1LTXB

Structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
326
structure length
318
Chain Sequence
KDVTIKSDPDTLLLEKHADYIASYGSCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB GERANYLGERANYLTRANSFERASE ALPHA SUBUNIT
publication title Structure of Rab Escort Protein-1 in Complex with Rab Geranylgeranyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
total genus 105
structure length 318
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2002-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ltxB00
3PZ2B 1H3BA 1N4RB 3SQCA 4D4AA 3SFYB 3HXCB 2G0DA 1R76A 1H35A 2SQCA 1GXMA 1O6QA 5FO9B 3PZ4B 4ZH1A 2H6HB 3D5SA 3E32B 1S63B 1QBQB 2R2LB 3PZ3B 5FO8B 3CU7A 3PZ1B 1S64B 3C72B 3Q7AB 3DSSB 1GHQA 1SA4B 3G6JB 3DSTB 2A73B 3DSUB 3EUVB 1H36A 3Q78B 1GXNA 4LNGB 1LD8B 2V8JA 4KKIA 4D4BA 3OXUA 3Q73B 4YDEB 3E37B 4D4CA 2BB5A 2WY8A 1FT2B 2BEDB 1NI1B 2XWBB 1O5MB 4GTTB 1N95B 1C3DA 1O79A 2G02A 3Q79B 3KSQB 1D8EB 4LNVA 2ZISB 1JCSB 3KLSA 3DRAB 3HXBB 2NOJA 2V3NA 1SQCA 3HXEB 4ZRQA 3EU5B 3D5RA 2XWJB 4GTPB 3Q75B 4GTQB 2V3PA 1SA5B 4GTRB 3Q7FB 4ZRPA 4EHMB 1TNYB 3DSVB 3E34B 2I07B 2WINB 1TNBB 1FT1B 4M76A 1HZFA 5JPMB 1W6KA 1GXOA 1N9AB 3HXDB 3DSWB 3KQ4A 4MBGB 5JPNB 1QSJA 1N4PB 1O6RA 1QQFA 4D4DA 1H3AA 1N94B 2H6FB 5AGDA 2WY7A 2H6GB 1TNOB 4ONTA 3DSXB 3KSLB 2BBCA 1N4SB 1TN8B 1TNUB 3OEDA 4C1SA 3RJ3A 1X81B 1O1TB 1TN6B 4LNBB 2BB6A 1LD7B 4YDOB 5FO7B 1KZPB 3E30B 4GTSB 1O6HA 4MU9A 1UMPA 4V1RA 1MZCB 2F0YB 4FXGB 1D8DB 2IEJB 2GOXA 1N4QB 2ZIRB 3K7XA 5FOBB 2PN5A 3SFXB 4KKJA 2PMVA 1TNZB 1NL4B 4V1SA 1O1RB 2WIIB 1JCQB 1KZOB 1TN7B 1FPPB 3HXFB 2V8KA 2B39A 1JCRB 1DCEB 3DPYB 1H37A 4GTOB 1LTXB 1W6JA 1O1SB 1H39A 3E33B 4FXKB 1GSZA 4BOJA 4D94A 4BOKA 2XQWA 4GTVB 1H3CA 2V8IA 4GTMB 4L9PB 2H6IB
chains in the Genus database with same CATH superfamily
1KRFA 1N4RB 1C82A 3SDQA 4AYPA 1H13A 1N1BA 3M77A 1H12A 2RI8A 3PZ4B 2H6HB 3D5SA 3WKHA 1HX9A 2DRSA 3PZ3B 5E2JA 4WVCA 3X17A 3QPFA 1GHQA 1GA2A 2A8ZA 2RI9A 3N0FA 1HN0A 1LD8B 4KKIA 3OXUA 3P5PA 4YDEB 1KWFA 3P2CA 3E37B 5IK6A 2BB5A 2JG0A 5EATA 3W7XA 2BEDB 2XWBB 1I8QA 2B4FA 1C3DA 2G02A 3SAEA 3M78A 3KLSA 3QRYA 1N7PA 1SQCA 2CQTA 3WC3A 2JJBA 3ACSA 2XWJB 5CZLA 5DGRA 3QT9A 4EHMB 1TNYB 5GW7A 3E34B 5DHIA 1TNBB 1ULVA 1X1JA 1KSDA 1CB8A 3M75A 1N7NA 2D8LA 1QSJA 1V7VA 1N4PB 1AGMA 1O6RA 1IS9A 2H6GB 1DOGA 1TNOB 1NC5A 4C1SA 1TNUB 3RJ3A 1X81B 2J5CA 2Z07A 1JS4A 2VN7A 1O1TB 3W7TA 4FUSA 3S4AA 5CA3A 4OJZA 4GTSB 1O6HA 1UMPA 4V1RA 3SDVA 4OZVA 4V1SA 2PMVA 1NL4B 5DGQA 1L1YA 5M7YA 1TF4A 4DODA 5M7IA 1LF6A 5ILZA 4D94A 4TXTA 4BOKA 2NVPA 3ANKA 3QFZA 4CJ1A 1HCUA 3CIHA 4E1YA 1H3BA 2E24A 1GAHA 4YCRA 4MMHA 3HXCB 1KKTA 2FUZA 1R76A 2BRPA 1W3YA 3RENA 3GZKA 1H35A 1NXCA 3E73A 1FBOA 2CQSA 3N0GA 1S63B 1QBQB 2R2LB 3GLYA 2DROA 3ACTA 1CEMA 3CU7A 3LZ9A 1S64B 2RGKA 2XFGA 3ON6A 3WIQA 1SA4B 1HMWA 5ILJA 2A73B 3DSUB 2X03A 3E80A 4OZWA 2P0VA 3QT3A 1IA7A 4KTRA 1RWFA 3SDTA 3RRSA 4J5TA 4RNQA 4GTTB 1O79A 3QFYA 1X9DA 4LIXA 4LNVA 5EAUA 1H54A 4AYOA 1EGUA 3HXBB 4JJJA 4FJQA 2EABA 4ZRQA 3D5RA 5ILKA 1FMIA 5GY3A 3M71A 3WIWA 5IK0A 3DSVB 5MEHA 2WDAA 3S4CA 1FT1B 2BRWA 5JPMB 3KQ4A 3DSWB 3AFLA 4MBGB 3RX5A 4ZG8A 4GAXA 4ONTA 2ONGA 2WYNA 3QXQA 3ANJA 3DSXB 3OEDA 2BBCA 2OKXA 5IKHA 3A0OA 1G9GA 5EASA 1TN6B 3S9VA 1LD7B 1F1SA 1N1ZA 1KZPB 4AYQA 3E30B 5JMDA 3WKGA 4GL3A 1WU6A 1X1HA 2FV0A 3M02A 4FXGB 3VSNA 1HMUA 5DHKA 4EL8A 3QXFA 5ILHA 1QAZA 1G9JA 2PN5A 4AYRA 1O1RB 4CE7A 2WIIB 2EACA 2JF4A 3VSMA 3HXFB 2V8KA 2DRRA 1DCEB 3M76A 1LTXB 1OJPA 1W6JA 3S4BA 3RSYA 1KS8A 4FXKB 3E33B 3M7EA 1GSZA 4OK2A 3G4FA 4GTVB 2V8IA 3M7BA 3PYAA 4L9PB 2H6IB 5GZKA 3WIRA 1KSCA 3SQCA 4QT9A 3SFYB 5ILDA 1WZZA 3GT5A 1GXMA 3EU8A 3E32B 5FO8B 1X1IA 3PZ1B 3PYBA 5ILIA 1F9DA 5CD2A 3Q7AB 1N22A 3T33A 1LF9A 4Z4JA 3K11A 3G6JB 4NEIA 3EUVB 1H36A 2V8JA 1OJNA 3Q73B 3W7WA 4F10A 3NNBA 3SDUA 4ZH5A 4WVBA 4D4CA 1N7QA 2WY8A 1V5DA 1NI1B 2AHFA 3H7LA 1O5MB 3G4DA 4KTPA 1N95B 3SDRA 1RWCA 3KSQB 1HXCA 2DRQA 4L6XA 3DRAB 2NOJA 1FO3A 2FUQA 2V3NA 2ZBLA 3EU5B 5IL8A 1RWGA 3Q75B 4Q88A 4GTRB 2I07B 3W7UA 1LXKA 4M76A 1HXGA 3M74A 1HZFA 1G87A 1N9AB 1F9GA 5JPNB 2FUTA 1QQFA 1OJOA 1H3AA 2H6FB 1RWHA 3WKIA 2WY7A 3KSLB 1N4SB 4LNBB 2D5JA 2BB6A 3VW5A 3WKFA 4Q2BA 5IL3A 5IM1A 3WUXA 1N7OA 4XUVA 5KKBA 3QWTA 1AYXA 3TF4A 1D8DB 2GOXA 1XWTA 1DL2A 1N4QB 4CJ0A 2ZIRB 3SFXB 3M72A 2GZ6A 1TNZB 1LOHA 2EADA 1RQ5A 1JCQB 1TN7B 3W5NA 2B39A 1JCRB 1H37A 3M00A 4GTOB 4TF4A 1FO2A 1N24A 3NFVA 1H39A 1HM3A 1H3CA 1V7WA 2VN4A 1HXAA 1H14A 2IEJB 3PZ2B 2EAEA 3P5RA 4D4AA 5IKAA 4WVAA 2G0DA 1OJMA 4DI5A 2SQCA 5FO9B 1O6QA 1FAEA 4ZH1A 1WU5A 1HM2A 3M7LA 1N7RA 2YIKA 3C72B 4OK4A 3DSSB 4Z4LA 1N23A 3ANIA 3DSTB 3H2WA 2FV1A 3Q78B 3E6UA 1GXNA 2E22A 4LNGB 4D4BA 3PMMA 2AHGA 1FT2B 1FP3A 3QG0A 1UG9A 1KREA 1WU4A 3Q79B 4WU0A 1D8EB 2ZISB 1JCSB 1L2AA 3QDEA 1GLMA 3HXEB 5IK9A 3M73A 1J0MA 1RWAA 2ZZRA 2F6DA 4GTPB 1UT9A 4GTQB 2V3PA 1SA5B 3EQAA 3Q7FB 4ZRPA 2FBAA 1G6IA 1LXMA 2ONHA 2WINB 4FNVA 1F9OA 5JMFA 1IA6A 1W6KA 1GXOA 3HXDB 3RX7A 3W7SA 3AFJA 1RW9A 3M7CA 4D4DA 1N94B 5AGDA 2QNOA 1XWQA 1GAIA 3H3KA 1J0NA 3A3VA 3RX8A 1TN8B 1V7XA 5ILYA 3W5MA 1FBWA 3S4DA 4F13A 1N20A 1FCEA 3E7JA 4YDOB 5FO7B 3M01A 1XW2A 4MU9A 1MZCB 2F0YB 1V5CA 3EZ8A 1N21A 5C05A 3D3IA 3VXDA 3K7XA 5FOBB 1VD5A 4KKJA 1CLCA 1KZOB 1FPPB 2GH4A 4DOEA 3DPYB 1KFGA 2WCOA 4L0GA 1O1SB 4MMIA 2Q1FA 4BOJA 1HV6A 2XQWA 1K72A 4GTMB 3QSPA 2AFAA 2BRVX
chains in the Genus database with same CATH topology
1KRFA 1N4RB 3SDQA 4AYPA 1H13A 3M77A 1H12A 2RI8A 3PZ4B 2H6HB 3D5SA 3WKHA 3PZ3B 2DRSA 5E2JA 4WVCA 3X17A 3QPFA 1GHQA 1GA2A 2A8ZA 2RI9A 1LD8B 4KKIA 3OXUA 3P5PA 4YDEB 1KWFA 3P2CA 3E37B 2BB5A 2JG0A 3W7XA 2BEDB 2XWBB 2B4FA 1C3DA 2G02A 3SAEA 3M78A 3KLSA 3QRYA 1SQCA 2CQTA 3WC3A 2JJBA 3ACSA 2XWJB 5CZLA 5DGRA 3QT9A 4EHMB 1TNYB 5GW7A 3E34B 1TNBB 1ULVA 1KSDA 3M75A 2D8LA 1QSJA 1V7VA 1N4PB 1AGMA 1O6RA 1IS9A 2H6GB 1DOGA 1TNOB 1NC5A 4C1SA 1TNUB 3RJ3A 1X81B 2Z07A 1JS4A 2VN7A 1O1TB 3W7TA 4FUSA 3S4AA 5CA3A 4GTSB 1O6HA 1UMPA 4V1RA 3SDVA 4V1SA 2PMVA 1NL4B 5DGQA 1L1YA 5M7YA 1TF4A 4DODA 5M7IA 1LF6A 4D94A 4TXTA 4BOKA 2NVPA 3ANKA 3QFZA 4CJ1A 1HCUA 3CIHA 1H3BA 1GAHA 4YCRA 3HXCB 1KKTA 2FUZA 1R76A 3RENA 3GZKA 1H35A 1NXCA 3E73A 1FBOA 2CQSA 1S63B 1QBQB 2R2LB 3GLYA 2DROA 3ACTA 1CEMA 3CU7A 1S64B 2RGKA 2XFGA 3ON6A 3WIQA 1SA4B 2A73B 3DSUB 2P0VA 3QT3A 1IA7A 4KTRA 3SDTA 3RRSA 4J5TA 4GTTB 1O79A 3QFYA 1X9DA 4LIXA 4LNVA 1H54A 4AYOA 3HXBB 4JJJA 2EABA 4ZRQA 3D5RA 1FMIA 5GY3A 3M71A 3WIWA 3DSVB 5MEHA 3S4CA 1FT1B 5JPMB 3KQ4A 3DSWB 4MBGB 3RX5A 4ZG8A 4ONTA 2WYNA 3QXQA 3ANJA 3DSXB 3OEDA 2BBCA 2OKXA 1G9GA 1TN6B 3S9VA 1LD7B 1KZPB 4AYQA 3E30B 3WKGA 4GL3A 1WU6A 2FV0A 4FXGB 4EL8A 3QXFA 1G9JA 2PN5A 4AYRA 1O1RB 4CE7A 2WIIB 2EACA 2JF4A 3HXFB 2V8KA 2DRRA 1DCEB 3M76A 1LTXB 1W6JA 3S4BA 3RSYA 1KS8A 4FXKB 3E33B 3M7EA 1GSZA 4GTVB 2V8IA 3M7BA 3PYAA 4L9PB 2H6IB 5GZKA 3WIRA 1KSCA 3SQCA 4QT9A 3SFYB 1WZZA 3GT5A 1GXMA 3EU8A 3E32B 5FO8B 3PZ1B 3PYBA 1F9DA 5CD2A 3Q7AB 3T33A 1LF9A 4Z4JA 3K11A 3G6JB 3EUVB 1H36A 2V8JA 3Q73B 3W7WA 3SDUA 4ZH5A 4WVBA 4D4CA 2WY8A 1V5DA 1NI1B 2AHFA 3H7LA 1O5MB 4KTPA 1N95B 3SDRA 3KSQB 2DRQA 4L6XA 3DRAB 2NOJA 1FO3A 2V3NA 2ZBLA 3EU5B 3Q75B 4Q88A 4GTRB 2I07B 3W7UA 4M76A 3M74A 1HZFA 1G87A 1N9AB 5JPNB 1QQFA 1H3AA 2H6FB 3WKIA 2WY7A 3KSLB 1N4SB 4LNBB 2D5JA 2BB6A 3VW5A 3WKFA 4Q2BA 3WUXA 4XUVA 5KKBA 3QWTA 1AYXA 3TF4A 1D8DB 2GOXA 1XWTA 1DL2A 1N4QB 4CJ0A 2ZIRB 3SFXB 3M72A 2GZ6A 1TNZB 2EADA 1RQ5A 1JCQB 1TN7B 3W5NA 2B39A 1JCRB 1H37A 4GTOB 4TF4A 1FO2A 1H39A 1H3CA 1V7WA 2VN4A 1H14A 2IEJB 3PZ2B 2EAEA 3P5RA 4D4AA 4WVAA 2G0DA 2SQCA 5FO9B 1O6QA 1FAEA 4ZH1A 1WU5A 3M7LA 2YIKA 3C72B 3DSSB 4Z4LA 3ANIA 3DSTB 3H2WA 2FV1A 3Q78B 3E6UA 1GXNA 4LNGB 4D4BA 3PMMA 2AHGA 1FT2B 1FP3A 3QG0A 1UG9A 1KREA 1WU4A 3Q79B 4WU0A 1D8EB 2ZISB 1JCSB 1L2AA 3QDEA 1GLMA 3HXEB 3M73A 2ZZRA 2F6DA 4GTPB 1UT9A 4GTQB 2V3PA 1SA5B 3EQAA 3Q7FB 4ZRPA 2FBAA 1G6IA 2WINB 1F9OA 1IA6A 1W6KA 1GXOA 3HXDB 3RX7A 3W7SA 3AFJA 3M7CA 4D4DA 1N94B 5AGDA 2QNOA 1XWQA 1GAIA 3H3KA 3A3VA 3RX8A 1TN8B 1V7XA 3W5MA 1FBWA 3S4DA 1FCEA 4YDOB 5FO7B 1XW2A 4MU9A 1MZCB 2F0YB 1V5CA 3EZ8A 3D3IA 3VXDA 3K7XA 5FOBB 1VD5A 4KKJA 1CLCA 1KZOB 1FPPB 2GH4A 4DOEA 3DPYB 1KFGA 4L0GA 1O1SB 4BOJA 2XQWA 1K72A 4GTMB 3QSPA 2AFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ2 B;  1H3B A;  1N4R B;  3SQC A;  4D4A A;  3SFY B;  3HXC B;  2G0D A;  1R76 A;  1H35 A;  2SQC A;  1GXM A;  1O6Q A;  5FO9 B;  3PZ4 B;  4ZH1 A;  2H6H B;  3D5S A;  3E32 B;  1S63 B;  1QBQ B;  2R2L B;  3PZ3 B;  5FO8 B;  3CU7 A;  3PZ1 B;  1S64 B;  3C72 B;  3Q7A B;  3DSS B;  1GHQ A;  1SA4 B;  3G6J B;  3DST B;  2A73 B;  3DSU B;  3EUV B;  1H36 A;  3Q78 B;  1GXN A;  4LNG B;  1LD8 B;  2V8J A;  4KKI A;  4D4B A;  3OXU A;  3Q73 B;  4YDE B;  3E37 B;  4D4C A;  2BB5 A;  2WY8 A;  1FT2 B;  2BED B;  1NI1 B;  2XWB B;  1O5M B;  4GTT B;  1N95 B;  1C3D A;  1O79 A;  2G02 A;  3Q79 B;  3KSQ B;  1D8E B;  4LNV A;  2ZIS B;  1JCS B;  3KLS A;  3DRA B;  3HXB B;  2NOJ A;  2V3N A;  1SQC A;  3HXE B;  4ZRQ A;  3EU5 B;  3D5R A;  2XWJ B;  4GTP B;  3Q75 B;  4GTQ B;  2V3P A;  1SA5 B;  4GTR B;  3Q7F B;  4ZRP A;  4EHM B;  1TNY B;  3DSV B;  3E34 B;  2I07 B;  2WIN B;  1TNB B;  1FT1 B;  4M76 A;  1HZF A;  5JPM B;  1W6K A;  1GXO A;  1N9A B;  3HXD B;  3DSW B;  3KQ4 A;  4MBG B;  5JPN B;  1QSJ A;  1N4P B;  1O6R A;  1QQF A;  4D4D A;  1H3A A;  1N94 B;  2H6F B;  5AGD A;  2WY7 A;  2H6G B;  1TNO B;  4ONT A;  3DSX B;  3KSL B;  2BBC A;  1N4S B;  1TN8 B;  1TNU B;  3OED A;  4C1S A;  3RJ3 A;  1X81 B;  1O1T B;  1TN6 B;  4LNB B;  2BB6 A;  1LD7 B;  4YDO B;  5FO7 B;  1KZP B;  3E30 B;  4GTS B;  1O6H A;  4MU9 A;  1UMP A;  4V1R A;  1MZC B;  2F0Y B;  4FXG B;  1D8D B;  2IEJ B;  2GOX A;  1N4Q B;  2ZIR B;  3K7X A;  5FOB B;  2PN5 A;  3SFX B;  4KKJ A;  2PMV A;  1TNZ B;  1NL4 B;  4V1S A;  1O1R B;  2WII B;  1JCQ B;  1KZO B;  1TN7 B;  1FPP B;  3HXF B;  2V8K A;  2B39 A;  1JCR B;  1DCE B;  3DPY B;  1H37 A;  4GTO B;  1LTX B;  1W6J A;  1O1S B;  1H39 A;  3E33 B;  4FXK B;  1GSZ A;  4BOJ A;  4D94 A;  4BOK A;  2XQW A;  4GTV B;  1H3C A;  2V8I A;  4GTM B;  4L9P B;  2H6I B; 
#chains in the Genus database with same CATH topology
 1KRF A;  1N4R B;  1C82 A;  3SDQ A;  4AYP A;  1H13 A;  1N1B A;  3M77 A;  1H12 A;  2RI8 A;  3PZ4 B;  2H6H B;  3D5S A;  3WKH A;  1HX9 A;  2DRS A;  3PZ3 B;  5E2J A;  4WVC A;  3X17 A;  3QPF A;  1GHQ A;  1GA2 A;  2A8Z A;  2RI9 A;  3N0F A;  1HN0 A;  1LD8 B;  4KKI A;  3OXU A;  3P5P A;  4YDE B;  1KWF A;  3P2C A;  3E37 B;  5IK6 A;  2BB5 A;  2JG0 A;  5EAT A;  3W7X A;  2BED B;  2XWB B;  1I8Q A;  2B4F A;  1C3D A;  2G02 A;  3SAE A;  3M78 A;  3KLS A;  3QRY A;  1N7P A;  1SQC A;  2CQT A;  3WC3 A;  2JJB A;  3ACS A;  2XWJ B;  5CZL A;  5DGR A;  3QT9 A;  4EHM B;  1TNY B;  5GW7 A;  3E34 B;  5DHI A;  1TNB B;  1ULV A;  1X1J A;  1KSD A;  1CB8 A;  3M75 A;  1N7N A;  2D8L A;  1QSJ A;  1V7V A;  1N4P B;  1AGM A;  1O6R A;  1IS9 A;  2H6G B;  1DOG A;  1TNO B;  1NC5 A;  4C1S A;  1TNU B;  3RJ3 A;  1X81 B;  2J5C A;  2Z07 A;  1JS4 A;  2VN7 A;  1O1T B;  3W7T A;  4FUS A;  3S4A A;  5CA3 A;  4OJZ A;  4GTS B;  1O6H A;  1UMP A;  4V1R A;  3SDV A;  4OZV A;  4V1S A;  2PMV A;  1NL4 B;  5DGQ A;  1L1Y A;  5M7Y A;  1TF4 A;  4DOD A;  5M7I A;  1LF6 A;  5ILZ A;  4D94 A;  4TXT A;  4BOK A;  2NVP A;  3ANK A;  3QFZ A;  4CJ1 A;  1HCU A;  3CIH A;  4E1Y A;  1H3B A;  2E24 A;  1GAH A;  4YCR A;  4MMH A;  3HXC B;  1KKT A;  2FUZ A;  1R76 A;  2BRP A;  1W3Y A;  3REN A;  3GZK A;  1H35 A;  1NXC A;  3E73 A;  1FBO A;  2CQS A;  3N0G A;  1S63 B;  1QBQ B;  2R2L B;  3GLY A;  2DRO A;  3ACT A;  1CEM A;  3CU7 A;  3LZ9 A;  1S64 B;  2RGK A;  2XFG A;  3ON6 A;  3WIQ A;  1SA4 B;  1HMW A;  5ILJ A;  2A73 B;  3DSU B;  2X03 A;  3E80 A;  4OZW A;  2P0V A;  3QT3 A;  1IA7 A;  4KTR A;  1RWF A;  3SDT A;  3RRS A;  4J5T A;  4RNQ A;  4GTT B;  1O79 A;  3QFY A;  1X9D A;  4LIX A;  4LNV A;  5EAU A;  1H54 A;  4AYO A;  1EGU A;  3HXB B;  4JJJ A;  4FJQ A;  2EAB A;  4ZRQ A;  3D5R A;  5ILK A;  1FMI A;  5GY3 A;  3M71 A;  3WIW A;  5IK0 A;  3DSV B;  5MEH A;  2WDA A;  3S4C A;  1FT1 B;  2BRW A;  5JPM B;  3KQ4 A;  3DSW B;  3AFL A;  4MBG B;  3RX5 A;  4ZG8 A;  4GAX A;  4ONT A;  2ONG A;  2WYN A;  3QXQ A;  3ANJ A;  3DSX B;  3OED A;  2BBC A;  2OKX A;  5IKH A;  3A0O A;  1G9G A;  5EAS A;  1TN6 B;  3S9V A;  1LD7 B;  1F1S A;  1N1Z A;  1KZP B;  4AYQ A;  3E30 B;  5JMD A;  3WKG A;  4GL3 A;  1WU6 A;  1X1H A;  2FV0 A;  3M02 A;  4FXG B;  3VSN A;  1HMU A;  5DHK A;  4EL8 A;  3QXF A;  5ILH A;  1QAZ A;  1G9J A;  2PN5 A;  4AYR A;  1O1R B;  4CE7 A;  2WII B;  2EAC A;  2JF4 A;  3VSM A;  3HXF B;  2V8K A;  2DRR A;  1DCE B;  3M76 A;  1LTX B;  1OJP A;  1W6J A;  3S4B A;  3RSY A;  1KS8 A;  4FXK B;  3E33 B;  3M7E A;  1GSZ A;  4OK2 A;  3G4F A;  4GTV B;  2V8I A;  3M7B A;  3PYA A;  4L9P B;  2H6I B;  5GZK A;  3WIR A;  1KSC A;  3SQC A;  4QT9 A;  3SFY B;  5ILD A;  1WZZ A;  3GT5 A;  1GXM A;  3EU8 A;  3E32 B;  5FO8 B;  1X1I A;  3PZ1 B;  3PYB A;  5ILI A;  1F9D A;  5CD2 A;  3Q7A B;  1N22 A;  3T33 A;  1LF9 A;  4Z4J A;  3K11 A;  3G6J B;  4NEI A;  3EUV B;  1H36 A;  2V8J A;  1OJN A;  3Q73 B;  3W7W A;  4F10 A;  3NNB A;  3SDU A;  4ZH5 A;  4WVB A;  4D4C A;  1N7Q A;  2WY8 A;  1V5D A;  1NI1 B;  2AHF A;  3H7L A;  1O5M B;  3G4D A;  4KTP A;  1N95 B;  3SDR A;  1RWC A;  3KSQ B;  1HXC A;  2DRQ A;  4L6X A;  3DRA B;  2NOJ A;  1FO3 A;  2FUQ A;  2V3N A;  2ZBL A;  3EU5 B;  5IL8 A;  1RWG A;  3Q75 B;  4Q88 A;  4GTR B;  2I07 B;  3W7U A;  1LXK A;  4M76 A;  1HXG A;  3M74 A;  1HZF A;  1G87 A;  1N9A B;  1F9G A;  5JPN B;  2FUT A;  1QQF A;  1OJO A;  1H3A A;  2H6F B;  1RWH A;  3WKI A;  2WY7 A;  3KSL B;  1N4S B;  4LNB B;  2D5J A;  2BB6 A;  3VW5 A;  3WKF A;  4Q2B A;  5IL3 A;  5IM1 A;  3WUX A;  1N7O A;  4XUV A;  5KKB A;  3QWT A;  1AYX A;  3TF4 A;  1D8D B;  2GOX A;  1XWT A;  1DL2 A;  1N4Q B;  4CJ0 A;  2ZIR B;  3SFX B;  3M72 A;  2GZ6 A;  1TNZ B;  1LOH A;  2EAD A;  1RQ5 A;  1JCQ B;  1TN7 B;  3W5N A;  2B39 A;  1JCR B;  1H37 A;  3M00 A;  4GTO B;  4TF4 A;  1FO2 A;  1N24 A;  3NFV A;  1H39 A;  1HM3 A;  1H3C A;  1V7W A;  2VN4 A;  1HXA A;  1H14 A;  2IEJ B;  3PZ2 B;  2EAE A;  3P5R A;  4D4A A;  5IKA A;  4WVA A;  2G0D A;  1OJM A;  4DI5 A;  2SQC A;  5FO9 B;  1O6Q A;  1FAE A;  4ZH1 A;  1WU5 A;  1HM2 A;  3M7L A;  1N7R A;  2YIK A;  3C72 B;  4OK4 A;  3DSS B;  4Z4L A;  1N23 A;  3ANI A;  3DST B;  3H2W A;  2FV1 A;  3Q78 B;  3E6U A;  1GXN A;  2E22 A;  4LNG B;  4D4B A;  3PMM A;  2AHG A;  1FT2 B;  1FP3 A;  3QG0 A;  1UG9 A;  1KRE A;  1WU4 A;  3Q79 B;  4WU0 A;  1D8E B;  2ZIS B;  1JCS B;  1L2A A;  3QDE A;  1GLM A;  3HXE B;  5IK9 A;  3M73 A;  1J0M A;  1RWA A;  2ZZR A;  2F6D A;  4GTP B;  1UT9 A;  4GTQ B;  2V3P A;  1SA5 B;  3EQA A;  3Q7F B;  4ZRP A;  2FBA A;  1G6I A;  1LXM A;  2ONH A;  2WIN B;  4FNV A;  1F9O A;  5JMF A;  1IA6 A;  1W6K A;  1GXO A;  3HXD B;  3RX7 A;  3W7S A;  3AFJ A;  1RW9 A;  3M7C A;  4D4D A;  1N94 B;  5AGD A;  2QNO A;  1XWQ A;  1GAI A;  3H3K A;  1J0N A;  3A3V A;  3RX8 A;  1TN8 B;  1V7X A;  5ILY A;  3W5M A;  1FBW A;  3S4D A;  4F13 A;  1N20 A;  1FCE A;  3E7J A;  4YDO B;  5FO7 B;  3M01 A;  1XW2 A;  4MU9 A;  1MZC B;  2F0Y B;  1V5C A;  3EZ8 A;  1N21 A;  5C05 A;  3D3I A;  3VXD A;  3K7X A;  5FOB B;  1VD5 A;  4KKJ A;  1CLC A;  1KZO B;  1FPP B;  2GH4 A;  4DOE A;  3DPY B;  1KFG A;  2WCO A;  4L0G A;  1O1S B;  4MMI A;  2Q1F A;  4BOJ A;  1HV6 A;  2XQW A;  1K72 A;  4GTM B;  3QSP A;  2AFA A;  2BRV X; 
#chains in the Genus database with same CATH homology
 1KRF A;  1N4R B;  3SDQ A;  4AYP A;  1H13 A;  3M77 A;  1H12 A;  2RI8 A;  3PZ4 B;  2H6H B;  3D5S A;  3WKH A;  3PZ3 B;  2DRS A;  5E2J A;  4WVC A;  3X17 A;  3QPF A;  1GHQ A;  1GA2 A;  2A8Z A;  2RI9 A;  1LD8 B;  4KKI A;  3OXU A;  3P5P A;  4YDE B;  1KWF A;  3P2C A;  3E37 B;  2BB5 A;  2JG0 A;  3W7X A;  2BED B;  2XWB B;  2B4F A;  1C3D A;  2G02 A;  3SAE A;  3M78 A;  3KLS A;  3QRY A;  1SQC A;  2CQT A;  3WC3 A;  2JJB A;  3ACS A;  2XWJ B;  5CZL A;  5DGR A;  3QT9 A;  4EHM B;  1TNY B;  5GW7 A;  3E34 B;  1TNB B;  1ULV A;  1KSD A;  3M75 A;  2D8L A;  1QSJ A;  1V7V A;  1N4P B;  1AGM A;  1O6R A;  1IS9 A;  2H6G B;  1DOG A;  1TNO B;  1NC5 A;  4C1S A;  1TNU B;  3RJ3 A;  1X81 B;  2Z07 A;  1JS4 A;  2VN7 A;  1O1T B;  3W7T A;  4FUS A;  3S4A A;  5CA3 A;  4GTS B;  1O6H A;  1UMP A;  4V1R A;  3SDV A;  4V1S A;  2PMV A;  1NL4 B;  5DGQ A;  1L1Y A;  5M7Y A;  1TF4 A;  4DOD A;  5M7I A;  1LF6 A;  4D94 A;  4TXT A;  4BOK A;  2NVP A;  3ANK A;  3QFZ A;  4CJ1 A;  1HCU A;  3CIH A;  1H3B A;  1GAH A;  4YCR A;  3HXC B;  1KKT A;  2FUZ A;  1R76 A;  3REN A;  3GZK A;  1H35 A;  1NXC A;  3E73 A;  1FBO A;  2CQS A;  1S63 B;  1QBQ B;  2R2L B;  3GLY A;  2DRO A;  3ACT A;  1CEM A;  3CU7 A;  1S64 B;  2RGK A;  2XFG A;  3ON6 A;  3WIQ A;  1SA4 B;  2A73 B;  3DSU B;  2P0V A;  3QT3 A;  1IA7 A;  4KTR A;  3SDT A;  3RRS A;  4J5T A;  4GTT B;  1O79 A;  3QFY A;  1X9D A;  4LIX A;  4LNV A;  1H54 A;  4AYO A;  3HXB B;  4JJJ A;  2EAB A;  4ZRQ A;  3D5R A;  1FMI A;  5GY3 A;  3M71 A;  3WIW A;  3DSV B;  5MEH A;  3S4C A;  1FT1 B;  5JPM B;  3KQ4 A;  3DSW B;  4MBG B;  3RX5 A;  4ZG8 A;  4ONT A;  2WYN A;  3QXQ A;  3ANJ A;  3DSX B;  3OED A;  2BBC A;  2OKX A;  1G9G A;  1TN6 B;  3S9V A;  1LD7 B;  1KZP B;  4AYQ A;  3E30 B;  3WKG A;  4GL3 A;  1WU6 A;  2FV0 A;  4FXG B;  4EL8 A;  3QXF A;  1G9J A;  2PN5 A;  4AYR A;  1O1R B;  4CE7 A;  2WII B;  2EAC A;  2JF4 A;  3HXF B;  2V8K A;  2DRR A;  1DCE B;  3M76 A;  1LTX B;  1W6J A;  3S4B A;  3RSY A;  1KS8 A;  4FXK B;  3E33 B;  3M7E A;  1GSZ A;  4GTV B;  2V8I A;  3M7B A;  3PYA A;  4L9P B;  2H6I B;  5GZK A;  3WIR A;  1KSC A;  3SQC A;  4QT9 A;  3SFY B;  1WZZ A;  3GT5 A;  1GXM A;  3EU8 A;  3E32 B;  5FO8 B;  3PZ1 B;  3PYB A;  1F9D A;  5CD2 A;  3Q7A B;  3T33 A;  1LF9 A;  4Z4J A;  3K11 A;  3G6J B;  3EUV B;  1H36 A;  2V8J A;  3Q73 B;  3W7W A;  3SDU A;  4ZH5 A;  4WVB A;  4D4C A;  2WY8 A;  1V5D A;  1NI1 B;  2AHF A;  3H7L A;  1O5M B;  4KTP A;  1N95 B;  3SDR A;  3KSQ B;  2DRQ A;  4L6X A;  3DRA B;  2NOJ A;  1FO3 A;  2V3N A;  2ZBL A;  3EU5 B;  3Q75 B;  4Q88 A;  4GTR B;  2I07 B;  3W7U A;  4M76 A;  3M74 A;  1HZF A;  1G87 A;  1N9A B;  5JPN B;  1QQF A;  1H3A A;  2H6F B;  3WKI A;  2WY7 A;  3KSL B;  1N4S B;  4LNB B;  2D5J A;  2BB6 A;  3VW5 A;  3WKF A;  4Q2B A;  3WUX A;  4XUV A;  5KKB A;  3QWT A;  1AYX A;  3TF4 A;  1D8D B;  2GOX A;  1XWT A;  1DL2 A;  1N4Q B;  4CJ0 A;  2ZIR B;  3SFX B;  3M72 A;  2GZ6 A;  1TNZ B;  2EAD A;  1RQ5 A;  1JCQ B;  1TN7 B;  3W5N A;  2B39 A;  1JCR B;  1H37 A;  4GTO B;  4TF4 A;  1FO2 A;  1H39 A;  1H3C A;  1V7W A;  2VN4 A;  1H14 A;  2IEJ B;  3PZ2 B;  2EAE A;  3P5R A;  4D4A A;  4WVA A;  2G0D A;  2SQC A;  5FO9 B;  1O6Q A;  1FAE A;  4ZH1 A;  1WU5 A;  3M7L A;  2YIK A;  3C72 B;  3DSS B;  4Z4L A;  3ANI A;  3DST B;  3H2W A;  2FV1 A;  3Q78 B;  3E6U A;  1GXN A;  4LNG B;  4D4B A;  3PMM A;  2AHG A;  1FT2 B;  1FP3 A;  3QG0 A;  1UG9 A;  1KRE A;  1WU4 A;  3Q79 B;  4WU0 A;  1D8E B;  2ZIS B;  1JCS B;  1L2A A;  3QDE A;  1GLM A;  3HXE B;  3M73 A;  2ZZR A;  2F6D A;  4GTP B;  1UT9 A;  4GTQ B;  2V3P A;  1SA5 B;  3EQA A;  3Q7F B;  4ZRP A;  2FBA A;  1G6I A;  2WIN B;  1F9O A;  1IA6 A;  1W6K A;  1GXO A;  3HXD B;  3RX7 A;  3W7S A;  3AFJ A;  3M7C A;  4D4D A;  1N94 B;  5AGD A;  2QNO A;  1XWQ A;  1GAI A;  3H3K A;  3A3V A;  3RX8 A;  1TN8 B;  1V7X A;  3W5M A;  1FBW A;  3S4D A;  1FCE A;  4YDO B;  5FO7 B;  1XW2 A;  4MU9 A;  1MZC B;  2F0Y B;  1V5C A;  3EZ8 A;  3D3I A;  3VXD A;  3K7X A;  5FOB B;  1VD5 A;  4KKJ A;  1CLC A;  1KZO B;  1FPP B;  2GH4 A;  4DOE A;  3DPY B;  1KFG A;  4L0G A;  1O1S B;  4BOJ A;  2XQW A;  1K72 A;  4GTM B;  3QSP A;  2AFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...