1LTXB

Structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
326
structure length
318
Chain Sequence
KDVTIKSDPDTLLLEKHADYIASYGSCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/protein binding
molecule keywords RAB GERANYLGERANYLTRANSFERASE ALPHA SUBUNIT
publication title Structure of Rab Escort Protein-1 in Complex with Rab Geranylgeranyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 105
structure length 318
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2002-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ltxB00
1NL4B 3EUVB 1TN6B 1TN8B 3DSTB 1H37A 1SA5B 2BBCA 1TNBB 2H6IB 2BEDB 1N9AB 1KZPB 1C3DA 4C1SA 2A73B 4YDEB 1H3BA 3C72B 5FOBB 3DRAB 4GTMB 2V3PA 1HZFA 1DCEB 1O6RA 1JCRB 1GXNA 4ZRPA 3RJ3A 1O1TB 4D4DA 1SQCA 1TNZB 2XWJB 1N4QB 2GOXA 4GTOB 4D4AA 3OEDA 1SA4B 1O5MB 1TN7B 2XWBB 4D4CA 1GXOA 5AGDA 2I07B 2H6GB 4GTVB 1O6HA 3KSQB 3K7XA 3OXUA 1UMPA 1FPPB 1H39A 2R2LB 3DSSB 5FO8B 2WIIB 4ZH1A 2ZIRB 4YDOB 1KZOB 1D8DB 3EU5B 1TNUB 3PZ1B 3CU7A 3PZ4B 4V1RA 1N4RB 5JPNB 1LD7B 1LTXB 4GTQB 1GSZA 3Q73B 1X81B 2WINB 3DPYB 2G0DA 3HXBB 2G02A 2PN5A 2NOJA 3D5RA 1TNYB 4M76A 1FT2B 1NI1B 2F0YB 2V8KA 4V1SA 1GXMA 2SQCA 4FXKB 4BOKA 1O6QA 3Q79B 3E34B 5FO7B 3KQ4A 3Q78B 4GTRB 3PZ3B 2WY8A 4LNGB 5FO9B 3Q7FB 1H3CA 1FT1B 1QBQB 1LD8B 3DSUB 2B39A 3D5SA 1N95B 1O1SB 4MU9A 1H35A 4KKIA 1GHQA 4KKJA 4BOJA 2XQWA 2V3NA 2H6HB 2WY7A 3KLSA 2PMVA 1W6KA 2IEJB 1R76A 1N4PB 1S63B 2BB5A 3SFYB 1QSJA 4D4BA 3HXFB 3KSLB 1D8EB 3HXDB 3SFXB 1O1RB 3G6JB 3Q7AB 4D94A 4EHMB 1MZCB 2V8IA 4ONTA 2V8JA 3HXEB 1QQFA 5JPMB 3E33B 4L9PB 1TNOB 3Q75B 1JCSB 1W6JA 3SQCA 3E32B 4LNBB 3HXCB 4GTTB 1N94B 1JCQB 4MBGB 3PZ2B 3DSWB 4ZRQA 4FXGB 4GTPB 3DSVB 3E37B 1H3AA 2BB6A 2ZISB 1S64B 4GTSB 1N4SB 2H6FB 1O79A 3DSXB 1H36A 4LNVA 3E30B
chains in the Genus database with same CATH superfamily
1NL4B 2AFAA 3QPFA 1CB8A 3EUVB 1LF9A 1N22A 1N7RA 1N1ZA 3DSTB 1H37A 1SA5B 1TNBB 1X1JA 2H6IB 1N9AB 2DROA 3N0GA 3QXFA 1KZPB 3PMMA 1WZZA 1FP3A 5FOBB 1DCEB 1GXNA 4D4DA 1O1TB 1XWTA 1OJMA 1SQCA 2XWJB 4GL3A 5CZLA 1LXKA 1HV6A 3OEDA 1L1YA 5CA3A 3M72A 4Z4LA 4MMIA 5ILDA 1F9DA 2I07B 3M77A 1HXCA 2RI8A 1HX9A 5IKHA 1UMPA 2RI9A 5IK0A 1AYXA 1D8DB 1XW2A 5M7YA 3NNBA 3EU5B 3M71A 2DRSA 3PZ4B 4V1RA 2EADA 1X1IA 4OJZA 2BRWA 5DGQA 1X81B 2G0DA 3SDVA 2NOJA 3D5RA 2E24A 3M78A 1NI1B 4DODA 3WIQA 2V8KA 1FCEA 1KSDA 3S4DA 4V1SA 1GXMA 4FXKB 5ILZA 3PZ3B 3VW5A 4LNGB 4Q2BA 3Q7FB 3W7XA 3DSUB 2B39A 3H7LA 1N95B 3H2WA 4KKIA 1HCUA 5ILHA 2FBAA 1XWQA 3QFYA 1AGMA 1J0MA 3AFLA 1UT9A 5DHKA 5KKBA 2H6HB 3KLSA 1W6KA 2WCOA 1N4PB 3QRYA 4DI5A 3P2CA 1RWHA 3QFZA 2X03A 3A3VA 1G6IA 4EHMB 3QSPA 4ONTA 3M7BA 3A0OA 5JPMB 4Q88A 3N0FA 2B4FA 3Q75B 3GT5A 3SQCA 3E32B 4LNBB 3HXCB 4GTTB 1N94B 1X1HA 4ZG8A 3DSWB 3EU8A 4FXGB 4GTPB 2OKXA 4L0GA 2H6FB 5M7IA 3S9VA 3GLYA 5GZKA 3QDEA 1TN6B 1TN8B 2AHGA 2BBCA 3WKIA 2EACA 2BEDB 3ANJA 4YDEB 3W7TA 1H3BA 3C72B 3QWTA 4GAXA 1JCRB 1FO2A 3RJ3A 4GTOB 3SDUA 4D4AA 3RX5A 5AGDA 4GTVB 4L6XA 2A8ZA 4LIXA 3M75A 2WDAA 2WIIB 3VXDA 4NEIA 4XUVA 3SDTA 4TXTA 4YDOB 1L2AA 3QXQA 1IS9A 4FUSA 2BRPA 1KFGA 2FUQA 2RGKA 2ZBLA 5JPNB 4YCRA 3SDQA 1V7WA 1HMWA 3Q73B 1GAHA 3DPYB 1V5CA 4WU0A 3PYAA 4KTRA 3P5PA 3S4BA 1N21A 4TF4A 4OK4A 1F1SA 4BOKA 3X17A 1WU6A 1CEMA 5FO9B 1RWGA 1WU4A 1LD8B 2P0VA 5ILKA 1N20A 3RX8A 5IL3A 1W3YA 3WKHA 3QG0A 3M74A 2JJBA 2ONHA 5IK6A 3T33A 2YIKA 1HM3A 2WY7A 1FBOA 2IEJB 2DRQA 3E73A 2FUZA 3KSLB 3PYBA 3HXDB 3Q7AB 1K72A 2V8IA 1V7VA 1QQFA 4AYQA 1JCSB 1W6JA 3ACSA 4QT9A 2GH4A 4AYPA 3PZ2B 3SAEA 4ZRQA 5JMFA 1UG9A 3DSVB 3E37B 2BB6A 1QAZA 2ZISB 1H14A 4KTPA 3K11A 1S64B 2FV0A 4EL8A 1RWAA 1CLCA 3GZKA 3S4AA 3P5RA 5E2JA 3M02A 2FUTA 1LF6A 3RSYA 4C1SA 2A73B 3ANKA 1LOHA 3DRAB 2V3PA 1HZFA 1O6RA 4ZRPA 3E6UA 1C82A 4ZH5A 2VN7A 2EABA 1O5MB 5IKAA 4FNVA 3W7SA 1RWCA 3M7EA 3SDRA 4E1YA 5EATA 1G9JA 3KSQB 1LXMA 2R2LB 1H39A 3M01A 2Z07A 4J5TA 2BRVX 1OJNA 1TF4A 1VD5A 5C05A 5GY3A 1N1BA 1TNUB 3M73A 1LTXB 3RRSA 1IA7A 3LZ9A 2G02A 4Z4JA 2D5JA 1TNYB 1NC5A 4M76A 2F0YB 4AYRA 4OK2A 1O6QA 1KREA 3ON6A 3Q79B 5FO7B 3KQ4A 4GTRB 1EGUA 1OJPA 3ACTA 4AYOA 2CQTA 1QBQB 1FBWA 3WIRA 3D5SA 3WC3A 3M76A 4MU9A 1GHQA 2EAEA 4CE7A 4BOJA 2XQWA 2V3NA 3ANIA 3RX7A 2PMVA 3SFYB 1QSJA 3NFVA 1RWFA 4D4BA 1OJOA 3G4DA 3HXFB 1KRFA 3M7CA 1D8EB 3SFXB 2JG0A 3G6JB 4D94A 4MMHA 3VSNA 3EZ8A 1V7XA 1KKTA 1V5DA 2V8JA 4DOEA 3E33B 1I8QA 1DOGA 1GAIA 1FAEA 4WVBA 3WKGA 5EASA 4OZVA 1JS4A 2WYNA 1JCQB 4JJJA 4OZWA 1F9OA 3WIWA 2NVPA 1N4SB 3AFJA 5ILYA 1IA6A 1C3DA 1NXCA 5GW7A 3WKFA 4F10A 2DRRA 2JF4A 3QT3A 5DHIA 4GTMB 1TNZB 1G9GA 1N4QB 2GOXA 1SA4B 1X9DA 1TN7B 2XWBB 1RW9A 4F13A 4WVCA 1HXAA 4D4CA 2VN4A 3W5MA 2FV1A 1GXOA 2F6DA 2QNOA 5MEHA 2H6GB 1O6HA 3W7WA 1N23A 2E22A 3K7XA 3H3KA 4RNQA 3OXUA 1J0NA 1HN0A 1FPPB 5ILJA 3DSSB 5FO8B 3VSMA 4ZH1A 1N7NA 2ZIRB 3G4FA 1H12A 1KZOB 1HXGA 1N7PA 3PZ1B 3CU7A 1N4RB 1FMIA 1KSCA 3E80A 3TF4A 1LD7B 4GTQB 1GSZA 2Q1FA 2WINB 3HXBB 3QT9A 2PN5A 1N7OA 1FT2B 3M7LA 1GLMA 2GZ6A 3EQAA 5EAUA 2SQCA 1G87A 3E34B 2D8LA 3Q78B 3M00A 1FO3A 2WY8A 3WUXA 5CD2A 1GA2A 3W5NA 1H3CA 1H54A 1FT1B 2ZZRA 3E7JA 4FJQA 5ILIA 1O1SB 1H35A 5DGRA 4KKJA 5JMDA 3RENA 4CJ0A 1R76A 1S63B 2BB5A 3CIHA 5IK9A 5IL8A 3S4CA 1DL2A 2CQSA 1HMUA 1KS8A 1ULVA 1O1RB 4CJ1A 1MZCB 3HXEB 1F9GA 1KWFA 4L9PB 1TNOB 2J5CA 1H13A 1WU5A 1RQ5A 4MBGB 1HM2A 1N24A 1N7QA 2XFGA 1H3AA 3D3IA 5IM1A 4GTSB 4LNVA 4WVAA 1O79A 2ONGA 1H36A 3DSXB 3W7UA 2AHFA 3E30B
chains in the Genus database with same CATH topology
1NL4B 2AFAA 3QPFA 3EUVB 1LF9A 3DSTB 1H37A 1SA5B 1TNBB 2H6IB 1N9AB 2DROA 3QXFA 1KZPB 3PMMA 1WZZA 1FP3A 5FOBB 1DCEB 1GXNA 4D4DA 1O1TB 1XWTA 1SQCA 2XWJB 4GL3A 5CZLA 3OEDA 1L1YA 5CA3A 3M72A 4Z4LA 1F9DA 2I07B 3M77A 2RI8A 1UMPA 2RI9A 1AYXA 1D8DB 1XW2A 5M7YA 3EU5B 3M71A 2DRSA 3PZ4B 4V1RA 2EADA 5DGQA 1X81B 2G0DA 3SDVA 2NOJA 3D5RA 3M78A 1NI1B 4DODA 3WIQA 2V8KA 1FCEA 1KSDA 3S4DA 4V1SA 1GXMA 4FXKB 3PZ3B 3VW5A 4LNGB 4Q2BA 3Q7FB 3W7XA 3DSUB 2B39A 3H7LA 1N95B 3H2WA 4KKIA 1HCUA 2FBAA 1XWQA 3QFYA 1AGMA 1UT9A 5KKBA 2H6HB 3KLSA 1W6KA 1N4PB 3QRYA 3P2CA 3QFZA 3A3VA 1G6IA 4EHMB 3QSPA 4ONTA 3M7BA 5JPMB 4Q88A 2B4FA 3Q75B 3GT5A 3SQCA 3E32B 4LNBB 3HXCB 4GTTB 1N94B 4ZG8A 3DSWB 3EU8A 4FXGB 4GTPB 2OKXA 4L0GA 2H6FB 5M7IA 3S9VA 3GLYA 5GZKA 3QDEA 1TN6B 1TN8B 2AHGA 2BBCA 3WKIA 2EACA 2BEDB 3ANJA 4YDEB 3W7TA 1H3BA 3C72B 3QWTA 1JCRB 1FO2A 3RJ3A 4GTOB 3SDUA 4D4AA 3RX5A 5AGDA 4GTVB 4L6XA 2A8ZA 4LIXA 3M75A 2WIIB 3VXDA 4XUVA 3SDTA 4TXTA 4YDOB 1L2AA 3QXQA 1IS9A 4FUSA 1KFGA 2RGKA 2ZBLA 5JPNB 4YCRA 3SDQA 1V7WA 3Q73B 1GAHA 3DPYB 1V5CA 4WU0A 3PYAA 4KTRA 3P5PA 3S4BA 4TF4A 4BOKA 3X17A 1WU6A 1CEMA 5FO9B 1WU4A 1LD8B 2P0VA 3RX8A 3WKHA 3QG0A 3M74A 2JJBA 3T33A 2YIKA 2WY7A 1FBOA 2IEJB 2DRQA 3E73A 2FUZA 3KSLB 3PYBA 3HXDB 3Q7AB 1K72A 2V8IA 1V7VA 1QQFA 4AYQA 1JCSB 1W6JA 3ACSA 4QT9A 2GH4A 4AYPA 3PZ2B 3SAEA 4ZRQA 1UG9A 3DSVB 3E37B 2BB6A 2ZISB 1H14A 4KTPA 3K11A 1S64B 2FV0A 4EL8A 1CLCA 3GZKA 3S4AA 3P5RA 5E2JA 1LF6A 3RSYA 4C1SA 2A73B 3ANKA 3DRAB 2V3PA 1HZFA 1O6RA 4ZRPA 3E6UA 4ZH5A 2VN7A 2EABA 1O5MB 3W7SA 3M7EA 3SDRA 1G9JA 3KSQB 2R2LB 1H39A 2Z07A 4J5TA 1VD5A 1TF4A 5GY3A 1TNUB 3M73A 1LTXB 3RRSA 1IA7A 2G02A 4Z4JA 2D5JA 1TNYB 1NC5A 4M76A 2F0YB 4AYRA 1O6QA 1KREA 3ON6A 3Q79B 5FO7B 3KQ4A 4GTRB 3ACTA 4AYOA 2CQTA 1QBQB 1FBWA 3WIRA 3D5SA 3WC3A 3M76A 4MU9A 1GHQA 2EAEA 4CE7A 4BOJA 2XQWA 2V3NA 3ANIA 3RX7A 2PMVA 3SFYB 1QSJA 4D4BA 3HXFB 1KRFA 3M7CA 1D8EB 3SFXB 2JG0A 3G6JB 4D94A 3EZ8A 1V7XA 1KKTA 1V5DA 2V8JA 4DOEA 3E33B 1DOGA 1GAIA 1FAEA 4WVBA 3WKGA 1JS4A 2WYNA 1JCQB 4JJJA 1F9OA 3WIWA 2NVPA 1N4SB 3AFJA 1IA6A 1C3DA 1NXCA 5GW7A 3WKFA 2DRRA 2JF4A 3QT3A 4GTMB 1TNZB 1G9GA 1N4QB 2GOXA 1SA4B 1X9DA 1TN7B 2XWBB 4WVCA 4D4CA 2VN4A 3W5MA 2FV1A 1GXOA 2F6DA 2QNOA 5MEHA 2H6GB 1O6HA 3W7WA 3K7XA 3H3KA 3OXUA 1FPPB 3DSSB 5FO8B 4ZH1A 2ZIRB 1H12A 1KZOB 3PZ1B 3CU7A 1N4RB 1FMIA 1KSCA 3TF4A 1LD7B 4GTQB 1GSZA 2WINB 3HXBB 3QT9A 2PN5A 1FT2B 3M7LA 1GLMA 2GZ6A 3EQAA 2SQCA 1G87A 3E34B 2D8LA 3Q78B 1FO3A 2WY8A 3WUXA 5CD2A 1GA2A 3W5NA 1H3CA 1H54A 1FT1B 2ZZRA 1O1SB 1H35A 5DGRA 4KKJA 3RENA 4CJ0A 1R76A 1S63B 2BB5A 3CIHA 3S4CA 1DL2A 2CQSA 1KS8A 1ULVA 1O1RB 4CJ1A 1MZCB 3HXEB 1KWFA 4L9PB 1TNOB 1H13A 1WU5A 1RQ5A 4MBGB 2XFGA 1H3AA 3D3IA 4GTSB 4LNVA 4WVAA 1O79A 3DSXB 1H36A 3W7UA 2AHFA 3E30B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NL4 B;  3EUV B;  1TN6 B;  1TN8 B;  3DST B;  1H37 A;  1SA5 B;  2BBC A;  1TNB B;  2H6I B;  2BED B;  1N9A B;  1KZP B;  1C3D A;  4C1S A;  2A73 B;  4YDE B;  1H3B A;  3C72 B;  5FOB B;  3DRA B;  4GTM B;  2V3P A;  1HZF A;  1DCE B;  1O6R A;  1JCR B;  1GXN A;  4ZRP A;  3RJ3 A;  1O1T B;  4D4D A;  1SQC A;  1TNZ B;  2XWJ B;  1N4Q B;  2GOX A;  4GTO B;  4D4A A;  3OED A;  1SA4 B;  1O5M B;  1TN7 B;  2XWB B;  4D4C A;  1GXO A;  5AGD A;  2I07 B;  2H6G B;  4GTV B;  1O6H A;  3KSQ B;  3K7X A;  3OXU A;  1UMP A;  1FPP B;  1H39 A;  2R2L B;  3DSS B;  5FO8 B;  2WII B;  4ZH1 A;  2ZIR B;  4YDO B;  1KZO B;  1D8D B;  3EU5 B;  1TNU B;  3PZ1 B;  3CU7 A;  3PZ4 B;  4V1R A;  1N4R B;  5JPN B;  1LD7 B;  1LTX B;  4GTQ B;  1GSZ A;  3Q73 B;  1X81 B;  2WIN B;  3DPY B;  2G0D A;  3HXB B;  2G02 A;  2PN5 A;  2NOJ A;  3D5R A;  1TNY B;  4M76 A;  1FT2 B;  1NI1 B;  2F0Y B;  2V8K A;  4V1S A;  1GXM A;  2SQC A;  4FXK B;  4BOK A;  1O6Q A;  3Q79 B;  3E34 B;  5FO7 B;  3KQ4 A;  3Q78 B;  4GTR B;  3PZ3 B;  2WY8 A;  4LNG B;  5FO9 B;  3Q7F B;  1H3C A;  1FT1 B;  1QBQ B;  1LD8 B;  3DSU B;  2B39 A;  3D5S A;  1N95 B;  1O1S B;  4MU9 A;  1H35 A;  4KKI A;  1GHQ A;  4KKJ A;  4BOJ A;  2XQW A;  2V3N A;  2H6H B;  2WY7 A;  3KLS A;  2PMV A;  1W6K A;  2IEJ B;  1R76 A;  1N4P B;  1S63 B;  2BB5 A;  3SFY B;  1QSJ A;  4D4B A;  3HXF B;  3KSL B;  1D8E B;  3HXD B;  3SFX B;  1O1R B;  3G6J B;  3Q7A B;  4D94 A;  4EHM B;  1MZC B;  2V8I A;  4ONT A;  2V8J A;  3HXE B;  1QQF A;  5JPM B;  3E33 B;  4L9P B;  1TNO B;  3Q75 B;  1JCS B;  1W6J A;  3SQC A;  3E32 B;  4LNB B;  3HXC B;  4GTT B;  1N94 B;  1JCQ B;  4MBG B;  3PZ2 B;  3DSW B;  4ZRQ A;  4FXG B;  4GTP B;  3DSV B;  3E37 B;  1H3A A;  2BB6 A;  2ZIS B;  1S64 B;  4GTS B;  1N4S B;  2H6F B;  1O79 A;  3DSX B;  1H36 A;  4LNV A;  3E30 B; 
#chains in the Genus database with same CATH topology
 1NL4 B;  2AFA A;  3QPF A;  1CB8 A;  3EUV B;  1LF9 A;  1N22 A;  1N7R A;  1N1Z A;  3DST B;  1H37 A;  1SA5 B;  1TNB B;  1X1J A;  2H6I B;  1N9A B;  2DRO A;  3N0G A;  3QXF A;  1KZP B;  3PMM A;  1WZZ A;  1FP3 A;  5FOB B;  1DCE B;  1GXN A;  4D4D A;  1O1T B;  1XWT A;  1OJM A;  1SQC A;  2XWJ B;  4GL3 A;  5CZL A;  1LXK A;  1HV6 A;  3OED A;  1L1Y A;  5CA3 A;  3M72 A;  4Z4L A;  4MMI A;  5ILD A;  1F9D A;  2I07 B;  3M77 A;  1HXC A;  2RI8 A;  1HX9 A;  5IKH A;  1UMP A;  2RI9 A;  5IK0 A;  1AYX A;  1D8D B;  1XW2 A;  5M7Y A;  3NNB A;  3EU5 B;  3M71 A;  2DRS A;  3PZ4 B;  4V1R A;  2EAD A;  1X1I A;  4OJZ A;  2BRW A;  5DGQ A;  1X81 B;  2G0D A;  3SDV A;  2NOJ A;  3D5R A;  2E24 A;  3M78 A;  1NI1 B;  4DOD A;  3WIQ A;  2V8K A;  1FCE A;  1KSD A;  3S4D A;  4V1S A;  1GXM A;  4FXK B;  5ILZ A;  3PZ3 B;  3VW5 A;  4LNG B;  4Q2B A;  3Q7F B;  3W7X A;  3DSU B;  2B39 A;  3H7L A;  1N95 B;  3H2W A;  4KKI A;  1HCU A;  5ILH A;  2FBA A;  1XWQ A;  3QFY A;  1AGM A;  1J0M A;  3AFL A;  1UT9 A;  5DHK A;  5KKB A;  2H6H B;  3KLS A;  1W6K A;  2WCO A;  1N4P B;  3QRY A;  4DI5 A;  3P2C A;  1RWH A;  3QFZ A;  2X03 A;  3A3V A;  1G6I A;  4EHM B;  3QSP A;  4ONT A;  3M7B A;  3A0O A;  5JPM B;  4Q88 A;  3N0F A;  2B4F A;  3Q75 B;  3GT5 A;  3SQC A;  3E32 B;  4LNB B;  3HXC B;  4GTT B;  1N94 B;  1X1H A;  4ZG8 A;  3DSW B;  3EU8 A;  4FXG B;  4GTP B;  2OKX A;  4L0G A;  2H6F B;  5M7I A;  3S9V A;  3GLY A;  5GZK A;  3QDE A;  1TN6 B;  1TN8 B;  2AHG A;  2BBC A;  3WKI A;  2EAC A;  2BED B;  3ANJ A;  4YDE B;  3W7T A;  1H3B A;  3C72 B;  3QWT A;  4GAX A;  1JCR B;  1FO2 A;  3RJ3 A;  4GTO B;  3SDU A;  4D4A A;  3RX5 A;  5AGD A;  4GTV B;  4L6X A;  2A8Z A;  4LIX A;  3M75 A;  2WDA A;  2WII B;  3VXD A;  4NEI A;  4XUV A;  3SDT A;  4TXT A;  4YDO B;  1L2A A;  3QXQ A;  1IS9 A;  4FUS A;  2BRP A;  1KFG A;  2FUQ A;  2RGK A;  2ZBL A;  5JPN B;  4YCR A;  3SDQ A;  1V7W A;  1HMW A;  3Q73 B;  1GAH A;  3DPY B;  1V5C A;  4WU0 A;  3PYA A;  4KTR A;  3P5P A;  3S4B A;  1N21 A;  4TF4 A;  4OK4 A;  1F1S A;  4BOK A;  3X17 A;  1WU6 A;  1CEM A;  5FO9 B;  1RWG A;  1WU4 A;  1LD8 B;  2P0V A;  5ILK A;  1N20 A;  3RX8 A;  5IL3 A;  1W3Y A;  3WKH A;  3QG0 A;  3M74 A;  2JJB A;  2ONH A;  5IK6 A;  3T33 A;  2YIK A;  1HM3 A;  2WY7 A;  1FBO A;  2IEJ B;  2DRQ A;  3E73 A;  2FUZ A;  3KSL B;  3PYB A;  3HXD B;  3Q7A B;  1K72 A;  2V8I A;  1V7V A;  1QQF A;  4AYQ A;  1JCS B;  1W6J A;  3ACS A;  4QT9 A;  2GH4 A;  4AYP A;  3PZ2 B;  3SAE A;  4ZRQ A;  5JMF A;  1UG9 A;  3DSV B;  3E37 B;  2BB6 A;  1QAZ A;  2ZIS B;  1H14 A;  4KTP A;  3K11 A;  1S64 B;  2FV0 A;  4EL8 A;  1RWA A;  1CLC A;  3GZK A;  3S4A A;  3P5R A;  5E2J A;  3M02 A;  2FUT A;  1LF6 A;  3RSY A;  4C1S A;  2A73 B;  3ANK A;  1LOH A;  3DRA B;  2V3P A;  1HZF A;  1O6R A;  4ZRP A;  3E6U A;  1C82 A;  4ZH5 A;  2VN7 A;  2EAB A;  1O5M B;  5IKA A;  4FNV A;  3W7S A;  1RWC A;  3M7E A;  3SDR A;  4E1Y A;  5EAT A;  1G9J A;  3KSQ B;  1LXM A;  2R2L B;  1H39 A;  3M01 A;  2Z07 A;  4J5T A;  2BRV X;  1OJN A;  1TF4 A;  1VD5 A;  5C05 A;  5GY3 A;  1N1B A;  1TNU B;  3M73 A;  1LTX B;  3RRS A;  1IA7 A;  3LZ9 A;  2G02 A;  4Z4J A;  2D5J A;  1TNY B;  1NC5 A;  4M76 A;  2F0Y B;  4AYR A;  4OK2 A;  1O6Q A;  1KRE A;  3ON6 A;  3Q79 B;  5FO7 B;  3KQ4 A;  4GTR B;  1EGU A;  1OJP A;  3ACT A;  4AYO A;  2CQT A;  1QBQ B;  1FBW A;  3WIR A;  3D5S A;  3WC3 A;  3M76 A;  4MU9 A;  1GHQ A;  2EAE A;  4CE7 A;  4BOJ A;  2XQW A;  2V3N A;  3ANI A;  3RX7 A;  2PMV A;  3SFY B;  1QSJ A;  3NFV A;  1RWF A;  4D4B A;  1OJO A;  3G4D A;  3HXF B;  1KRF A;  3M7C A;  1D8E B;  3SFX B;  2JG0 A;  3G6J B;  4D94 A;  4MMH A;  3VSN A;  3EZ8 A;  1V7X A;  1KKT A;  1V5D A;  2V8J A;  4DOE A;  3E33 B;  1I8Q A;  1DOG A;  1GAI A;  1FAE A;  4WVB A;  3WKG A;  5EAS A;  4OZV A;  1JS4 A;  2WYN A;  1JCQ B;  4JJJ A;  4OZW A;  1F9O A;  3WIW A;  2NVP A;  1N4S B;  3AFJ A;  5ILY A;  1IA6 A;  1C3D A;  1NXC A;  5GW7 A;  3WKF A;  4F10 A;  2DRR A;  2JF4 A;  3QT3 A;  5DHI A;  4GTM B;  1TNZ B;  1G9G A;  1N4Q B;  2GOX A;  1SA4 B;  1X9D A;  1TN7 B;  2XWB B;  1RW9 A;  4F13 A;  4WVC A;  1HXA A;  4D4C A;  2VN4 A;  3W5M A;  2FV1 A;  1GXO A;  2F6D A;  2QNO A;  5MEH A;  2H6G B;  1O6H A;  3W7W A;  1N23 A;  2E22 A;  3K7X A;  3H3K A;  4RNQ A;  3OXU A;  1J0N A;  1HN0 A;  1FPP B;  5ILJ A;  3DSS B;  5FO8 B;  3VSM A;  4ZH1 A;  1N7N A;  2ZIR B;  3G4F A;  1H12 A;  1KZO B;  1HXG A;  1N7P A;  3PZ1 B;  3CU7 A;  1N4R B;  1FMI A;  1KSC A;  3E80 A;  3TF4 A;  1LD7 B;  4GTQ B;  1GSZ A;  2Q1F A;  2WIN B;  3HXB B;  3QT9 A;  2PN5 A;  1N7O A;  1FT2 B;  3M7L A;  1GLM A;  2GZ6 A;  3EQA A;  5EAU A;  2SQC A;  1G87 A;  3E34 B;  2D8L A;  3Q78 B;  3M00 A;  1FO3 A;  2WY8 A;  3WUX A;  5CD2 A;  1GA2 A;  3W5N A;  1H3C A;  1H54 A;  1FT1 B;  2ZZR A;  3E7J A;  4FJQ A;  5ILI A;  1O1S B;  1H35 A;  5DGR A;  4KKJ A;  5JMD A;  3REN A;  4CJ0 A;  1R76 A;  1S63 B;  2BB5 A;  3CIH A;  5IK9 A;  5IL8 A;  3S4C A;  1DL2 A;  2CQS A;  1HMU A;  1KS8 A;  1ULV A;  1O1R B;  4CJ1 A;  1MZC B;  3HXE B;  1F9G A;  1KWF A;  4L9P B;  1TNO B;  2J5C A;  1H13 A;  1WU5 A;  1RQ5 A;  4MBG B;  1HM2 A;  1N24 A;  1N7Q A;  2XFG A;  1H3A A;  3D3I A;  5IM1 A;  4GTS B;  4LNV A;  4WVA A;  1O79 A;  2ONG A;  1H36 A;  3DSX B;  3W7U A;  2AHF A;  3E30 B; 
#chains in the Genus database with same CATH homology
 1NL4 B;  2AFA A;  3QPF A;  3EUV B;  1LF9 A;  3DST B;  1H37 A;  1SA5 B;  1TNB B;  2H6I B;  1N9A B;  2DRO A;  3QXF A;  1KZP B;  3PMM A;  1WZZ A;  1FP3 A;  5FOB B;  1DCE B;  1GXN A;  4D4D A;  1O1T B;  1XWT A;  1SQC A;  2XWJ B;  4GL3 A;  5CZL A;  3OED A;  1L1Y A;  5CA3 A;  3M72 A;  4Z4L A;  1F9D A;  2I07 B;  3M77 A;  2RI8 A;  1UMP A;  2RI9 A;  1AYX A;  1D8D B;  1XW2 A;  5M7Y A;  3EU5 B;  3M71 A;  2DRS A;  3PZ4 B;  4V1R A;  2EAD A;  5DGQ A;  1X81 B;  2G0D A;  3SDV A;  2NOJ A;  3D5R A;  3M78 A;  1NI1 B;  4DOD A;  3WIQ A;  2V8K A;  1FCE A;  1KSD A;  3S4D A;  4V1S A;  1GXM A;  4FXK B;  3PZ3 B;  3VW5 A;  4LNG B;  4Q2B A;  3Q7F B;  3W7X A;  3DSU B;  2B39 A;  3H7L A;  1N95 B;  3H2W A;  4KKI A;  1HCU A;  2FBA A;  1XWQ A;  3QFY A;  1AGM A;  1UT9 A;  5KKB A;  2H6H B;  3KLS A;  1W6K A;  1N4P B;  3QRY A;  3P2C A;  3QFZ A;  3A3V A;  1G6I A;  4EHM B;  3QSP A;  4ONT A;  3M7B A;  5JPM B;  4Q88 A;  2B4F A;  3Q75 B;  3GT5 A;  3SQC A;  3E32 B;  4LNB B;  3HXC B;  4GTT B;  1N94 B;  4ZG8 A;  3DSW B;  3EU8 A;  4FXG B;  4GTP B;  2OKX A;  4L0G A;  2H6F B;  5M7I A;  3S9V A;  3GLY A;  5GZK A;  3QDE A;  1TN6 B;  1TN8 B;  2AHG A;  2BBC A;  3WKI A;  2EAC A;  2BED B;  3ANJ A;  4YDE B;  3W7T A;  1H3B A;  3C72 B;  3QWT A;  1JCR B;  1FO2 A;  3RJ3 A;  4GTO B;  3SDU A;  4D4A A;  3RX5 A;  5AGD A;  4GTV B;  4L6X A;  2A8Z A;  4LIX A;  3M75 A;  2WII B;  3VXD A;  4XUV A;  3SDT A;  4TXT A;  4YDO B;  1L2A A;  3QXQ A;  1IS9 A;  4FUS A;  1KFG A;  2RGK A;  2ZBL A;  5JPN B;  4YCR A;  3SDQ A;  1V7W A;  3Q73 B;  1GAH A;  3DPY B;  1V5C A;  4WU0 A;  3PYA A;  4KTR A;  3P5P A;  3S4B A;  4TF4 A;  4BOK A;  3X17 A;  1WU6 A;  1CEM A;  5FO9 B;  1WU4 A;  1LD8 B;  2P0V A;  3RX8 A;  3WKH A;  3QG0 A;  3M74 A;  2JJB A;  3T33 A;  2YIK A;  2WY7 A;  1FBO A;  2IEJ B;  2DRQ A;  3E73 A;  2FUZ A;  3KSL B;  3PYB A;  3HXD B;  3Q7A B;  1K72 A;  2V8I A;  1V7V A;  1QQF A;  4AYQ A;  1JCS B;  1W6J A;  3ACS A;  4QT9 A;  2GH4 A;  4AYP A;  3PZ2 B;  3SAE A;  4ZRQ A;  1UG9 A;  3DSV B;  3E37 B;  2BB6 A;  2ZIS B;  1H14 A;  4KTP A;  3K11 A;  1S64 B;  2FV0 A;  4EL8 A;  1CLC A;  3GZK A;  3S4A A;  3P5R A;  5E2J A;  1LF6 A;  3RSY A;  4C1S A;  2A73 B;  3ANK A;  3DRA B;  2V3P A;  1HZF A;  1O6R A;  4ZRP A;  3E6U A;  4ZH5 A;  2VN7 A;  2EAB A;  1O5M B;  3W7S A;  3M7E A;  3SDR A;  1G9J A;  3KSQ B;  2R2L B;  1H39 A;  2Z07 A;  4J5T A;  1VD5 A;  1TF4 A;  5GY3 A;  1TNU B;  3M73 A;  1LTX B;  3RRS A;  1IA7 A;  2G02 A;  4Z4J A;  2D5J A;  1TNY B;  1NC5 A;  4M76 A;  2F0Y B;  4AYR A;  1O6Q A;  1KRE A;  3ON6 A;  3Q79 B;  5FO7 B;  3KQ4 A;  4GTR B;  3ACT A;  4AYO A;  2CQT A;  1QBQ B;  1FBW A;  3WIR A;  3D5S A;  3WC3 A;  3M76 A;  4MU9 A;  1GHQ A;  2EAE A;  4CE7 A;  4BOJ A;  2XQW A;  2V3N A;  3ANI A;  3RX7 A;  2PMV A;  3SFY B;  1QSJ A;  4D4B A;  3HXF B;  1KRF A;  3M7C A;  1D8E B;  3SFX B;  2JG0 A;  3G6J B;  4D94 A;  3EZ8 A;  1V7X A;  1KKT A;  1V5D A;  2V8J A;  4DOE A;  3E33 B;  1DOG A;  1GAI A;  1FAE A;  4WVB A;  3WKG A;  1JS4 A;  2WYN A;  1JCQ B;  4JJJ A;  1F9O A;  3WIW A;  2NVP A;  1N4S B;  3AFJ A;  1IA6 A;  1C3D A;  1NXC A;  5GW7 A;  3WKF A;  2DRR A;  2JF4 A;  3QT3 A;  4GTM B;  1TNZ B;  1G9G A;  1N4Q B;  2GOX A;  1SA4 B;  1X9D A;  1TN7 B;  2XWB B;  4WVC A;  4D4C A;  2VN4 A;  3W5M A;  2FV1 A;  1GXO A;  2F6D A;  2QNO A;  5MEH A;  2H6G B;  1O6H A;  3W7W A;  3K7X A;  3H3K A;  3OXU A;  1FPP B;  3DSS B;  5FO8 B;  4ZH1 A;  2ZIR B;  1H12 A;  1KZO B;  3PZ1 B;  3CU7 A;  1N4R B;  1FMI A;  1KSC A;  3TF4 A;  1LD7 B;  4GTQ B;  1GSZ A;  2WIN B;  3HXB B;  3QT9 A;  2PN5 A;  1FT2 B;  3M7L A;  1GLM A;  2GZ6 A;  3EQA A;  2SQC A;  1G87 A;  3E34 B;  2D8L A;  3Q78 B;  1FO3 A;  2WY8 A;  3WUX A;  5CD2 A;  1GA2 A;  3W5N A;  1H3C A;  1H54 A;  1FT1 B;  2ZZR A;  1O1S B;  1H35 A;  5DGR A;  4KKJ A;  3REN A;  4CJ0 A;  1R76 A;  1S63 B;  2BB5 A;  3CIH A;  3S4C A;  1DL2 A;  2CQS A;  1KS8 A;  1ULV A;  1O1R B;  4CJ1 A;  1MZC B;  3HXE B;  1KWF A;  4L9P B;  1TNO B;  1H13 A;  1WU5 A;  1RQ5 A;  4MBG B;  2XFG A;  1H3A A;  3D3I A;  4GTS B;  4LNV A;  4WVA A;  1O79 A;  3DSX B;  1H36 A;  3W7U A;  2AHF A;  3E30 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...