1LTXB

Structure of rab escort protein-1 in complex with rab geranylgeranyl transferase and isoprenoid
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
326
structure length
318
Chain Sequence
KDVTIKSDPDTLLLEKHADYIASYGSCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB GERANYLGERANYLTRANSFERASE ALPHA SUBUNIT
publication title Structure of Rab Escort Protein-1 in Complex with Rab Geranylgeranyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/protein binding
total genus 105
structure length 318
sequence length 326
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2002-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ltxB00
2A73B 1N4PB 3HXBB 3Q7FB 2XWBB 1SA4B 1TN6B 1N4QB 2GOXA 3PZ1B 1O6QA 1TNZB 4LNGB 1N9AB 2WIIB 4YDEB 3DPYB 1FT1B 3G6JB 4GTMB 1TNBB 4C1SA 4EHMB 3SFYB 2BB6A 4LNBB 4ZRPA 5FOBB 4V1SA 2WINB 3Q75B 2V3NA 4FXKB 1KZPB 4LNVA 3Q78B 4BOJA 1H36A 3E30B 1C3DA 3OXUA 3DSTB 3E34B 4D4AA 1H39A 2XWJB 3HXDB 4ZRQA 3HXFB 1GXMA 3K7XA 4YDOB 3D5SA 1N94B 1SQCA 1O1TB 1TN8B 3HXCB 1SA5B 4ZH1A 5FO9B 1KZOB 1GSZA 1D8EB 3DSVB 3KLSA 1N95B 3SFXB 5AGDA 1GXNA 2V3PA 1GXOA 3HXEB 2H6HB 3PZ4B 1H3CA 3SQCA 2H6IB 4D94A 3PZ2B 4D4DA 1FPPB 5FO7B 1O1SB 1H3AA 1N4SB 2XQWA 1W6JA 2WY7A 1TNOB 1H3BA 1O6RA 2IEJB 2V8IA 4GTOB 2ZISB 4D4CA 1S63B 1GHQA 2NOJA 4M76A 1HZFA 1O6HA 3EU5B 4GTSB 2V8JA 1O79A 5JPMB 4ONTA 2PMVA 1FT2B 1N4RB 2G02A 5JPNB 3C72B 4D4BA 3DRAB 2I07B 1TNUB 1LTXB 3D5RA 3RJ3A 1LD8B 1QQFA 2SQCA 3DSUB 3Q73B 1JCRB 4L9PB 2WY8A 2R2LB 4GTRB 1UMPA 1QSJA 4MU9A 4V1RA 2ZIRB 1H37A 1LD7B 3KSQB 3OEDA 1NI1B 1NL4B 2BB5A 3E32B 2F0YB 3KQ4A 4KKIA 4GTVB 1DCEB 2B39A 1W6KA 1TNYB 3PZ3B 2BEDB 2V8KA 2H6FB 1O1RB 2PN5A 3CU7A 3E37B 1R76A 3EUVB 1QBQB 1X81B 3Q79B 3DSWB 4GTQB 3KSLB 2H6GB 1TN7B 4BOKA 1JCSB 1S64B 3DSXB 1JCQB 3Q7AB 4GTPB 4GTTB 4MBGB 3DSSB 1D8DB 1H35A 3E33B 2BBCA 2G0DA 5FO8B 1O5MB 4FXGB 1MZCB 4KKJA
chains in the Genus database with same CATH superfamily
1N4PB 3Q7FB 1N4QB 3VXDA 1TNZB 4LNGB 3SDQA 3P5RA 1KKTA 1DOGA 1FBWA 1FT1B 1RWHA 3M71A 4C1SA 3M7LA 3WIWA 1KS8A 3M01A 3QFYA 3E34B 3M74A 3HXDB 5ILZA 4WVBA 1GXMA 1WU4A 3P2CA 1N94B 2WYNA 1SA5B 1GSZA 2JG0A 4OJZA 3TF4A 1RWAA 3SFXB 5AGDA 4OZWA 2E24A 3SAEA 4OK4A 2H6IB 2ONHA 4D4DA 3H2WA 3VW5A 1N20A 2WY7A 2BRPA 1GA2A 1H3BA 5DHKA 1O6RA 1TF4A 4M76A 2DRRA 2WDAA 3NNBA 1F1SA 1N1BA 1KREA 5EASA 2V8JA 4CJ0A 1LF9A 1N4RB 3C72B 4D4BA 3DRAB 5IK9A 3P5PA 2I07B 3QDEA 1LD8B 1QQFA 3LZ9A 2WY8A 3ANIA 2EAEA 1VD5A 1X1JA 4AYQA 4TF4A 5GW7A 5ILDA 2ZIRB 1F9GA 2VN7A 1CEMA 1LD7B 3EQAA 3M7BA 3N0FA 3CIHA 3ANKA 3M77A 2RI8A 3N0GA 3VSMA 2FUQA 3E37B 4FJQA 1R76A 3RX5A 2Q1FA 1QBQB 3PMMA 1K72A 3Q79B 4RNQA 2BRWA 1JCSB 5JMDA 1S64B 1H13A 3DSXB 4GTPB 3M02A 1HM2A 2FV1A 1O5MB 4FXGB 1MZCB 3RSYA 5IK0A 1G9GA 2XWBB 4CE7A 1TN6B 3PZ1B 1O6QA 3QXQA 2WIIB 4LIXA 2F6DA 1FO2A 4YDEB 1H12A 3G6JB 4GTMB 1TNBB 4LNBB 1L1YA 1V5CA 4V1SA 4AYRA 3Q75B 3PYBA 4LNVA 3G4FA 3Q78B 5IKHA 3QFZA 3E30B 3OXUA 4AYOA 3DSTB 2XWJB 1F9OA 3HXFB 3QRYA 1HX9A 3D5SA 1J0MA 3HXCB 4ZH1A 2P0VA 3K11A 1HXCA 1NXCA 5IL3A 1JS4A 2V3PA 1L2AA 2QNOA 3HXEB 3W5NA 3GLYA 4D94A 2D8LA 3PZ2B 5ILKA 1KFGA 1N4SB 1W6JA 2V8IA 4Z4JA 5JMFA 1N24A 1CLCA 4D4CA 2E22A 1V5DA 2WCOA 1OJPA 1O6HA 4KTPA 5JPMB 1O79A 5C05A 3RRSA 1TNUB 2EACA 3H7LA 3D5RA 3DSUB 3M7CA 3SDTA 1UMPA 2BRVX 2CQTA 4MU9A 3WIRA 3KSQB 3WIQA 2BB5A 1AGMA 2F0YB 5IK6A 2B39A 4GL3A 1G87A 3X17A 3PZ3B 2BEDB 1XWQA 1X1HA 2V8KA 3QPFA 2H6FB 2FV0A 1O1RB 5M7YA 3WKHA 3M72A 3EUVB 4E1YA 1HMUA 4Q2BA 2A8ZA 5CZLA 1X81B 3GT5A 1H54A 3ANJA 4AYPA 1LF6A 4DOEA 3WKGA 1KWFA 4Z4LA 5ILJA 3AFLA 3WUXA 1JCQB 3QSPA 1UG9A 3ACSA 3W7TA 2BBCA 2G0DA 4L0GA 3E73A 4KKJA 3T33A 3HXBB 4ZG8A 1X1IA 4KTRA 3RX8A 1SA4B 1GAHA 1WZZA 3QT9A 1LOHA 1LXKA 1H14A 1N9AB 1V7WA 3SDUA 3DPYB 1IA6A 2BB6A 4ZRPA 5FOBB 2GH4A 2CQSA 2V3NA 2JJBA 3E80A 2XFGA 4BOJA 3EU8A 1C3DA 2Z07A 4D4AA 1H39A 3M78A 1FCEA 2EADA 5E2JA 3S4BA 5DGRA 1SQCA 1O1TB 1F9DA 1RW9A 1KZOB 3DSVB 3W7SA 1UT9A 3GZKA 1N95B 4GAXA 1GXNA 1FAEA 1G9JA 1RWGA 1GXOA 2H6HB 3G4DA 3S4CA 1N22A 1OJMA 1FPPB 1O1SB 4CJ1A 4GTOB 4L6XA 2ZISB 1ULVA 5ILIA 1J0NA 4XUVA 4GTSB 4WVAA 2PMVA 2G02A 3A0OA 1FBOA 5CD2A 1RWCA 1RQ5A 3RJ3A 2SQCA 3Q73B 4MMIA 2R2LB 4F10A 1OJOA 5EATA 4JJJA 4GTRB 1QSJA 3ACTA 4F13A 1IA7A 2EABA 3D3IA 1NI1B 1NL4B 1KSCA 3KQ4A 2AHFA 1DCEB 4GTVB 4J5TA 1W6KA 2DROA 2YIKA 3AFJA 1N7QA 1WU6A 5IKAA 2FBAA 3QXFA 2DRQA 5GY3A 3W5MA 5IM1A 2ZBLA 3DSWB 5CA3A 2H6GB 1TN7B 1HCUA 4FUSA 2FUZA 1N7PA 1HM3A 2D5JA 1DL2A 2VN4A 3SDVA 2GZ6A 4MBGB 1FP3A 4GTTB 5GZKA 3SDRA 3W7UA 1QAZA 4YCRA 1D8DB 3E33B 1W3YA 2A73B 1V7XA 5MEHA 1AYXA 2GOXA 3M7EA 1N21A 3EZ8A 5DGQA 3VSNA 2AHGA 4EHMB 1OJNA 2JF4A 3SFYB 1EGUA 2WINB 1XW2A 1I8QA 4FXKB 1KZPB 1HN0A 1H36A 4OZVA 1LXMA 4ZRQA 3M00A 4OK2A 2AFAA 3K7XA 3QT3A 4YDOB 1V7VA 2ONGA 1NC5A 3QWTA 1TN8B 4QT9A 5FO9B 3S4AA 1D8EB 4MMHA 4WU0A 3KLSA 2J5CA 3RENA 3M75A 3M73A 3PZ4B 3WC3A 1H3CA 3SQCA 4DI5A 1X9DA 3W7XA 1N7OA 5FO7B 1H3AA 3E7JA 2X03A 1N1ZA 2XQWA 1TNOB 1FO3A 2IEJB 1GLMA 1S63B 1GHQA 2NOJA 1HZFA 1KRFA 3EU5B 4ONTA 4DODA 1FT2B 5JPNB 1CB8A 1HV6A 2RGKA 3PYAA 1LTXB 1FMIA 1JCRB 3E6UA 4L9PB 5EAUA 3WKFA 3NFVA 1WU5A 3M76A 1G6IA 3ON6A 2B4FA 4V1RA 3WKIA 1H37A 3QG0A 1HXAA 3OEDA 1RWFA 4EL8A 2NVPA 3E32B 2FUTA 4KKIA 5DHIA 1TNYB 4NEIA 4TXTA 1HXGA 5ILHA 5KKBA 2PN5A 2RI9A 3CU7A 2ZZRA 5M7IA 3S9VA 5ILYA 4GTQB 3KSLB 3W7WA 1HMWA 1KSDA 4BOKA 4Q88A 1GAIA 3A3VA 3RX7A 3H3KA 1N23A 4FNVA 2DRSA 1XWTA 3Q7AB 2OKXA 3DSSB 1H35A 3S4DA 4ZH5A 5IL8A 1N7RA 4WVCA 5FO8B 1IS9A 1N7NA 1C82A
chains in the Genus database with same CATH topology
1N4PB 3Q7FB 1N4QB 3VXDA 1TNZB 4LNGB 3SDQA 3P5RA 1KKTA 1DOGA 1FBWA 1FT1B 3M71A 4C1SA 3M7LA 3WIWA 1KS8A 3QFYA 3E34B 3M74A 3HXDB 4WVBA 1GXMA 1WU4A 3P2CA 1N94B 2WYNA 1SA5B 1GSZA 2JG0A 3TF4A 3SFXB 5AGDA 3SAEA 2H6IB 4D4DA 3H2WA 3VW5A 2WY7A 1GA2A 1H3BA 1O6RA 1TF4A 4M76A 2DRRA 1KREA 2V8JA 4CJ0A 1LF9A 1N4RB 3C72B 4D4BA 3DRAB 3P5PA 2I07B 3QDEA 1LD8B 1QQFA 2WY8A 3ANIA 2EAEA 1VD5A 4AYQA 4TF4A 5GW7A 2ZIRB 2VN7A 1CEMA 1LD7B 3EQAA 3M7BA 3CIHA 3ANKA 3M77A 2RI8A 3E37B 1R76A 3RX5A 1QBQB 3PMMA 1K72A 3Q79B 1JCSB 1S64B 1H13A 3DSXB 4GTPB 2FV1A 1O5MB 4FXGB 1MZCB 3RSYA 1G9GA 2XWBB 4CE7A 1TN6B 3PZ1B 1O6QA 3QXQA 2WIIB 4LIXA 2F6DA 1FO2A 4YDEB 1H12A 3G6JB 4GTMB 1TNBB 4LNBB 1L1YA 1V5CA 4V1SA 4AYRA 3Q75B 3PYBA 4LNVA 3Q78B 3QFZA 3E30B 3OXUA 4AYOA 3DSTB 2XWJB 1F9OA 3HXFB 3QRYA 3D5SA 3HXCB 4ZH1A 2P0VA 3K11A 1NXCA 1JS4A 2V3PA 1L2AA 2QNOA 3HXEB 3W5NA 3GLYA 4D94A 2D8LA 3PZ2B 1KFGA 1N4SB 1W6JA 2V8IA 4Z4JA 1CLCA 4D4CA 1V5DA 4KTPA 1O6HA 5JPMB 1O79A 3RRSA 1TNUB 2EACA 3H7LA 3D5RA 3DSUB 3M7CA 3SDTA 1UMPA 2CQTA 4MU9A 3WIRA 3KSQB 3WIQA 2BB5A 1AGMA 2F0YB 2B39A 4GL3A 1G87A 3X17A 3PZ3B 2BEDB 1XWQA 2V8KA 3QPFA 2H6FB 2FV0A 1O1RB 5M7YA 3WKHA 3M72A 3EUVB 4Q2BA 2A8ZA 5CZLA 1X81B 3GT5A 1H54A 3ANJA 4AYPA 1LF6A 4DOEA 3WKGA 1KWFA 4Z4LA 3WUXA 1JCQB 3QSPA 1UG9A 3ACSA 3W7TA 2BBCA 2G0DA 4L0GA 3E73A 4KKJA 3T33A 3HXBB 4ZG8A 4KTRA 3RX8A 1SA4B 1GAHA 1WZZA 3QT9A 1H14A 1N9AB 1V7WA 3SDUA 3DPYB 1IA6A 2BB6A 4ZRPA 5FOBB 2GH4A 2CQSA 2V3NA 2JJBA 2XFGA 4BOJA 3EU8A 1C3DA 2Z07A 4D4AA 1H39A 3M78A 1FCEA 2EADA 5E2JA 3S4BA 5DGRA 1SQCA 1O1TB 1F9DA 1KZOB 3DSVB 3W7SA 1UT9A 3GZKA 1N95B 1GXNA 1FAEA 1G9JA 1GXOA 2H6HB 3S4CA 1FPPB 1O1SB 4CJ1A 4GTOB 4L6XA 2ZISB 1ULVA 4XUVA 4GTSB 4WVAA 2PMVA 2G02A 1FBOA 5CD2A 1RQ5A 3RJ3A 2SQCA 3Q73B 2R2LB 4JJJA 4GTRB 1QSJA 3ACTA 1IA7A 2EABA 3D3IA 1NI1B 1NL4B 1KSCA 3KQ4A 2AHFA 1DCEB 4GTVB 4J5TA 1W6KA 2DROA 2YIKA 3AFJA 1WU6A 2FBAA 3QXFA 2DRQA 5GY3A 3W5MA 2ZBLA 3DSWB 5CA3A 2H6GB 1TN7B 1HCUA 4FUSA 2FUZA 2D5JA 1DL2A 2VN4A 3SDVA 2GZ6A 4MBGB 1FP3A 4GTTB 5GZKA 3SDRA 3W7UA 4YCRA 1D8DB 3E33B 2A73B 1V7XA 5MEHA 1AYXA 2GOXA 3M7EA 3EZ8A 5DGQA 2AHGA 4EHMB 2JF4A 3SFYB 2WINB 1XW2A 4FXKB 1KZPB 1H36A 4ZRQA 2AFAA 3K7XA 3QT3A 4YDOB 1V7VA 3QWTA 1NC5A 1TN8B 4QT9A 5FO9B 3S4AA 1D8EB 4WU0A 3KLSA 3RENA 3M75A 3M73A 3PZ4B 3WC3A 1H3CA 3SQCA 3W7XA 1X9DA 5FO7B 1H3AA 2XQWA 1TNOB 1FO3A 2IEJB 1GLMA 1S63B 1GHQA 2NOJA 1HZFA 1KRFA 3EU5B 4ONTA 4DODA 1FT2B 5JPNB 2RGKA 3PYAA 1LTXB 1FMIA 1JCRB 3E6UA 4L9PB 3WKFA 1WU5A 3M76A 1G6IA 3ON6A 2B4FA 4V1RA 3WKIA 1H37A 3QG0A 3OEDA 4EL8A 2NVPA 3E32B 4KKIA 1TNYB 4TXTA 5KKBA 2PN5A 2RI9A 3CU7A 2ZZRA 5M7IA 4GTQB 3KSLB 3W7WA 1KSDA 4BOKA 4Q88A 1GAIA 3A3VA 3RX7A 3H3KA 2DRSA 1XWTA 3Q7AB 2OKXA 3DSSB 1H35A 3S4DA 4ZH5A 4WVCA 5FO8B 1IS9A 3S9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A73 B;  1N4P B;  3HXB B;  3Q7F B;  2XWB B;  1SA4 B;  1TN6 B;  1N4Q B;  2GOX A;  3PZ1 B;  1O6Q A;  1TNZ B;  4LNG B;  1N9A B;  2WII B;  4YDE B;  3DPY B;  1FT1 B;  3G6J B;  4GTM B;  1TNB B;  4C1S A;  4EHM B;  3SFY B;  2BB6 A;  4LNB B;  4ZRP A;  5FOB B;  4V1S A;  2WIN B;  3Q75 B;  2V3N A;  4FXK B;  1KZP B;  4LNV A;  3Q78 B;  4BOJ A;  1H36 A;  3E30 B;  1C3D A;  3OXU A;  3DST B;  3E34 B;  4D4A A;  1H39 A;  2XWJ B;  3HXD B;  4ZRQ A;  3HXF B;  1GXM A;  3K7X A;  4YDO B;  3D5S A;  1N94 B;  1SQC A;  1O1T B;  1TN8 B;  3HXC B;  1SA5 B;  4ZH1 A;  5FO9 B;  1KZO B;  1GSZ A;  1D8E B;  3DSV B;  3KLS A;  1N95 B;  3SFX B;  5AGD A;  1GXN A;  2V3P A;  1GXO A;  3HXE B;  2H6H B;  3PZ4 B;  1H3C A;  3SQC A;  2H6I B;  4D94 A;  3PZ2 B;  4D4D A;  1FPP B;  5FO7 B;  1O1S B;  1H3A A;  1N4S B;  2XQW A;  1W6J A;  2WY7 A;  1TNO B;  1H3B A;  1O6R A;  2IEJ B;  2V8I A;  4GTO B;  2ZIS B;  4D4C A;  1S63 B;  1GHQ A;  2NOJ A;  4M76 A;  1HZF A;  1O6H A;  3EU5 B;  4GTS B;  2V8J A;  1O79 A;  5JPM B;  4ONT A;  2PMV A;  1FT2 B;  1N4R B;  2G02 A;  5JPN B;  3C72 B;  4D4B A;  3DRA B;  2I07 B;  1TNU B;  1LTX B;  3D5R A;  3RJ3 A;  1LD8 B;  1QQF A;  2SQC A;  3DSU B;  3Q73 B;  1JCR B;  4L9P B;  2WY8 A;  2R2L B;  4GTR B;  1UMP A;  1QSJ A;  4MU9 A;  4V1R A;  2ZIR B;  1H37 A;  1LD7 B;  3KSQ B;  3OED A;  1NI1 B;  1NL4 B;  2BB5 A;  3E32 B;  2F0Y B;  3KQ4 A;  4KKI A;  4GTV B;  1DCE B;  2B39 A;  1W6K A;  1TNY B;  3PZ3 B;  2BED B;  2V8K A;  2H6F B;  1O1R B;  2PN5 A;  3CU7 A;  3E37 B;  1R76 A;  3EUV B;  1QBQ B;  1X81 B;  3Q79 B;  3DSW B;  4GTQ B;  3KSL B;  2H6G B;  1TN7 B;  4BOK A;  1JCS B;  1S64 B;  3DSX B;  1JCQ B;  3Q7A B;  4GTP B;  4GTT B;  4MBG B;  3DSS B;  1D8D B;  1H35 A;  3E33 B;  2BBC A;  2G0D A;  5FO8 B;  1O5M B;  4FXG B;  1MZC B;  4KKJ A; 
#chains in the Genus database with same CATH topology
 1N4P B;  3Q7F B;  1N4Q B;  3VXD A;  1TNZ B;  4LNG B;  3SDQ A;  3P5R A;  1KKT A;  1DOG A;  1FBW A;  1FT1 B;  1RWH A;  3M71 A;  4C1S A;  3M7L A;  3WIW A;  1KS8 A;  3M01 A;  3QFY A;  3E34 B;  3M74 A;  3HXD B;  5ILZ A;  4WVB A;  1GXM A;  1WU4 A;  3P2C A;  1N94 B;  2WYN A;  1SA5 B;  1GSZ A;  2JG0 A;  4OJZ A;  3TF4 A;  1RWA A;  3SFX B;  5AGD A;  4OZW A;  2E24 A;  3SAE A;  4OK4 A;  2H6I B;  2ONH A;  4D4D A;  3H2W A;  3VW5 A;  1N20 A;  2WY7 A;  2BRP A;  1GA2 A;  1H3B A;  5DHK A;  1O6R A;  1TF4 A;  4M76 A;  2DRR A;  2WDA A;  3NNB A;  1F1S A;  1N1B A;  1KRE A;  5EAS A;  2V8J A;  4CJ0 A;  1LF9 A;  1N4R B;  3C72 B;  4D4B A;  3DRA B;  5IK9 A;  3P5P A;  2I07 B;  3QDE A;  1LD8 B;  1QQF A;  3LZ9 A;  2WY8 A;  3ANI A;  2EAE A;  1VD5 A;  1X1J A;  4AYQ A;  4TF4 A;  5GW7 A;  5ILD A;  2ZIR B;  1F9G A;  2VN7 A;  1CEM A;  1LD7 B;  3EQA A;  3M7B A;  3N0F A;  3CIH A;  3ANK A;  3M77 A;  2RI8 A;  3N0G A;  3VSM A;  2FUQ A;  3E37 B;  4FJQ A;  1R76 A;  3RX5 A;  2Q1F A;  1QBQ B;  3PMM A;  1K72 A;  3Q79 B;  4RNQ A;  2BRW A;  1JCS B;  5JMD A;  1S64 B;  1H13 A;  3DSX B;  4GTP B;  3M02 A;  1HM2 A;  2FV1 A;  1O5M B;  4FXG B;  1MZC B;  3RSY A;  5IK0 A;  1G9G A;  2XWB B;  4CE7 A;  1TN6 B;  3PZ1 B;  1O6Q A;  3QXQ A;  2WII B;  4LIX A;  2F6D A;  1FO2 A;  4YDE B;  1H12 A;  3G6J B;  4GTM B;  1TNB B;  4LNB B;  1L1Y A;  1V5C A;  4V1S A;  4AYR A;  3Q75 B;  3PYB A;  4LNV A;  3G4F A;  3Q78 B;  5IKH A;  3QFZ A;  3E30 B;  3OXU A;  4AYO A;  3DST B;  2XWJ B;  1F9O A;  3HXF B;  3QRY A;  1HX9 A;  3D5S A;  1J0M A;  3HXC B;  4ZH1 A;  2P0V A;  3K11 A;  1HXC A;  1NXC A;  5IL3 A;  1JS4 A;  2V3P A;  1L2A A;  2QNO A;  3HXE B;  3W5N A;  3GLY A;  4D94 A;  2D8L A;  3PZ2 B;  5ILK A;  1KFG A;  1N4S B;  1W6J A;  2V8I A;  4Z4J A;  5JMF A;  1N24 A;  1CLC A;  4D4C A;  2E22 A;  1V5D A;  2WCO A;  1OJP A;  1O6H A;  4KTP A;  5JPM B;  1O79 A;  5C05 A;  3RRS A;  1TNU B;  2EAC A;  3H7L A;  3D5R A;  3DSU B;  3M7C A;  3SDT A;  1UMP A;  2BRV X;  2CQT A;  4MU9 A;  3WIR A;  3KSQ B;  3WIQ A;  2BB5 A;  1AGM A;  2F0Y B;  5IK6 A;  2B39 A;  4GL3 A;  1G87 A;  3X17 A;  3PZ3 B;  2BED B;  1XWQ A;  1X1H A;  2V8K A;  3QPF A;  2H6F B;  2FV0 A;  1O1R B;  5M7Y A;  3WKH A;  3M72 A;  3EUV B;  4E1Y A;  1HMU A;  4Q2B A;  2A8Z A;  5CZL A;  1X81 B;  3GT5 A;  1H54 A;  3ANJ A;  4AYP A;  1LF6 A;  4DOE A;  3WKG A;  1KWF A;  4Z4L A;  5ILJ A;  3AFL A;  3WUX A;  1JCQ B;  3QSP A;  1UG9 A;  3ACS A;  3W7T A;  2BBC A;  2G0D A;  4L0G A;  3E73 A;  4KKJ A;  3T33 A;  3HXB B;  4ZG8 A;  1X1I A;  4KTR A;  3RX8 A;  1SA4 B;  1GAH A;  1WZZ A;  3QT9 A;  1LOH A;  1LXK A;  1H14 A;  1N9A B;  1V7W A;  3SDU A;  3DPY B;  1IA6 A;  2BB6 A;  4ZRP A;  5FOB B;  2GH4 A;  2CQS A;  2V3N A;  2JJB A;  3E80 A;  2XFG A;  4BOJ A;  3EU8 A;  1C3D A;  2Z07 A;  4D4A A;  1H39 A;  3M78 A;  1FCE A;  2EAD A;  5E2J A;  3S4B A;  5DGR A;  1SQC A;  1O1T B;  1F9D A;  1RW9 A;  1KZO B;  3DSV B;  3W7S A;  1UT9 A;  3GZK A;  1N95 B;  4GAX A;  1GXN A;  1FAE A;  1G9J A;  1RWG A;  1GXO A;  2H6H B;  3G4D A;  3S4C A;  1N22 A;  1OJM A;  1FPP B;  1O1S B;  4CJ1 A;  4GTO B;  4L6X A;  2ZIS B;  1ULV A;  5ILI A;  1J0N A;  4XUV A;  4GTS B;  4WVA A;  2PMV A;  2G02 A;  3A0O A;  1FBO A;  5CD2 A;  1RWC A;  1RQ5 A;  3RJ3 A;  2SQC A;  3Q73 B;  4MMI A;  2R2L B;  4F10 A;  1OJO A;  5EAT A;  4JJJ A;  4GTR B;  1QSJ A;  3ACT A;  4F13 A;  1IA7 A;  2EAB A;  3D3I A;  1NI1 B;  1NL4 B;  1KSC A;  3KQ4 A;  2AHF A;  1DCE B;  4GTV B;  4J5T A;  1W6K A;  2DRO A;  2YIK A;  3AFJ A;  1N7Q A;  1WU6 A;  5IKA A;  2FBA A;  3QXF A;  2DRQ A;  5GY3 A;  3W5M A;  5IM1 A;  2ZBL A;  3DSW B;  5CA3 A;  2H6G B;  1TN7 B;  1HCU A;  4FUS A;  2FUZ A;  1N7P A;  1HM3 A;  2D5J A;  1DL2 A;  2VN4 A;  3SDV A;  2GZ6 A;  4MBG B;  1FP3 A;  4GTT B;  5GZK A;  3SDR A;  3W7U A;  1QAZ A;  4YCR A;  1D8D B;  3E33 B;  1W3Y A;  2A73 B;  1V7X A;  5MEH A;  1AYX A;  2GOX A;  3M7E A;  1N21 A;  3EZ8 A;  5DGQ A;  3VSN A;  2AHG A;  4EHM B;  1OJN A;  2JF4 A;  3SFY B;  1EGU A;  2WIN B;  1XW2 A;  1I8Q A;  4FXK B;  1KZP B;  1HN0 A;  1H36 A;  4OZV A;  1LXM A;  4ZRQ A;  3M00 A;  4OK2 A;  2AFA A;  3K7X A;  3QT3 A;  4YDO B;  1V7V A;  2ONG A;  1NC5 A;  3QWT A;  1TN8 B;  4QT9 A;  5FO9 B;  3S4A A;  1D8E B;  4MMH A;  4WU0 A;  3KLS A;  2J5C A;  3REN A;  3M75 A;  3M73 A;  3PZ4 B;  3WC3 A;  1H3C A;  3SQC A;  4DI5 A;  1X9D A;  3W7X A;  1N7O A;  5FO7 B;  1H3A A;  3E7J A;  2X03 A;  1N1Z A;  2XQW A;  1TNO B;  1FO3 A;  2IEJ B;  1GLM A;  1S63 B;  1GHQ A;  2NOJ A;  1HZF A;  1KRF A;  3EU5 B;  4ONT A;  4DOD A;  1FT2 B;  5JPN B;  1CB8 A;  1HV6 A;  2RGK A;  3PYA A;  1LTX B;  1FMI A;  1JCR B;  3E6U A;  4L9P B;  5EAU A;  3WKF A;  3NFV A;  1WU5 A;  3M76 A;  1G6I A;  3ON6 A;  2B4F A;  4V1R A;  3WKI A;  1H37 A;  3QG0 A;  1HXA A;  3OED A;  1RWF A;  4EL8 A;  2NVP A;  3E32 B;  2FUT A;  4KKI A;  5DHI A;  1TNY B;  4NEI A;  4TXT A;  1HXG A;  5ILH A;  5KKB A;  2PN5 A;  2RI9 A;  3CU7 A;  2ZZR A;  5M7I A;  3S9V A;  5ILY A;  4GTQ B;  3KSL B;  3W7W A;  1HMW A;  1KSD A;  4BOK A;  4Q88 A;  1GAI A;  3A3V A;  3RX7 A;  3H3K A;  1N23 A;  4FNV A;  2DRS A;  1XWT A;  3Q7A B;  2OKX A;  3DSS B;  1H35 A;  3S4D A;  4ZH5 A;  5IL8 A;  1N7R A;  4WVC A;  5FO8 B;  1IS9 A;  1N7N A;  1C82 A; 
#chains in the Genus database with same CATH homology
 1N4P B;  3Q7F B;  1N4Q B;  3VXD A;  1TNZ B;  4LNG B;  3SDQ A;  3P5R A;  1KKT A;  1DOG A;  1FBW A;  1FT1 B;  3M71 A;  4C1S A;  3M7L A;  3WIW A;  1KS8 A;  3QFY A;  3E34 B;  3M74 A;  3HXD B;  4WVB A;  1GXM A;  1WU4 A;  3P2C A;  1N94 B;  2WYN A;  1SA5 B;  1GSZ A;  2JG0 A;  3TF4 A;  3SFX B;  5AGD A;  3SAE A;  2H6I B;  4D4D A;  3H2W A;  3VW5 A;  2WY7 A;  1GA2 A;  1H3B A;  1O6R A;  1TF4 A;  4M76 A;  2DRR A;  1KRE A;  2V8J A;  4CJ0 A;  1LF9 A;  1N4R B;  3C72 B;  4D4B A;  3DRA B;  3P5P A;  2I07 B;  3QDE A;  1LD8 B;  1QQF A;  2WY8 A;  3ANI A;  2EAE A;  1VD5 A;  4AYQ A;  4TF4 A;  5GW7 A;  2ZIR B;  2VN7 A;  1CEM A;  1LD7 B;  3EQA A;  3M7B A;  3CIH A;  3ANK A;  3M77 A;  2RI8 A;  3E37 B;  1R76 A;  3RX5 A;  1QBQ B;  3PMM A;  1K72 A;  3Q79 B;  1JCS B;  1S64 B;  1H13 A;  3DSX B;  4GTP B;  2FV1 A;  1O5M B;  4FXG B;  1MZC B;  3RSY A;  1G9G A;  2XWB B;  4CE7 A;  1TN6 B;  3PZ1 B;  1O6Q A;  3QXQ A;  2WII B;  4LIX A;  2F6D A;  1FO2 A;  4YDE B;  1H12 A;  3G6J B;  4GTM B;  1TNB B;  4LNB B;  1L1Y A;  1V5C A;  4V1S A;  4AYR A;  3Q75 B;  3PYB A;  4LNV A;  3Q78 B;  3QFZ A;  3E30 B;  3OXU A;  4AYO A;  3DST B;  2XWJ B;  1F9O A;  3HXF B;  3QRY A;  3D5S A;  3HXC B;  4ZH1 A;  2P0V A;  3K11 A;  1NXC A;  1JS4 A;  2V3P A;  1L2A A;  2QNO A;  3HXE B;  3W5N A;  3GLY A;  4D94 A;  2D8L A;  3PZ2 B;  1KFG A;  1N4S B;  1W6J A;  2V8I A;  4Z4J A;  1CLC A;  4D4C A;  1V5D A;  4KTP A;  1O6H A;  5JPM B;  1O79 A;  3RRS A;  1TNU B;  2EAC A;  3H7L A;  3D5R A;  3DSU B;  3M7C A;  3SDT A;  1UMP A;  2CQT A;  4MU9 A;  3WIR A;  3KSQ B;  3WIQ A;  2BB5 A;  1AGM A;  2F0Y B;  2B39 A;  4GL3 A;  1G87 A;  3X17 A;  3PZ3 B;  2BED B;  1XWQ A;  2V8K A;  3QPF A;  2H6F B;  2FV0 A;  1O1R B;  5M7Y A;  3WKH A;  3M72 A;  3EUV B;  4Q2B A;  2A8Z A;  5CZL A;  1X81 B;  3GT5 A;  1H54 A;  3ANJ A;  4AYP A;  1LF6 A;  4DOE A;  3WKG A;  1KWF A;  4Z4L A;  3WUX A;  1JCQ B;  3QSP A;  1UG9 A;  3ACS A;  3W7T A;  2BBC A;  2G0D A;  4L0G A;  3E73 A;  4KKJ A;  3T33 A;  3HXB B;  4ZG8 A;  4KTR A;  3RX8 A;  1SA4 B;  1GAH A;  1WZZ A;  3QT9 A;  1H14 A;  1N9A B;  1V7W A;  3SDU A;  3DPY B;  1IA6 A;  2BB6 A;  4ZRP A;  5FOB B;  2GH4 A;  2CQS A;  2V3N A;  2JJB A;  2XFG A;  4BOJ A;  3EU8 A;  1C3D A;  2Z07 A;  4D4A A;  1H39 A;  3M78 A;  1FCE A;  2EAD A;  5E2J A;  3S4B A;  5DGR A;  1SQC A;  1O1T B;  1F9D A;  1KZO B;  3DSV B;  3W7S A;  1UT9 A;  3GZK A;  1N95 B;  1GXN A;  1FAE A;  1G9J A;  1GXO A;  2H6H B;  3S4C A;  1FPP B;  1O1S B;  4CJ1 A;  4GTO B;  4L6X A;  2ZIS B;  1ULV A;  4XUV A;  4GTS B;  4WVA A;  2PMV A;  2G02 A;  1FBO A;  5CD2 A;  1RQ5 A;  3RJ3 A;  2SQC A;  3Q73 B;  2R2L B;  4JJJ A;  4GTR B;  1QSJ A;  3ACT A;  1IA7 A;  2EAB A;  3D3I A;  1NI1 B;  1NL4 B;  1KSC A;  3KQ4 A;  2AHF A;  1DCE B;  4GTV B;  4J5T A;  1W6K A;  2DRO A;  2YIK A;  3AFJ A;  1WU6 A;  2FBA A;  3QXF A;  2DRQ A;  5GY3 A;  3W5M A;  2ZBL A;  3DSW B;  5CA3 A;  2H6G B;  1TN7 B;  1HCU A;  4FUS A;  2FUZ A;  2D5J A;  1DL2 A;  2VN4 A;  3SDV A;  2GZ6 A;  4MBG B;  1FP3 A;  4GTT B;  5GZK A;  3SDR A;  3W7U A;  4YCR A;  1D8D B;  3E33 B;  2A73 B;  1V7X A;  5MEH A;  1AYX A;  2GOX A;  3M7E A;  3EZ8 A;  5DGQ A;  2AHG A;  4EHM B;  2JF4 A;  3SFY B;  2WIN B;  1XW2 A;  4FXK B;  1KZP B;  1H36 A;  4ZRQ A;  2AFA A;  3K7X A;  3QT3 A;  4YDO B;  1V7V A;  3QWT A;  1NC5 A;  1TN8 B;  4QT9 A;  5FO9 B;  3S4A A;  1D8E B;  4WU0 A;  3KLS A;  3REN A;  3M75 A;  3M73 A;  3PZ4 B;  3WC3 A;  1H3C A;  3SQC A;  3W7X A;  1X9D A;  5FO7 B;  1H3A A;  2XQW A;  1TNO B;  1FO3 A;  2IEJ B;  1GLM A;  1S63 B;  1GHQ A;  2NOJ A;  1HZF A;  1KRF A;  3EU5 B;  4ONT A;  4DOD A;  1FT2 B;  5JPN B;  2RGK A;  3PYA A;  1LTX B;  1FMI A;  1JCR B;  3E6U A;  4L9P B;  3WKF A;  1WU5 A;  3M76 A;  1G6I A;  3ON6 A;  2B4F A;  4V1R A;  3WKI A;  1H37 A;  3QG0 A;  3OED A;  4EL8 A;  2NVP A;  3E32 B;  4KKI A;  1TNY B;  4TXT A;  5KKB A;  2PN5 A;  2RI9 A;  3CU7 A;  2ZZR A;  5M7I A;  4GTQ B;  3KSL B;  3W7W A;  1KSD A;  4BOK A;  4Q88 A;  1GAI A;  3A3V A;  3RX7 A;  3H3K A;  2DRS A;  1XWT A;  3Q7A B;  2OKX A;  3DSS B;  1H35 A;  3S4D A;  4ZH5 A;  4WVC A;  5FO8 B;  1IS9 A;  3S9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...