1LTXB

Structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
326
structure length
318
Chain Sequence
b'KDVTIKSDPDTLLLEKHADYIASYGSCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB GERANYLGERANYLTRANSFERASE ALPHA SUBUNIT
publication title Structure of Rab Escort Protein-1 in Complex with Rab Geranylgeranyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
total genus 105
structure length 318
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2002-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ltxB00
4D4BA 4ZRPA 1SQCA 1NL4B 4KKIA 2H6GB 1UMPA 2H6IB 4V1RA 1TN6B 3E32B 2XQWA 3OXUA 1R76A 3C72B 4GTMB 2F0YB 1TN7B 2H6FB 1SA5B 1W6KA 1N4QB 3Q79B 4L9PB 4FXKB 1H35A 2BB6A 4YDEB 3K7XA 2G02A 3E34B 2B39A 2WY7A 2NOJA 3DSUB 4GTOB 3DSTB 1FT1B 4GTVB 1GXMA 1QQFA 4KKJA 1FT2B 3OEDA 4ONTA 2BEDB 3HXFB 1N4RB 1JCSB 1H3BA 2ZIRB 1N9AB 1NI1B 1LD7B 1GHQA 2BBCA 2IEJB 2PMVA 1SA4B 1TNZB 3DSXB 1KZOB 2V8IA 4LNVA 2G0DA 1O1TB 2WINB 1O1SB 3SQCA 1H39A 2PN5A 3SFYB 4D94A 1N94B 4BOKA 2XWJB 5FOBB 1N4SB 2V8KA 1FPPB 4GTRB 5AGDA 4GTTB 3DSSB 3D5RA 5FO8B 1TN8B 1JCRB 1JCQB 1LD8B 3EUVB 1GXNA 2WY8A 3DPYB 1TNOB 1O6RA 1N4PB 1S63B 3KQ4A 1QSJA 3E37B 3KSQB 4BOJA 1H37A 1C3DA 1D8DB 4MBGB 2A73B 3PZ1B 4GTPB 2R2LB 2XWBB 2ZISB 4D4CA 3KLSA 3E30B 3PZ4B 1W6JA 1N95B 4V1SA 5FO9B 1O5MB 4D4AA 1O6QA 2SQCA 1TNYB 3Q7FB 4M76A 1H36A 2WIIB 2V3NA 3DRAB 2H6HB 1O1RB 1O79A 4LNGB 4YDOB 3EU5B 3PZ2B 3DSVB 4C1SA 3KSLB 3Q78B 4ZH1A 1HZFA 4GTQB 4MU9A 1TNUB 1X81B 2V3PA 3CU7A 1DCEB 1O6HA 3G6JB 4LNBB 1LTXB 5JPNB 3E33B 4D4DA 2I07B 3Q75B 1D8EB 1QBQB 1H3CA 3Q7AB 5JPMB 4GTSB 3Q73B 3PZ3B 4ZRQA 4EHMB 1MZCB 3HXDB 5FO7B 1TNBB 1KZPB 4FXGB 1H3AA 2GOXA 3SFXB 3RJ3A 3D5SA 2V8JA 3DSWB 1GSZA 2BB5A 3HXBB 3HXCB 1S64B 1GXOA 3HXEB
chains in the Genus database with same CATH superfamily
1KWFA 5DGQA 3N0FA 4D4BA 3S4CA 4ZRPA 1NL4B 1HCUA 1X9DA 5M7IA 4V1RA 4GTMB 4OK2A 5C05A 2F0YB 2H6FB 1OJMA 1C82A 4YDEB 3K7XA 1RWHA 2B39A 2ONGA 3WIWA 3PMMA 5EATA 2YIKA 1HXAA 1V7XA 3M74A 1FT1B 1LF6A 1QQFA 4CJ0A 1V5CA 1FT2B 3WKGA 1AGMA 2DROA 1W3YA 5EAUA 3SDVA 1N4RB 1H3BA 1XWTA 4F10A 3VSNA 1RWGA 4XUVA 3M77A 4JJJA 1KZOB 3M7CA 2G0DA 4DOEA 1GAIA 3SQCA 1H39A 3SFYB 4WU0A 4D94A 1N94B 3QFYA 1N4SB 4GTRB 3M01A 1JCRB 3M00A 1TNOB 1S63B 3KSQB 4MBGB 5DHIA 3X17A 2A73B 2VN7A 5DHKA 2XWBB 2QNOA 3M76A 3D3IA 1W6JA 1KFGA 3QT9A 1OJPA 3ACTA 5IKAA 3QFZA 2CQSA 3VSMA 1WZZA 3S4BA 4M76A 2WIIB 2H6HB 3ANIA 5IL8A 1O79A 5IKHA 4MMIA 3QG0A 2WCOA 1KSCA 3EU5B 3DSVB 4YDOB 4C1SA 4FUSA 4MU9A 1N7QA 1O6HA 3G6JB 4OK4A 1HMUA 3WIRA 3Q75B 5IL3A 5ILIA 2JG0A 3PZ3B 3RSYA 1N21A 4EHMB 1TNBB 2ZZRA 3H7LA 1GSZA 3HXBB 3W5MA 2AHGA 3HXEB 3M7LA 2A8ZA 4YCRA 5M7YA 1JS4A 1KREA 2RI9A 4Z4JA 1G87A 2H6GB 2H6IB 1G9JA 2J5CA 2XQWA 4ZRQA 1R76A 4ZH5A 4L9PB 2BRPA 1H35A 2BB6A 1LOHA 5KKBA 1HV6A 3SDRA 4CE7A 4GTOB 1RW9A 1FCEA 4KKJA 4QT9A 2BRVX 3QSPA 1JCSB 1X1IA 1LXKA 1LD7B 1FBWA 3WKIA 1NC5A 3SDTA 2BBCA 2IEJB 3P2CA 1TNZB 3G4FA 3PYBA 3QDEA 5ILDA 2CQTA 2WINB 1H14A 3GZKA 4TXTA 3P5RA 1NXCA 2E24A 2RI8A 1N24A 2V8KA 3W7SA 3N0GA 2VN4A 1JCQB 1H54A 2WY8A 1N7NA 1FP3A 1KRFA 1N4PB 1O6RA 3KQ4A 3ON6A 4J5TA 1QSJA 2FUTA 3E37B 1C3DA 3W7XA 3M75A 3W5NA 3S4AA 3M7EA 3M02A 3KLSA 2BRWA 3VXDA 2EABA 4AYRA 4Q2BA 1L2AA 1RWCA 4DODA 1O6QA 3Q7FB 3EU8A 1OJOA 2EACA 3DRAB 1DL2A 5E2JA 2FV1A 3VW5A 1RQ5A 1G6IA 4RNQA 3KSLB 1HZFA 1V7WA 2FUQA 4AYQA 1DCEB 1N7RA 5JPNB 4KTRA 4D4DA 5CD2A 3WIQA 1QBQB 3QXQA 1HM2A 3W7UA 3Q7AB 2EAEA 2D8LA 1MZCB 3EZ8A 1H3AA 2GOXA 2AFAA 3SFXB 3D5SA 4WVCA 3DSWB 5MEHA 5EASA 5GY3A 1S64B 3CIHA 2RGKA 3RX7A 2E22A 1UT9A 1SQCA 1X1HA 4TF4A 3NFVA 2WYNA 3A0OA 1N1ZA 1UMPA 3SDUA 3T33A 3C72B 3K11A 1J0NA 3Q79B 1SA5B 1N4QB 1ULVA 3E34B 2NOJA 3DSUB 1HN0A 1GXMA 3AFJA 5GW7A 5IK0A 3RENA 1AYXA 3E7JA 4Q88A 4ONTA 1DOGA 2ZIRB 1RWAA 1IA6A 1NI1B 2Z07A 1GHQA 4WVBA 1HM3A 1FBOA 1GAHA 4DI5A 4OZWA 3RX8A 5ILHA 1I8QA 3G4DA 1KSDA 5ILYA 1O1SB 2PN5A 4AYPA 1FMIA 1G9GA 4BOKA 4OZVA 2XWJB 5FOBB 4KTPA 5GZKA 1FPPB 1L1YA 1QAZA 3DSSB 1N23A 5AGDA 5FO8B 3H2WA 3WUXA 4LIXA 1LD8B 3DPYB 1F9DA 1N20A 3QT3A 4BOJA 1D8DB 5ILJA 3PZ1B 4GTPB 1F9OA 2P0VA 2X03A 4NEIA 4MMHA 4WVAA 5IK6A 1H13A 4OJZA 4EL8A 4V1SA 4D4AA 4AYOA 1TNYB 4GAXA 1N1BA 5CA3A 1XWQA 1N22A 3P5PA 1HXCA 3GT5A 2ONHA 2V3NA 2XFGA 1O1RB 2DRQA 3PZ2B 3Q78B 4ZH1A 3QPFA 4GTQB 2D5JA 1V5DA 2V3PA 1LTXB 3M72A 5DGRA 2I07B 2GZ6A 3PYAA 2DRSA 2FUZA 4GTSB 3Q73B 1TF4A 3HXDB 1KZPB 1FO3A 3RJ3A 2V8JA 3W7TA 1OJNA 2BB5A 4F13A 3M73A 1X1JA 1GXOA 3TF4A 5IK9A 1XW2A 2ZBLA 5JMDA 3GLYA 3RRSA 3E73A 1F1SA 4ZG8A 5CZLA 4E1YA 3NNBA 4KKIA 1GLMA 1TN6B 3E32B 3OXUA 3ACSA 1TN7B 1W6KA 3M71A 3E80A 2GH4A 4FXKB 3WKFA 2FV0A 2G02A 3SDQA 2WY7A 3M7BA 3DSTB 3QXFA 4GTVB 2EADA 3E6UA 3OEDA 1J0MA 5ILZA 2BEDB 3HXFB 1IS9A 1N9AB 1GA2A 3S4DA 2F6DA 2PMVA 1SA4B 1KS8A 3LZ9A 3DSXB 1CLCA 2V8IA 3ANJA 2NVPA 4LNVA 3H3KA 1O1TB 3W7WA 3SAEA 1K72A 1VD5A 1CB8A 2WDAA 3ANKA 5JMFA 4GTTB 3D5RA 3QWTA 1WU6A 1TN8B 3EUVB 2OKXA 1GXNA 1IA7A 4GL3A 1N7PA 1H37A 3WC3A 1FO2A 3AFLA 3S9VA 5ILKA 2R2LB 2ZISB 4D4CA 3E30B 3EQAA 2JF4A 3PZ4B 1HMWA 1RWFA 1N95B 5FO9B 1FAEA 1O5MB 2SQCA 4L0GA 1KKTA 4FNVA 1H36A 2DRRA 2Q1FA 4LNGB 1WU4A 2AHFA 4CJ1A 1LXMA 1TNUB 1V7VA 4FJQA 1X81B 4Z4LA 3CU7A 1UG9A 1HXGA 4LNBB 1N7OA 2FBAA 3M78A 1H12A 3E33B 1CEMA 3QRYA 3WKHA 1D8EB 1F9GA 1H3CA 2B4FA 1HX9A 5JPMB 1WU5A 3RX5A 5FO7B 2JJBA 3A3VA 4FXGB 1LF9A 3HXCB 5IM1A 4L6XA 1EGUA
chains in the Genus database with same CATH topology
1KWFA 5DGQA 4D4BA 3S4CA 4ZRPA 1NL4B 1HCUA 1X9DA 5M7IA 4V1RA 4GTMB 2F0YB 2H6FB 4YDEB 3K7XA 2B39A 3WIWA 3PMMA 2YIKA 1V7XA 3M74A 1FT1B 1LF6A 1QQFA 4CJ0A 1V5CA 1FT2B 3WKGA 1AGMA 2DROA 3SDVA 1N4RB 1H3BA 1XWTA 4XUVA 3M77A 4JJJA 1KZOB 3M7CA 2G0DA 4DOEA 1GAIA 3SQCA 1H39A 3SFYB 4WU0A 4D94A 1N94B 3QFYA 1N4SB 4GTRB 1JCRB 1TNOB 1S63B 3KSQB 4MBGB 3X17A 2A73B 2VN7A 2XWBB 2QNOA 3M76A 3D3IA 1W6JA 1KFGA 3QT9A 3ACTA 3QFZA 2CQSA 1WZZA 3S4BA 4M76A 2WIIB 2H6HB 3ANIA 1O79A 4YDOB 3QG0A 3EU5B 1KSCA 3DSVB 4C1SA 4FUSA 4MU9A 1O6HA 3G6JB 3WIRA 3Q75B 2JG0A 3PZ3B 3RSYA 4EHMB 1TNBB 2ZZRA 3H7LA 1GSZA 3HXBB 3W5MA 2AHGA 3HXEB 3M7LA 2A8ZA 4YCRA 5M7YA 1JS4A 1KREA 2RI9A 4Z4JA 1G87A 2H6GB 2H6IB 1G9JA 2XQWA 4ZRQA 1R76A 4ZH5A 4L9PB 1H35A 2BB6A 5KKBA 3SDRA 4CE7A 4GTOB 1FCEA 4KKJA 4QT9A 3QSPA 1JCSB 1LD7B 1FBWA 3WKIA 1NC5A 3SDTA 2BBCA 2IEJB 3P2CA 1TNZB 3PYBA 3QDEA 2CQTA 2WINB 1H14A 3GZKA 4TXTA 3P5RA 1NXCA 2RI8A 2V8KA 3W7SA 2VN4A 1JCQB 1H54A 2WY8A 1FP3A 1KRFA 1N4PB 1O6RA 3KQ4A 3ON6A 4J5TA 1QSJA 3E37B 1C3DA 3W7XA 3M75A 3W5NA 3S4AA 3M7EA 3KLSA 3VXDA 2EABA 4AYRA 4Q2BA 1L2AA 4DODA 1O6QA 3Q7FB 3EU8A 2EACA 3DRAB 1DL2A 5E2JA 2FV1A 3VW5A 1RQ5A 1G6IA 3KSLB 1HZFA 1V7WA 4AYQA 1DCEB 5JPNB 4KTRA 4D4DA 5CD2A 3WIQA 1QBQB 3QXQA 3W7UA 3Q7AB 2EAEA 2D8LA 1MZCB 3EZ8A 1H3AA 2GOXA 2AFAA 3SFXB 3D5SA 4WVCA 3DSWB 5MEHA 5GY3A 1S64B 3CIHA 2RGKA 3RX7A 1UT9A 1SQCA 4TF4A 2WYNA 1UMPA 3SDUA 3T33A 3C72B 3K11A 3Q79B 1SA5B 1N4QB 1ULVA 3E34B 2NOJA 3DSUB 1GXMA 3AFJA 5GW7A 3RENA 1AYXA 4Q88A 4ONTA 1DOGA 2ZIRB 1IA6A 1NI1B 2Z07A 1GHQA 4WVBA 1FBOA 1GAHA 3RX8A 1KSDA 1O1SB 2PN5A 4AYPA 1FMIA 1G9GA 4BOKA 2XWJB 5FOBB 4KTPA 5GZKA 1FPPB 1L1YA 5AGDA 3DSSB 5FO8B 3H2WA 3WUXA 4LIXA 1LD8B 3DPYB 1F9DA 3QT3A 4BOJA 1D8DB 3PZ1B 4GTPB 1F9OA 2P0VA 4WVAA 1H13A 4EL8A 4V1SA 4D4AA 4AYOA 1TNYB 5CA3A 1XWQA 3P5PA 3GT5A 2V3NA 2XFGA 1O1RB 2DRQA 3PZ2B 3Q78B 4ZH1A 3QPFA 4GTQB 2D5JA 1V5DA 2V3PA 1LTXB 3M72A 5DGRA 2I07B 2GZ6A 3PYAA 2DRSA 2FUZA 4GTSB 3Q73B 1TF4A 3HXDB 1KZPB 1FO3A 3RJ3A 2V8JA 3W7TA 2BB5A 3M73A 1GXOA 3TF4A 1XW2A 2ZBLA 3GLYA 3RRSA 3E73A 4ZG8A 5CZLA 4KKIA 1GLMA 1TN6B 3E32B 3OXUA 3ACSA 1TN7B 1W6KA 3M71A 2GH4A 4FXKB 3WKFA 2FV0A 2G02A 3SDQA 2WY7A 3M7BA 3DSTB 3QXFA 4GTVB 2EADA 3E6UA 3OEDA 2BEDB 3HXFB 1IS9A 1N9AB 1GA2A 3S4DA 2F6DA 2PMVA 1SA4B 1KS8A 3DSXB 1CLCA 2V8IA 3ANJA 2NVPA 4LNVA 3H3KA 1O1TB 3W7WA 3SAEA 1K72A 1VD5A 3ANKA 4GTTB 3D5RA 3QWTA 1WU6A 1TN8B 3EUVB 2OKXA 1GXNA 1IA7A 4GL3A 1H37A 3WC3A 1FO2A 3S9VA 2R2LB 2ZISB 4D4CA 3E30B 3EQAA 2JF4A 3PZ4B 1N95B 5FO9B 1FAEA 1O5MB 2SQCA 4L0GA 1KKTA 1H36A 2DRRA 4LNGB 1WU4A 2AHFA 4CJ1A 1TNUB 1V7VA 1X81B 4Z4LA 1UG9A 3CU7A 4LNBB 2FBAA 3M78A 1H12A 3E33B 1CEMA 3QRYA 3WKHA 1D8EB 1H3CA 2B4FA 5JPMB 1WU5A 3RX5A 5FO7B 2JJBA 3A3VA 4FXGB 1LF9A 3HXCB 4L6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D4B A;  4ZRP A;  1SQC A;  1NL4 B;  4KKI A;  2H6G B;  1UMP A;  2H6I B;  4V1R A;  1TN6 B;  3E32 B;  2XQW A;  3OXU A;  1R76 A;  3C72 B;  4GTM B;  2F0Y B;  1TN7 B;  2H6F B;  1SA5 B;  1W6K A;  1N4Q B;  3Q79 B;  4L9P B;  4FXK B;  1H35 A;  2BB6 A;  4YDE B;  3K7X A;  2G02 A;  3E34 B;  2B39 A;  2WY7 A;  2NOJ A;  3DSU B;  4GTO B;  3DST B;  1FT1 B;  4GTV B;  1GXM A;  1QQF A;  4KKJ A;  1FT2 B;  3OED A;  4ONT A;  2BED B;  3HXF B;  1N4R B;  1JCS B;  1H3B A;  2ZIR B;  1N9A B;  1NI1 B;  1LD7 B;  1GHQ A;  2BBC A;  2IEJ B;  2PMV A;  1SA4 B;  1TNZ B;  3DSX B;  1KZO B;  2V8I A;  4LNV A;  2G0D A;  1O1T B;  2WIN B;  1O1S B;  3SQC A;  1H39 A;  2PN5 A;  3SFY B;  4D94 A;  1N94 B;  4BOK A;  2XWJ B;  5FOB B;  1N4S B;  2V8K A;  1FPP B;  4GTR B;  5AGD A;  4GTT B;  3DSS B;  3D5R A;  5FO8 B;  1TN8 B;  1JCR B;  1JCQ B;  1LD8 B;  3EUV B;  1GXN A;  2WY8 A;  3DPY B;  1TNO B;  1O6R A;  1N4P B;  1S63 B;  3KQ4 A;  1QSJ A;  3E37 B;  3KSQ B;  4BOJ A;  1H37 A;  1C3D A;  1D8D B;  4MBG B;  2A73 B;  3PZ1 B;  4GTP B;  2R2L B;  2XWB B;  2ZIS B;  4D4C A;  3KLS A;  3E30 B;  3PZ4 B;  1W6J A;  1N95 B;  4V1S A;  5FO9 B;  1O5M B;  4D4A A;  1O6Q A;  2SQC A;  1TNY B;  3Q7F B;  4M76 A;  1H36 A;  2WII B;  2V3N A;  3DRA B;  2H6H B;  1O1R B;  1O79 A;  4LNG B;  4YDO B;  3EU5 B;  3PZ2 B;  3DSV B;  4C1S A;  3KSL B;  3Q78 B;  4ZH1 A;  1HZF A;  4GTQ B;  4MU9 A;  1TNU B;  1X81 B;  2V3P A;  3CU7 A;  1DCE B;  1O6H A;  3G6J B;  4LNB B;  1LTX B;  5JPN B;  3E33 B;  4D4D A;  2I07 B;  3Q75 B;  1D8E B;  1QBQ B;  1H3C A;  3Q7A B;  5JPM B;  4GTS B;  3Q73 B;  3PZ3 B;  4ZRQ A;  4EHM B;  1MZC B;  3HXD B;  5FO7 B;  1TNB B;  1KZP B;  4FXG B;  1H3A A;  2GOX A;  3SFX B;  3RJ3 A;  3D5S A;  2V8J A;  3DSW B;  1GSZ A;  2BB5 A;  3HXB B;  3HXC B;  1S64 B;  1GXO A;  3HXE B; 
#chains in the Genus database with same CATH topology
 1KWF A;  5DGQ A;  3N0F A;  4D4B A;  3S4C A;  4ZRP A;  1NL4 B;  1HCU A;  1X9D A;  5M7I A;  4V1R A;  4GTM B;  4OK2 A;  5C05 A;  2F0Y B;  2H6F B;  1OJM A;  1C82 A;  4YDE B;  3K7X A;  1RWH A;  2B39 A;  2ONG A;  3WIW A;  3PMM A;  5EAT A;  2YIK A;  1HXA A;  1V7X A;  3M74 A;  1FT1 B;  1LF6 A;  1QQF A;  4CJ0 A;  1V5C A;  1FT2 B;  3WKG A;  1AGM A;  2DRO A;  1W3Y A;  5EAU A;  3SDV A;  1N4R B;  1H3B A;  1XWT A;  4F10 A;  3VSN A;  1RWG A;  4XUV A;  3M77 A;  4JJJ A;  1KZO B;  3M7C A;  2G0D A;  4DOE A;  1GAI A;  3SQC A;  1H39 A;  3SFY B;  4WU0 A;  4D94 A;  1N94 B;  3QFY A;  1N4S B;  4GTR B;  3M01 A;  1JCR B;  3M00 A;  1TNO B;  1S63 B;  3KSQ B;  4MBG B;  5DHI A;  3X17 A;  2A73 B;  2VN7 A;  5DHK A;  2XWB B;  2QNO A;  3M76 A;  3D3I A;  1W6J A;  1KFG A;  3QT9 A;  1OJP A;  3ACT A;  5IKA A;  3QFZ A;  2CQS A;  3VSM A;  1WZZ A;  3S4B A;  4M76 A;  2WII B;  2H6H B;  3ANI A;  5IL8 A;  1O79 A;  5IKH A;  4MMI A;  3QG0 A;  2WCO A;  1KSC A;  3EU5 B;  3DSV B;  4YDO B;  4C1S A;  4FUS A;  4MU9 A;  1N7Q A;  1O6H A;  3G6J B;  4OK4 A;  1HMU A;  3WIR A;  3Q75 B;  5IL3 A;  5ILI A;  2JG0 A;  3PZ3 B;  3RSY A;  1N21 A;  4EHM B;  1TNB B;  2ZZR A;  3H7L A;  1GSZ A;  3HXB B;  3W5M A;  2AHG A;  3HXE B;  3M7L A;  2A8Z A;  4YCR A;  5M7Y A;  1JS4 A;  1KRE A;  2RI9 A;  4Z4J A;  1G87 A;  2H6G B;  2H6I B;  1G9J A;  2J5C A;  2XQW A;  4ZRQ A;  1R76 A;  4ZH5 A;  4L9P B;  2BRP A;  1H35 A;  2BB6 A;  1LOH A;  5KKB A;  1HV6 A;  3SDR A;  4CE7 A;  4GTO B;  1RW9 A;  1FCE A;  4KKJ A;  4QT9 A;  2BRV X;  3QSP A;  1JCS B;  1X1I A;  1LXK A;  1LD7 B;  1FBW A;  3WKI A;  1NC5 A;  3SDT A;  2BBC A;  2IEJ B;  3P2C A;  1TNZ B;  3G4F A;  3PYB A;  3QDE A;  5ILD A;  2CQT A;  2WIN B;  1H14 A;  3GZK A;  4TXT A;  3P5R A;  1NXC A;  2E24 A;  2RI8 A;  1N24 A;  2V8K A;  3W7S A;  3N0G A;  2VN4 A;  1JCQ B;  1H54 A;  2WY8 A;  1N7N A;  1FP3 A;  1KRF A;  1N4P B;  1O6R A;  3KQ4 A;  3ON6 A;  4J5T A;  1QSJ A;  2FUT A;  3E37 B;  1C3D A;  3W7X A;  3M75 A;  3W5N A;  3S4A A;  3M7E A;  3M02 A;  3KLS A;  2BRW A;  3VXD A;  2EAB A;  4AYR A;  4Q2B A;  1L2A A;  1RWC A;  4DOD A;  1O6Q A;  3Q7F B;  3EU8 A;  1OJO A;  2EAC A;  3DRA B;  1DL2 A;  5E2J A;  2FV1 A;  3VW5 A;  1RQ5 A;  1G6I A;  4RNQ A;  3KSL B;  1HZF A;  1V7W A;  2FUQ A;  4AYQ A;  1DCE B;  1N7R A;  5JPN B;  4KTR A;  4D4D A;  5CD2 A;  3WIQ A;  1QBQ B;  3QXQ A;  1HM2 A;  3W7U A;  3Q7A B;  2EAE A;  2D8L A;  1MZC B;  3EZ8 A;  1H3A A;  2GOX A;  2AFA A;  3SFX B;  3D5S A;  4WVC A;  3DSW B;  5MEH A;  5EAS A;  5GY3 A;  1S64 B;  3CIH A;  2RGK A;  3RX7 A;  2E22 A;  1UT9 A;  1SQC A;  1X1H A;  4TF4 A;  3NFV A;  2WYN A;  3A0O A;  1N1Z A;  1UMP A;  3SDU A;  3T33 A;  3C72 B;  3K11 A;  1J0N A;  3Q79 B;  1SA5 B;  1N4Q B;  1ULV A;  3E34 B;  2NOJ A;  3DSU B;  1HN0 A;  1GXM A;  3AFJ A;  5GW7 A;  5IK0 A;  3REN A;  1AYX A;  3E7J A;  4Q88 A;  4ONT A;  1DOG A;  2ZIR B;  1RWA A;  1IA6 A;  1NI1 B;  2Z07 A;  1GHQ A;  4WVB A;  1HM3 A;  1FBO A;  1GAH A;  4DI5 A;  4OZW A;  3RX8 A;  5ILH A;  1I8Q A;  3G4D A;  1KSD A;  5ILY A;  1O1S B;  2PN5 A;  4AYP A;  1FMI A;  1G9G A;  4BOK A;  4OZV A;  2XWJ B;  5FOB B;  4KTP A;  5GZK A;  1FPP B;  1L1Y A;  1QAZ A;  3DSS B;  1N23 A;  5AGD A;  5FO8 B;  3H2W A;  3WUX A;  4LIX A;  1LD8 B;  3DPY B;  1F9D A;  1N20 A;  3QT3 A;  4BOJ A;  1D8D B;  5ILJ A;  3PZ1 B;  4GTP B;  1F9O A;  2P0V A;  2X03 A;  4NEI A;  4MMH A;  4WVA A;  5IK6 A;  1H13 A;  4OJZ A;  4EL8 A;  4V1S A;  4D4A A;  4AYO A;  1TNY B;  4GAX A;  1N1B A;  5CA3 A;  1XWQ A;  1N22 A;  3P5P A;  1HXC A;  3GT5 A;  2ONH A;  2V3N A;  2XFG A;  1O1R B;  2DRQ A;  3PZ2 B;  3Q78 B;  4ZH1 A;  3QPF A;  4GTQ B;  2D5J A;  1V5D A;  2V3P A;  1LTX B;  3M72 A;  5DGR A;  2I07 B;  2GZ6 A;  3PYA A;  2DRS A;  2FUZ A;  4GTS B;  3Q73 B;  1TF4 A;  3HXD B;  1KZP B;  1FO3 A;  3RJ3 A;  2V8J A;  3W7T A;  1OJN A;  2BB5 A;  4F13 A;  3M73 A;  1X1J A;  1GXO A;  3TF4 A;  5IK9 A;  1XW2 A;  2ZBL A;  5JMD A;  3GLY A;  3RRS A;  3E73 A;  1F1S A;  4ZG8 A;  5CZL A;  4E1Y A;  3NNB A;  4KKI A;  1GLM A;  1TN6 B;  3E32 B;  3OXU A;  3ACS A;  1TN7 B;  1W6K A;  3M71 A;  3E80 A;  2GH4 A;  4FXK B;  3WKF A;  2FV0 A;  2G02 A;  3SDQ A;  2WY7 A;  3M7B A;  3DST B;  3QXF A;  4GTV B;  2EAD A;  3E6U A;  3OED A;  1J0M A;  5ILZ A;  2BED B;  3HXF B;  1IS9 A;  1N9A B;  1GA2 A;  3S4D A;  2F6D A;  2PMV A;  1SA4 B;  1KS8 A;  3LZ9 A;  3DSX B;  1CLC A;  2V8I A;  3ANJ A;  2NVP A;  4LNV A;  3H3K A;  1O1T B;  3W7W A;  3SAE A;  1K72 A;  1VD5 A;  1CB8 A;  2WDA A;  3ANK A;  5JMF A;  4GTT B;  3D5R A;  3QWT A;  1WU6 A;  1TN8 B;  3EUV B;  2OKX A;  1GXN A;  1IA7 A;  4GL3 A;  1N7P A;  1H37 A;  3WC3 A;  1FO2 A;  3AFL A;  3S9V A;  5ILK A;  2R2L B;  2ZIS B;  4D4C A;  3E30 B;  3EQA A;  2JF4 A;  3PZ4 B;  1HMW A;  1RWF A;  1N95 B;  5FO9 B;  1FAE A;  1O5M B;  2SQC A;  4L0G A;  1KKT A;  4FNV A;  1H36 A;  2DRR A;  2Q1F A;  4LNG B;  1WU4 A;  2AHF A;  4CJ1 A;  1LXM A;  1TNU B;  1V7V A;  4FJQ A;  1X81 B;  4Z4L A;  3CU7 A;  1UG9 A;  1HXG A;  4LNB B;  1N7O A;  2FBA A;  3M78 A;  1H12 A;  3E33 B;  1CEM A;  3QRY A;  3WKH A;  1D8E B;  1F9G A;  1H3C A;  2B4F A;  1HX9 A;  5JPM B;  1WU5 A;  3RX5 A;  5FO7 B;  2JJB A;  3A3V A;  4FXG B;  1LF9 A;  3HXC B;  5IM1 A;  4L6X A;  1EGU A; 
#chains in the Genus database with same CATH homology
 1KWF A;  5DGQ A;  4D4B A;  3S4C A;  4ZRP A;  1NL4 B;  1HCU A;  1X9D A;  5M7I A;  4V1R A;  4GTM B;  2F0Y B;  2H6F B;  4YDE B;  3K7X A;  2B39 A;  3WIW A;  3PMM A;  2YIK A;  1V7X A;  3M74 A;  1FT1 B;  1LF6 A;  1QQF A;  4CJ0 A;  1V5C A;  1FT2 B;  3WKG A;  1AGM A;  2DRO A;  3SDV A;  1N4R B;  1H3B A;  1XWT A;  4XUV A;  3M77 A;  4JJJ A;  1KZO B;  3M7C A;  2G0D A;  4DOE A;  1GAI A;  3SQC A;  1H39 A;  3SFY B;  4WU0 A;  4D94 A;  1N94 B;  3QFY A;  1N4S B;  4GTR B;  1JCR B;  1TNO B;  1S63 B;  3KSQ B;  4MBG B;  3X17 A;  2A73 B;  2VN7 A;  2XWB B;  2QNO A;  3M76 A;  3D3I A;  1W6J A;  1KFG A;  3QT9 A;  3ACT A;  3QFZ A;  2CQS A;  1WZZ A;  3S4B A;  4M76 A;  2WII B;  2H6H B;  3ANI A;  1O79 A;  4YDO B;  3QG0 A;  3EU5 B;  1KSC A;  3DSV B;  4C1S A;  4FUS A;  4MU9 A;  1O6H A;  3G6J B;  3WIR A;  3Q75 B;  2JG0 A;  3PZ3 B;  3RSY A;  4EHM B;  1TNB B;  2ZZR A;  3H7L A;  1GSZ A;  3HXB B;  3W5M A;  2AHG A;  3HXE B;  3M7L A;  2A8Z A;  4YCR A;  5M7Y A;  1JS4 A;  1KRE A;  2RI9 A;  4Z4J A;  1G87 A;  2H6G B;  2H6I B;  1G9J A;  2XQW A;  4ZRQ A;  1R76 A;  4ZH5 A;  4L9P B;  1H35 A;  2BB6 A;  5KKB A;  3SDR A;  4CE7 A;  4GTO B;  1FCE A;  4KKJ A;  4QT9 A;  3QSP A;  1JCS B;  1LD7 B;  1FBW A;  3WKI A;  1NC5 A;  3SDT A;  2BBC A;  2IEJ B;  3P2C A;  1TNZ B;  3PYB A;  3QDE A;  2CQT A;  2WIN B;  1H14 A;  3GZK A;  4TXT A;  3P5R A;  1NXC A;  2RI8 A;  2V8K A;  3W7S A;  2VN4 A;  1JCQ B;  1H54 A;  2WY8 A;  1FP3 A;  1KRF A;  1N4P B;  1O6R A;  3KQ4 A;  3ON6 A;  4J5T A;  1QSJ A;  3E37 B;  1C3D A;  3W7X A;  3M75 A;  3W5N A;  3S4A A;  3M7E A;  3KLS A;  3VXD A;  2EAB A;  4AYR A;  4Q2B A;  1L2A A;  4DOD A;  1O6Q A;  3Q7F B;  3EU8 A;  2EAC A;  3DRA B;  1DL2 A;  5E2J A;  2FV1 A;  3VW5 A;  1RQ5 A;  1G6I A;  3KSL B;  1HZF A;  1V7W A;  4AYQ A;  1DCE B;  5JPN B;  4KTR A;  4D4D A;  5CD2 A;  3WIQ A;  1QBQ B;  3QXQ A;  3W7U A;  3Q7A B;  2EAE A;  2D8L A;  1MZC B;  3EZ8 A;  1H3A A;  2GOX A;  2AFA A;  3SFX B;  3D5S A;  4WVC A;  3DSW B;  5MEH A;  5GY3 A;  1S64 B;  3CIH A;  2RGK A;  3RX7 A;  1UT9 A;  1SQC A;  4TF4 A;  2WYN A;  1UMP A;  3SDU A;  3T33 A;  3C72 B;  3K11 A;  3Q79 B;  1SA5 B;  1N4Q B;  1ULV A;  3E34 B;  2NOJ A;  3DSU B;  1GXM A;  3AFJ A;  5GW7 A;  3REN A;  1AYX A;  4Q88 A;  4ONT A;  1DOG A;  2ZIR B;  1IA6 A;  1NI1 B;  2Z07 A;  1GHQ A;  4WVB A;  1FBO A;  1GAH A;  3RX8 A;  1KSD A;  1O1S B;  2PN5 A;  4AYP A;  1FMI A;  1G9G A;  4BOK A;  2XWJ B;  5FOB B;  4KTP A;  5GZK A;  1FPP B;  1L1Y A;  5AGD A;  3DSS B;  5FO8 B;  3H2W A;  3WUX A;  4LIX A;  1LD8 B;  3DPY B;  1F9D A;  3QT3 A;  4BOJ A;  1D8D B;  3PZ1 B;  4GTP B;  1F9O A;  2P0V A;  4WVA A;  1H13 A;  4EL8 A;  4V1S A;  4D4A A;  4AYO A;  1TNY B;  5CA3 A;  1XWQ A;  3P5P A;  3GT5 A;  2V3N A;  2XFG A;  1O1R B;  2DRQ A;  3PZ2 B;  3Q78 B;  4ZH1 A;  3QPF A;  4GTQ B;  2D5J A;  1V5D A;  2V3P A;  1LTX B;  3M72 A;  5DGR A;  2I07 B;  2GZ6 A;  3PYA A;  2DRS A;  2FUZ A;  4GTS B;  3Q73 B;  1TF4 A;  3HXD B;  1KZP B;  1FO3 A;  3RJ3 A;  2V8J A;  3W7T A;  2BB5 A;  3M73 A;  1GXO A;  3TF4 A;  1XW2 A;  2ZBL A;  3GLY A;  3RRS A;  3E73 A;  4ZG8 A;  5CZL A;  4KKI A;  1GLM A;  1TN6 B;  3E32 B;  3OXU A;  3ACS A;  1TN7 B;  1W6K A;  3M71 A;  2GH4 A;  4FXK B;  3WKF A;  2FV0 A;  2G02 A;  3SDQ A;  2WY7 A;  3M7B A;  3DST B;  3QXF A;  4GTV B;  2EAD A;  3E6U A;  3OED A;  2BED B;  3HXF B;  1IS9 A;  1N9A B;  1GA2 A;  3S4D A;  2F6D A;  2PMV A;  1SA4 B;  1KS8 A;  3DSX B;  1CLC A;  2V8I A;  3ANJ A;  2NVP A;  4LNV A;  3H3K A;  1O1T B;  3W7W A;  3SAE A;  1K72 A;  1VD5 A;  3ANK A;  4GTT B;  3D5R A;  3QWT A;  1WU6 A;  1TN8 B;  3EUV B;  2OKX A;  1GXN A;  1IA7 A;  4GL3 A;  1H37 A;  3WC3 A;  1FO2 A;  3S9V A;  2R2L B;  2ZIS B;  4D4C A;  3E30 B;  3EQA A;  2JF4 A;  3PZ4 B;  1N95 B;  5FO9 B;  1FAE A;  1O5M B;  2SQC A;  4L0G A;  1KKT A;  1H36 A;  2DRR A;  4LNG B;  1WU4 A;  2AHF A;  4CJ1 A;  1TNU B;  1V7V A;  1X81 B;  4Z4L A;  1UG9 A;  3CU7 A;  4LNB B;  2FBA A;  3M78 A;  1H12 A;  3E33 B;  1CEM A;  3QRY A;  3WKH A;  1D8E B;  1H3C A;  2B4F A;  5JPM B;  1WU5 A;  3RX5 A;  5FO7 B;  2JJB A;  3A3V A;  4FXG B;  1LF9 A;  3HXC B;  4L6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...