H3CA 2R2LB 4KKJA 4D4BA 4GTPB 5M7IA 1FT1B 1QSJA 4ZG8A 1H3AA 2WDAA 1G87A 3H7LA 3Q7FB 1RWGA 2D5JA 3H3KA 1OJMA 4ZRPA 3M00A 2AHGA 3RX5A 3P2CA 1S63B 5ILZA 4JJJA 3SDRA 3RX8A 1WZZA 2GZ6A 3S9VA 3DSSB 1WU4A 3HXFB 1H13A 2DRQA 2PN5A 1QAZA 1GXMA 5C05A 1CLCA 3Q7AB 1H12A 3M78A 4BOKA 4EL8A 1W3YA 1J0MA 3EUVB 4WVAA 1HZFA 1W6JA 2XWBB 1F9OA 1L1YA 2AHFA 2NVPA 2ONHA 1TN6B 2RI9A 3ACTA 2H6GB 1GXOA 4KTPA 1TN7B 1LXMA 2VN4A 4TXTA 4Z4JA 3WKIA 3A3VA 1N1BA 3ACSA 5IK0A 1N4SB 1FO3A 3AFLA 3QXFA 1HMUA 3D5SA 4QT9A 5GW7A 1RWHA 3N0GA 1G9GA 1TNOB 1IA6A 4GTTB 3ANKA 3N0FA 5ILDA 5E2JA 3K7XA 4F10A 3M73A 5GY3A 1RWCA 3QFYA 1N7PA 4CE7A 3WKFA 1V7VA 2IEJB 1C3DA 3EU5B 4F13A 2AFAA 1O5MB 1N4RB 1IA7A 3GT5A 1N7RA 2F0YB 1HCUA 1HMWA 1ULVA 4ZH1A 4D4DA 2ZZRA 2CQTA 1N1ZA 3E30B 4V1RA 4GAXA 1N9AB 3SDUA 2A73B 4ZRQA 2BB6A 1GLMA 1WU5A 3D3IA 1FP3A 1RW9A 1O6HA 3P5RA 5ILJA 2V3PA 4YCRA 2EACA 3G6JB 5CD2A 3WKHA 4E1YA 2XWJB 1KRFA 5ILKA 3PZ3B 3WC3A 1LOHA 1H54A 5ILHA 1HXCA 5EASA 3W5NA 4C1SA 1KREA 1QQFA 1LF6A 4KTRA 1I8QA 1RWFA 2XFGA 5AGDA 3ANJA 3H2WA 2WY8A 3W7SA 4V1SA 1V5DA 2G0DA 5IK9A 2FV1A 2BB5A 3DSVB 3M72A 1HXAA 3P5PA 2BBCA 5JPNB 1GXNA 3DSUB 1DOGA 1NI1B 3QRYA 1SQCA 3EZ8A 4M76A 3CIHA 3RX7A 3EU8A 1KFGA 1N20A 3E34B 4Q88A 1O79A 1N22A 1O6RA 1XW2A 4LNBB 3HXCB 2BRWA 4J5TA 4CJ0A 1TNBB 4CJ1A 2ZISB 4OZWA 3SDQA 1D8DB 3CU7A 3VSMA 3E33B 2A8ZA 2Q1FA 4AYRA 4Z4LA 3S4DA 3ON6A 3Q73B 3C72B 4GL3A 4YDOB 1N94B 4OK4A 1GSZA 3DSTB 1W6KA 1TNYB 4OZVA 5ILIA 1TN8B 1C82A 5EATA 3E80A 3M74A 2V3NA 5DHIA 1RQ5A 3W7UA 3M7LA 1J0NA 4FXGB 4AYPA 3RSYA 3NFVA 1HV6A 3M7EA 1QBQB 1JCRB 3ANIA 1X1IA 5M7YA 2ONGA 1G6IA 1N7QA 1FAEA 3Q78B 1NXCA 2V8JA 2BRPA 3X17A 5DGRA 5IL3A 5FO9B 3E37B 5FO8B 1LXKA 2EADA 3Q75B 1LTXB 3Q79B 3QT3A 4TF4A 1OJNA 3VW5A 3M77A 2D8LA 1N4QB 1TNUB 3KSLB 1KSCA 5JPMB 3GZKA 2GOXA 3QWTA 5MEHA 2GH4A 2BEDB 2FUQA 3M71A 1FO2A 4LIXA 1FBWA 3E73A 2VN7A 1K72A 2DRRA 3QT9A 3DPYB 3SFXB 3DSWB 2DRSA 1X9DA 1N23A 2DROA 1KZOB 1UMPA 1EGUA 2WY7A 3PMMA 2FBAA 3K11A 3QPFA 2F6DA 2E24A 3DRAB 2FUTA 3RENA 3SDTA 3S4BA 4AYOA 1N4PB 1N24A 3KSQB 3OEDA 2H6HB 4OJZA 5GZKA 1N95B 3M75A 1H14A 2FV0A 3SAEA 1UT9A 5ILYA 2V8IA 5CA3A 3HXDB 1TNZB 4FUSA 1H3BA 1AGMA 4MMIA 1L2AA 2E22A 5KKBA 4MBGB 4WU0A 1FPPB 3W7WA 1HM2A 3SDVA 4D4CA 2NOJA 1JCSB 3A0OA 1KZPB 3QDEA 4KKIA 3VXDA 5IKAA 4MU9A 1KKTA 1N7OA 3S4CA 3RRSA 1O1SB 3NNBA 1HN0A 4ONTA 3G4DA 3QG0A 1LF9A 4L6XA 1SA5B 4EHMB 2H6FB 4MMHA 1TF4A 3WIQA 4GTVB 3KLSA 2RGKA 3M7BA 1H37A 1HM3A 1F1SA 3QFZA 3AFJA 4FNVA 4AYQA 2J5CA 3W7XA 3OXUA 3LZ9A 1H35A 3E32B 5JMFA 4BOJA 1JS4A 3HXEB 2X03A 1IS9A 2YIKA 3TF4A 4NEIA 1HXGA 1RWAA 1LD8B 1SA4B 1S64B 1NC5A 2WYNA 3T33A 2PMVA 4DODA 2WINB 1GAIA 3QSPA 2BRVX 1O6QA 4FXKB 1X1JA 2Z07A 5JMDA 5IL8A 2SQCA 1N21A 1XWQA 1OJOA 3M02A 2QNOA 1DCEB 2I07B 1FBOA 1X81B 4WVBA 2WIIB 2JG0A 4YDEB 1KWFA 3M01A 5CZLA 1V5CA 4LNVA 3E6UA 4RNQA 1FT2B 3W7TA 5FOBB 3WKGA 4FJQA 2EAEA 4Q2BA 1R76A 2XQWA 1GA2A 3E7JA 3WIWA 4GTSB 1KSDA 5FO7B 3VSNA 4OK2A
chains in the Genus database with same CATH topology
2JJBA 3PZ2B 1VD5A 2G02A 3W5MA 3PYAA 1D8EB 1FMIA 4L9PB 2CQSA 3DSXB 4XUVA 1H36A 1GAHA 1CEMA 2B4FA 2JF4A 2V8KA 3PZ1B 3RJ3A 4WVCA 3KQ4A 4GTOB 3SQCA 4GTQB 1H39A 1UG9A 4D4AA 1F9DA 1AYXA 1XWTA 1WU6A 3HXBB 3PYBA 1FCEA 1DL2A 2FUZA 1MZCB 3D5RA 3WUXA 3GLYA 4ZH5A 1JCQB 1O1TB 1KS8A 3WIRA 4DOEA 3S4AA 4D94A 1GHQA 2OKXA 4L0GA 3SFYB 2B39A 5DGQA 2RI8A 1LD7B 3QXQA 2ZIRB 1O1RB 1V7WA 1NL4B 3PZ4B 4GTMB 3EQAA 3M7CA 2ZBLA 3M76A 2P0VA 4LNGB 2H6IB 4GTRB 1G9JA 1V7XA 2EABA 1H3CA 2R2LB 4KKJA 4D4BA 4GTPB 5M7IA 1FT1B 1QSJA 4ZG8A 1H3AA 1G87A 3H7LA 3Q7FB 2D5JA 3H3KA 4ZRPA 2AHGA 3RX5A 3P2CA 1S63B 4JJJA 3SDRA 3RX8A 1WZZA 2GZ6A 3S9VA 3DSSB 1WU4A 3HXFB 1H13A 2DRQA 2PN5A 1GXMA 1CLCA 3Q7AB 1H12A 3M78A 4BOKA 4EL8A 3EUVB 4WVAA 1HZFA 1W6JA 2XWBB 1F9OA 1L1YA 2AHFA 2NVPA 1TN6B 2RI9A 3ACTA 2H6GB 1GXOA 4KTPA 1TN7B 2VN4A 4TXTA 4Z4JA 3WKIA 3A3VA 3ACSA 1N4SB 1FO3A 3QXFA 3D5SA 4QT9A 5GW7A 1G9GA 1TNOB 1IA6A 4GTTB 3ANKA 5E2JA 3K7XA 3M73A 5GY3A 3QFYA 4CE7A 3WKFA 1V7VA 2IEJB 1C3DA 3EU5B 2AFAA 1O5MB 1N4RB 1IA7A 3GT5A 2F0YB 1HCUA 1ULVA 4ZH1A 4D4DA 2ZZRA 2CQTA 3E30B 4V1RA 1N9AB 3SDUA 2A73B 4ZRQA 2BB6A 1GLMA 1WU5A 3D3IA 1FP3A 1O6HA 3P5RA 2V3PA 4YCRA 2EACA 3G6JB 5CD2A 3WKHA 2XWJB 1KRFA 3PZ3B 3WC3A 1H54A 3W5NA 4C1SA 1KREA 1QQFA 1LF6A 4KTRA 2XFGA 5AGDA 3ANJA 3H2WA 2WY8A 3W7SA 4V1SA 1V5DA 2G0DA 2FV1A 2BB5A 3DSVB 3M72A 3P5PA 2BBCA 5JPNB 1GXNA 3DSUB 1DOGA 1NI1B 3QRYA 1SQCA 3EZ8A 4M76A 3CIHA 3RX7A 3EU8A 1KFGA 3E34B 4Q88A 1O79A 1O6RA 1XW2A 4LNBB 3HXCB 4J5TA 4CJ0A 1TNBB 4CJ1A 2ZISB 3SDQA 1D8DB 3CU7A 3E33B 2A8ZA 4AYRA 4Z4LA 3S4DA 3ON6A 3Q73B 3C72B 4GL3A 4YDOB 1N94B 1GSZA 3DSTB 1W6KA 1TNYB 1TN8B 3M74A 2V3NA 1RQ5A 3W7UA 3M7LA 4FXGB 4AYPA 3RSYA 3M7EA 1QBQB 1JCRB 3ANIA 5M7YA 1G6IA 1FAEA 3Q78B 1NXCA 2V8JA 3X17A 5DGRA 5FO9B 3E37B 5FO8B 2EADA 3Q75B 1LTXB 3Q79B 3QT3A 4TF4A 3VW5A 3M77A 2D8LA 1N4QB 1TNUB 3KSLB 1KSCA 5JPMB 3GZKA 2GOXA 3QWTA 5MEHA 2GH4A 2BEDB 3M71A 1FO2A 4LIXA 1FBWA 3E73A 2VN7A 1K72A 2DRRA 3QT9A 3DPYB 3SFXB 3DSWB 2DRSA 1X9DA 2DROA 1KZOB 1UMPA 2WY7A 3PMMA 2FBAA 3K11A 3QPFA 2F6DA 3DRAB 3RENA 3SDTA 3S4BA 4AYOA 1N4PB 3KSQB 3OEDA 2H6HB 5GZKA 1N95B 3M75A 1H14A 2FV0A 3SAEA 1UT9A 2V8IA 5CA3A 3HXDB 1TNZB 4FUSA 1H3BA 1AGMA 1L2AA 5KKBA 4MBGB 4WU0A 1FPPB 3W7WA 4D4CA 3SDVA 2NOJA 1JCSB 3QDEA 1KZPB 4KKIA 3VXDA 4MU9A 1KKTA 3S4CA 3RRSA 1O1SB 4ONTA 3QG0A 1LF9A 4L6XA 1SA5B 4EHMB 2H6FB 1TF4A 3WIQA 4GTVB 3KLSA 2RGKA 3M7BA 1H37A 3QFZA 3AFJA 4AYQA 3W7XA 3OXUA 1H35A 3E32B 4BOJA 1JS4A 3HXEB 1IS9A 2YIKA 3TF4A 1LD8B 1SA4B 1S64B 1NC5A 2WYNA 3T33A 2PMVA 4DODA 2WINB 1GAIA 3QSPA 1O6QA 4FXKB 2Z07A 2SQCA 1XWQA 2QNOA 1DCEB 2I07B 1FBOA 1X81B 4WVBA 2WIIB 2JG0A 4YDEB 1KWFA 5CZLA 1V5CA 4LNVA 3E6UA 1FT2B 3W7TA 5FOBB 3WKGA 2EAEA 4Q2BA 1R76A 2XQWA 1GA2A 3WIWA 4GTSB 1KSDA 5FO7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFG A;  1F9O A;  2JJB A;  4Q88 A;  1L1Y A;  1VD5 A;  2AHF A;  1H14 A;  2FV0 A;  2NVP A;  3W5M A;  2RI9 A;  1UT9 A;  3ACT A;  1FMI A;  1XW2 A;  5CA3 A;  4J5T A;  4CJ0 A;  2CQS A;  4KTP A;  4XUV A;  4FUS A;  4CJ1 A;  1AGM A;  1L2A A;  2VN4 A;  4TXT A;  4Z4J A;  1GAH A;  1CEM A;  5KKB A;  2A8Z A;  2B4F A;  2JF4 A;  4AYR A;  4Z4L A;  4WU0 A;  4WVC A;  3S4D A;  3W7W A;  3WKI A;  3ON6 A;  3A3V A;  1UG9 A;  3QDE A;  3ACS A;  1F9D A;  3VXD A;  1AYX A;  1FO3 A;  1XWT A;  1KKT A;  3S4C A;  1WU6 A;  3RRS A;  3QXF A;  5GW7 A;  1FCE A;  1DL2 A;  2FUZ A;  1RQ5 A;  3W7U A;  3WUX A;  1G9G A;  3GLY A;  1IA6 A;  4ZH5 A;  4AYP A;  3QG0 A;  3ANK A;  1LF9 A;  1KS8 A;  4L6X A;  3RSY A;  5E2J A;  3WIR A;  4DOE A;  1TF4 A;  3S4A A;  3WIQ A;  2OKX A;  5GY3 A;  3QFY A;  2RGK A;  3ANI A;  4L0G A;  5M7Y A;  4CE7 A;  1G6I A;  3QFZ A;  1FAE A;  1V7V A;  3AFJ A;  5DGQ A;  1NXC A;  3WKF A;  4AYQ A;  2RI8 A;  3QXQ A;  3X17 A;  3W7X A;  5DGR A;  2AFA A;  1V7W A;  1JS4 A;  2EAD A;  1IA7 A;  1IS9 A;  3GT5 A;  2YIK A;  3EQA A;  1HCU A;  2ZBL A;  3TF4 A;  1ULV A;  2P0V A;  3QT3 A;  2ZZR A;  2CQT A;  4TF4 A;  3VW5 A;  1G9J A;  1NC5 A;  1V7X A;  2EAB A;  2WYN A;  3T33 A;  2D8L A;  1KSC A;  5M7I A;  4DOD A;  4ZG8 A;  3GZK A;  1GAI A;  3QSP A;  5MEH A;  3QWT A;  1G87 A;  2GH4 A;  3H7L A;  1GLM A;  1WU5 A;  3D3I A;  1FP3 A;  2Z07 A;  2D5J A;  3H3K A;  1FO2 A;  2AHG A;  3RX5 A;  1FBW A;  3P2C A;  3E73 A;  1XWQ A;  2DRR A;  1K72 A;  2EAC A;  2VN7 A;  3QT9 A;  5CD2 A;  3WKH A;  4JJJ A;  2DRS A;  3RX8 A;  1KRF A;  1WZZ A;  2GZ6 A;  2QNO A;  1X9D A;  3WC3 A;  1WU4 A;  1H54 A;  2DRO A;  1H13 A;  2DRQ A;  1FBO A;  4WVB A;  3W5N A;  1KRE A;  2JG0 A;  1LF6 A;  3PMM A;  2FBA A;  2XFG A;  4KTR A;  3K11 A;  1KWF A;  3QPF A;  2F6D A;  1V5C A;  5CZL A;  3ANJ A;  3H2W A;  3E6U A;  1CLC A;  3W7S A;  1H12 A;  3W7T A;  1V5D A;  3WKG A;  3REN A;  4EL8 A;  2EAE A;  4Q2B A;  2FV1 A;  1GA2 A;  4WVA A;  3S4B A;  3WIW A;  4AYO A;  1KSD A;  1DOG A;  3QRY A;  3EZ8 A;  3CIH A;  3RX7 A; 
#chains in the Genus database with same CATH topology
 2JJB A;  1X1H A;  3PZ2 B;  1VD5 A;  2G02 A;  3W5M A;  3PYA A;  1D8E B;  1FMI A;  4L9P B;  5IM1 A;  5IK6 A;  4DI5 A;  2CQS A;  3DSX B;  4XUV A;  2WCO A;  1H36 A;  1GAH A;  1CEM A;  2B4F A;  2JF4 A;  2V8K A;  3PZ1 B;  3RJ3 A;  4WVC A;  3KQ4 A;  4GTO B;  5EAU A;  3SQC A;  4GTQ B;  1F9G A;  1H39 A;  1UG9 A;  4D4A A;  5IKH A;  1F9D A;  1AYX A;  1XWT A;  1WU6 A;  3HXB B;  3PYB A;  1FCE A;  1DL2 A;  2FUZ A;  1MZC B;  3D5R A;  3WUX A;  3GLY A;  4ZH5 A;  1JCQ B;  1O1T B;  1KS8 A;  1CB8 A;  3WIR A;  4DOE A;  3S4A A;  1N7N A;  4D94 A;  1OJP A;  1GHQ A;  2OKX A;  4L0G A;  3G4F A;  3SFY B;  2B39 A;  5DGQ A;  2RI8 A;  1LD7 B;  3QXQ A;  1HX9 A;  2ZIR B;  1O1R B;  1V7W A;  1NL4 B;  3PZ4 B;  4GTM B;  3EQA A;  3M7C A;  2ZBL A;  3M76 A;  2P0V A;  4LNG B;  2H6I B;  5DHK A;  4GTR B;  1G9J A;  1V7X A;  2EAB A;  1H3C A;  2R2L B;  4KKJ A;  4D4B A;  4GTP B;  5M7I A;  1FT1 B;  1QSJ A;  4ZG8 A;  1H3A A;  2WDA A;  1G87 A;  3H7L A;  3Q7F B;  1RWG A;  2D5J A;  3H3K A;  1OJM A;  4ZRP A;  3M00 A;  2AHG A;  3RX5 A;  3P2C A;  1S63 B;  5ILZ A;  4JJJ A;  3SDR A;  3RX8 A;  1WZZ A;  2GZ6 A;  3S9V A;  3DSS B;  1WU4 A;  3HXF B;  1H13 A;  2DRQ A;  2PN5 A;  1QAZ A;  1GXM A;  5C05 A;  1CLC A;  3Q7A B;  1H12 A;  3M78 A;  4BOK A;  4EL8 A;  1W3Y A;  1J0M A;  3EUV B;  4WVA A;  1HZF A;  1W6J A;  2XWB B;  1F9O A;  1L1Y A;  2AHF A;  2NVP A;  2ONH A;  1TN6 B;  2RI9 A;  3ACT A;  2H6G B;  1GXO A;  4KTP A;  1TN7 B;  1LXM A;  2VN4 A;  4TXT A;  4Z4J A;  3WKI A;  3A3V A;  1N1B A;  3ACS A;  5IK0 A;  1N4S B;  1FO3 A;  3AFL A;  3QXF A;  1HMU A;  3D5S A;  4QT9 A;  5GW7 A;  1RWH A;  3N0G A;  1G9G A;  1TNO B;  1IA6 A;  4GTT B;  3ANK A;  3N0F A;  5ILD A;  5E2J A;  3K7X A;  4F10 A;  3M73 A;  5GY3 A;  1RWC A;  3QFY A;  1N7P A;  4CE7 A;  3WKF A;  1V7V A;  2IEJ B;  1C3D A;  3EU5 B;  4F13 A;  2AFA A;  1O5M B;  1N4R B;  1IA7 A;  3GT5 A;  1N7R A;  2F0Y B;  1HCU A;  1HMW A;  1ULV A;  4ZH1 A;  4D4D A;  2ZZR A;  2CQT A;  1N1Z A;  3E30 B;  4V1R A;  4GAX A;  1N9A B;  3SDU A;  2A73 B;  4ZRQ A;  2BB6 A;  1GLM A;  1WU5 A;  3D3I A;  1FP3 A;  1RW9 A;  1O6H A;  3P5R A;  5ILJ A;  2V3P A;  4YCR A;  2EAC A;  3G6J B;  5CD2 A;  3WKH A;  4E1Y A;  2XWJ B;  1KRF A;  5ILK A;  3PZ3 B;  3WC3 A;  1LOH A;  1H54 A;  5ILH A;  1HXC A;  5EAS A;  3W5N A;  4C1S A;  1KRE A;  1QQF A;  1LF6 A;  4KTR A;  1I8Q A;  1RWF A;  2XFG A;  5AGD A;  3ANJ A;  3H2W A;  2WY8 A;  3W7S A;  4V1S A;  1V5D A;  2G0D A;  5IK9 A;  2FV1 A;  2BB5 A;  3DSV B;  3M72 A;  1HXA A;  3P5P A;  2BBC A;  5JPN B;  1GXN A;  3DSU B;  1DOG A;  1NI1 B;  3QRY A;  1SQC A;  3EZ8 A;  4M76 A;  3CIH A;  3RX7 A;  3EU8 A;  1KFG A;  1N20 A;  3E34 B;  4Q88 A;  1O79 A;  1N22 A;  1O6R A;  1XW2 A;  4LNB B;  3HXC B;  2BRW A;  4J5T A;  4CJ0 A;  1TNB B;  4CJ1 A;  2ZIS B;  4OZW A;  3SDQ A;  1D8D B;  3CU7 A;  3VSM A;  3E33 B;  2A8Z A;  2Q1F A;  4AYR A;  4Z4L A;  3S4D A;  3ON6 A;  3Q73 B;  3C72 B;  4GL3 A;  4YDO B;  1N94 B;  4OK4 A;  1GSZ A;  3DST B;  1W6K A;  1TNY B;  4OZV A;  5ILI A;  1TN8 B;  1C82 A;  5EAT A;  3E80 A;  3M74 A;  2V3N A;  5DHI A;  1RQ5 A;  3W7U A;  3M7L A;  1J0N A;  4FXG B;  4AYP A;  3RSY A;  3NFV A;  1HV6 A;  3M7E A;  1QBQ B;  1JCR B;  3ANI A;  1X1I A;  5M7Y A;  2ONG A;  1G6I A;  1N7Q A;  1FAE A;  3Q78 B;  1NXC A;  2V8J A;  2BRP A;  3X17 A;  5DGR A;  5IL3 A;  5FO9 B;  3E37 B;  5FO8 B;  1LXK A;  2EAD A;  3Q75 B;  1LTX B;  3Q79 B;  3QT3 A;  4TF4 A;  1OJN A;  3VW5 A;  3M77 A;  2D8L A;  1N4Q B;  1TNU B;  3KSL B;  1KSC A;  5JPM B;  3GZK A;  2GOX A;  3QWT A;  5MEH A;  2GH4 A;  2BED B;  2FUQ A;  3M71 A;  1FO2 A;  4LIX A;  1FBW A;  3E73 A;  2VN7 A;  1K72 A;  2DRR A;  3QT9 A;  3DPY B;  3SFX B;  3DSW B;  2DRS A;  1X9D A;  1N23 A;  2DRO A;  1KZO B;  1UMP A;  1EGU A;  2WY7 A;  3PMM A;  2FBA A;  3K11 A;  3QPF A;  2F6D A;  2E24 A;  3DRA B;  2FUT A;  3REN A;  3SDT A;  3S4B A;  4AYO A;  1N4P B;  1N24 A;  3KSQ B;  3OED A;  2H6H B;  4OJZ A;  5GZK A;  1N95 B;  3M75 A;  1H14 A;  2FV0 A;  3SAE A;  1UT9 A;  5ILY A;  2V8I A;  5CA3 A;  3HXD B;  1TNZ B;  4FUS A;  1H3B A;  1AGM A;  4MMI A;  1L2A A;  2E22 A;  5KKB A;  4MBG B;  4WU0 A;  1FPP B;  3W7W A;  1HM2 A;  3SDV A;  4D4C A;  2NOJ A;  1JCS B;  3A0O A;  1KZP B;  3QDE A;  4KKI A;  3VXD A;  5IKA A;  4MU9 A;  1KKT A;  1N7O A;  3S4C A;  3RRS A;  1O1S B;  3NNB A;  1HN0 A;  4ONT A;  3G4D A;  3QG0 A;  1LF9 A;  4L6X A;  1SA5 B;  4EHM B;  2H6F B;  4MMH A;  1TF4 A;  3WIQ A;  4GTV B;  3KLS A;  2RGK A;  3M7B A;  1H37 A;  1HM3 A;  1F1S A;  3QFZ A;  3AFJ A;  4FNV A;  4AYQ A;  2J5C A;  3W7X A;  3OXU A;  3LZ9 A;  1H35 A;  3E32 B;  5JMF A;  4BOJ A;  1JS4 A;  3HXE B;  2X03 A;  1IS9 A;  2YIK A;  3TF4 A;  4NEI A;  1HXG A;  1RWA A;  1LD8 B;  1SA4 B;  1S64 B;  1NC5 A;  2WYN A;  3T33 A;  2PMV A;  4DOD A;  2WIN B;  1GAI A;  3QSP A;  2BRV X;  1O6Q A;  4FXK B;  1X1J A;  2Z07 A;  5JMD A;  5IL8 A;  2SQC A;  1N21 A;  1XWQ A;  1OJO A;  3M02 A;  2QNO A;  1DCE B;  2I07 B;  1FBO A;  1X81 B;  4WVB A;  2WII B;  2JG0 A;  4YDE B;  1KWF A;  3M01 A;  5CZL A;  1V5C A;  4LNV A;  3E6U A;  4RNQ A;  1FT2 B;  3W7T A;  5FOB B;  3WKG A;  4FJQ A;  2EAE A;  4Q2B A;  1R76 A;  2XQW A;  1GA2 A;  3E7J A;  3WIW A;  4GTS B;  1KSD A;  5FO7 B;  3VSN A;  4OK2 A; 
#chains in the Genus database with same CATH homology
 2JJB A;  3PZ2 B;  1VD5 A;  2G02 A;  3W5M A;  3PYA A;  1D8E B;  1FMI A;  4L9P B;  2CQS A;  3DSX B;  4XUV A;  1H36 A;  1GAH A;  1CEM A;  2B4F A;  2JF4 A;  2V8K A;  3PZ1 B;  3RJ3 A;  4WVC A;  3KQ4 A;  4GTO B;  3SQC A;  4GTQ B;  1H39 A;  1UG9 A;  4D4A A;  1F9D A;  1AYX A;  1XWT A;  1WU6 A;  3HXB B;  3PYB A;  1FCE A;  1DL2 A;  2FUZ A;  1MZC B;  3D5R A;  3WUX A;  3GLY A;  4ZH5 A;  1JCQ B;  1O1T B;  1KS8 A;  3WIR A;  4DOE A;  3S4A A;  4D94 A;  1GHQ A;  2OKX A;  4L0G A;  3SFY B;  2B39 A;  5DGQ A;  2RI8 A;  1LD7 B;  3QXQ A;  2ZIR B;  1O1R B;  1V7W A;  1NL4 B;  3PZ4 B;  4GTM B;  3EQA A;  3M7C A;  2ZBL A;  3M76 A;  2P0V A;  4LNG B;  2H6I B;  4GTR B;  1G9J A;  1V7X A;  2EAB A;  1H3C A;  2R2L B;  4KKJ A;  4D4B A;  4GTP B;  5M7I A;  1FT1 B;  1QSJ A;  4ZG8 A;  1H3A A;  1G87 A;  3H7L A;  3Q7F B;  2D5J A;  3H3K A;  4ZRP A;  2AHG A;  3RX5 A;  3P2C A;  1S63 B;  4JJJ A;  3SDR A;  3RX8 A;  1WZZ A;  2GZ6 A;  3S9V A;  3DSS B;  1WU4 A;  3HXF B;  1H13 A;  2DRQ A;  2PN5 A;  1GXM A;  1CLC A;  3Q7A B;  1H12 A;  3M78 A;  4BOK A;  4EL8 A;  3EUV B;  4WVA A;  1HZF A;  1W6J A;  2XWB B;  1F9O A;  1L1Y A;  2AHF A;  2NVP A;  1TN6 B;  2RI9 A;  3ACT A;  2H6G B;  1GXO A;  4KTP A;  1TN7 B;  2VN4 A;  4TXT A;  4Z4J A;  3WKI A;  3A3V A;  3ACS A;  1N4S B;  1FO3 A;  3QXF A;  3D5S A;  4QT9 A;  5GW7 A;  1G9G A;  1TNO B;  1IA6 A;  4GTT B;  3ANK A;  5E2J A;  3K7X A;  3M73 A;  5GY3 A;  3QFY A;  4CE7 A;  3WKF A;  1V7V A;  2IEJ B;  1C3D A;  3EU5 B;  2AFA A;  1O5M B;  1N4R B;  1IA7 A;  3GT5 A;  2F0Y B;  1HCU A;  1ULV A;  4ZH1 A;  4D4D A;  2ZZR A;  2CQT A;  3E30 B;  4V1R A;  1N9A B;  3SDU A;  2A73 B;  4ZRQ A;  2BB6 A;  1GLM A;  1WU5 A;  3D3I A;  1FP3 A;  1O6H A;  3P5R A;  2V3P A;  4YCR A;  2EAC A;  3G6J B;  5CD2 A;  3WKH A;  2XWJ B;  1KRF A;  3PZ3 B;  3WC3 A;  1H54 A;  3W5N A;  4C1S A;  1KRE A;  1QQF A;  1LF6 A;  4KTR A;  2XFG A;  5AGD A;  3ANJ A;  3H2W A;  2WY8 A;  3W7S A;  4V1S A;  1V5D A;  2G0D A;  2FV1 A;  2BB5 A;  3DSV B;  3M72 A;  3P5P A;  2BBC A;  5JPN B;  1GXN A;  3DSU B;  1DOG A;  1NI1 B;  3QRY A;  1SQC A;  3EZ8 A;  4M76 A;  3CIH A;  3RX7 A;  3EU8 A;  1KFG A;  3E34 B;  4Q88 A;  1O79 A;  1O6R A;  1XW2 A;  4LNB B;  3HXC B;  4J5T A;  4CJ0 A;  1TNB B;  4CJ1 A;  2ZIS B;  3SDQ A;  1D8D B;  3CU7 A;  3E33 B;  2A8Z A;  4AYR A;  4Z4L A;  3S4D A;  3ON6 A;  3Q73 B;  3C72 B;  4GL3 A;  4YDO B;  1N94 B;  1GSZ A;  3DST B;  1W6K A;  1TNY B;  1TN8 B;  3M74 A;  2V3N A;  1RQ5 A;  3W7U A;  3M7L A;  4FXG B;  4AYP A;  3RSY A;  3M7E A;  1QBQ B;  1JCR B;  3ANI A;  5M7Y A;  1G6I A;  1FAE A;  3Q78 B;  1NXC A;  2V8J A;  3X17 A;  5DGR A;  5FO9 B;  3E37 B;  5FO8 B;  2EAD A;  3Q75 B;  1LTX B;  3Q79 B;  3QT3 A;  4TF4 A;  3VW5 A;  3M77 A;  2D8L A;  1N4Q B;  1TNU B;  3KSL B;  1KSC A;  5JPM B;  3GZK A;  2GOX A;  3QWT A;  5MEH A;  2GH4 A;  2BED B;  3M71 A;  1FO2 A;  4LIX A;  1FBW A;  3E73 A;  2VN7 A;  1K72 A;  2DRR A;  3QT9 A;  3DPY B;  3SFX B;  3DSW B;  2DRS A;  1X9D A;  2DRO A;  1KZO B;  1UMP A;  2WY7 A;  3PMM A;  2FBA A;  3K11 A;  3QPF A;  2F6D A;  3DRA B;  3REN A;  3SDT A;  3S4B A;  4AYO A;  1N4P B;  3KSQ B;  3OED A;  2H6H B;  5GZK A;  1N95 B;  3M75 A;  1H14 A;  2FV0 A;  3SAE A;  1UT9 A;  2V8I A;  5CA3 A;  3HXD B;  1TNZ B;  4FUS A;  1H3B A;  1AGM A;  1L2A A;  5KKB A;  4MBG B;  4WU0 A;  1FPP B;  3W7W A;  4D4C A;  3SDV A;  2NOJ A;  1JCS B;  3QDE A;  1KZP B;  4KKI A;  3VXD A;  4MU9 A;  1KKT A;  3S4C A;  3RRS A;  1O1S B;  4ONT A;  3QG0 A;  1LF9 A;  4L6X A;  1SA5 B;  4EHM B;  2H6F B;  1TF4 A;  3WIQ A;  4GTV B;  3KLS A;  2RGK A;  3M7B A;  1H37 A;  3QFZ A;  3AFJ A;  4AYQ A;  3W7X A;  3OXU A;  1H35 A;  3E32 B;  4BOJ A;  1JS4 A;  3HXE B;  1IS9 A;  2YIK A;  3TF4 A;  1LD8 B;  1SA4 B;  1S64 B;  1NC5 A;  2WYN A;  3T33 A;  2PMV A;  4DOD A;  2WIN B;  1GAI A;  3QSP A;  1O6Q A;  4FXK B;  2Z07 A;  2SQC A;  1XWQ A;  2QNO A;  1DCE B;  2I07 B;  1FBO A;  1X81 B;  4WVB A;  2WII B;  2JG0 A;  4YDE B;  1KWF A;  5CZL A;  1V5C A;  4LNV A;  3E6U A;  1FT2 B;  3W7T A;  5FOB B;  3WKG A;  2EAE A;  4Q2B A;  1R76 A;  2XQW A;  1GA2 A;  3WIW A;  4GTS B;  1KSD A;  5FO7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...