4ZH1A

Complement factor h in complex with the gm1 glycan
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
293
structure length
293
Chain Sequence
b'RDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Complement Factor H and Simian Virus 40 bind the GM1 ganglioside in distinct conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 118
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4zh1A00
3D5SA 1O6HA 1GXOA 1H37A 1H35A 1MZCB 1NI1B 1TN6B 1O1SB 3PZ2B 2R2LB 3DSTB 4ZRQA 2V3PA 3E37B 4GTSB 3DRAB 5FOBB 3KLSA 5FO7B 1TN7B 4BOKA 4ZRPA 1D8EB 2ZISB 4YDEB 2V8IA 1N9AB 2H6GB 4D4DA 1SQCA 1FT2B 2PMVA 4ZH1A 4EHMB 2BB6A 1QQFA 1TNUB 2WINB 1N95B 4LNGB 4M76A 4FXGB 3PZ3B 2BBCA 1S64B 1UMPA 4KKIA 1O5MB 4KKJA 4BOJA 4D94A 3OXUA 1JCRB 2A73B 4LNBB 2V8JA 2H6HB 1GXMA 1QSJA 1LD7B 5AGDA 1JCSB 1NL4B 3G6JB 2IEJB 4D4BA 4ONTA 2XWBB 3PZ4B 1TN8B 2BEDB 1SA5B 3Q7FB 2V8KA 4GTQB 1FPPB 3OEDA 4GTPB 1FT1B 2ZIRB 1GXNA 2WY7A 3HXFB 3KQ4A 1C3DA 2XWJB 1W6KA 2V3NA 3PZ1B 4GTVB 3E33B 2G0DA 2WY8A 1H3AA 1N4RB 3HXBB 3KSQB 2I07B 3Q75B 4YDOB 4GTOB 4GTTB 2NOJA 1KZOB 2B39A 1N4PB 4FXKB 1H39A 3D5RA 5JPNB 3EU5B 1LD8B 3E30B 3E32B 1GHQA 3DSUB 1GSZA 2F0YB 4D4AA 3DPYB 3EUVB 4MU9A 2XQWA 1W6JA 4V1RA 5FO8B 1HZFA 2H6IB 3SFXB 1N4QB 1TNBB 3HXDB 4GTMB 5FO9B 1KZPB 4D4CA 2H6FB 2PN5A 5JPMB 1O6QA 1N4SB 4MBGB 1N94B 4LNVA 1TNYB 3CU7A 3Q78B 3E34B 1O79A 3KSLB 1R76A 3K7XA 3SQCA 2WIIB 3HXCB 3Q7AB 3HXEB 3Q79B 3C72B 1JCQB 1H3CA 1O1RB 4L9PB 4V1SA 1D8DB 1TNZB 1H36A 3DSVB 4C1SA 2G02A 3RJ3A 1SA4B 1QBQB 1X81B 2GOXA 2BB5A 3DSWB 2SQCA 1TNOB 3DSSB 1O6RA 1H3BA 1S63B 3Q73B 1O1TB 4GTRB 3SFYB 1LTXB 1DCEB 3DSXB
chains in the Genus database with same CATH superfamily
3T33A 5ILIA 1H35A 3WIWA 1L2AA 2DROA 2NVPA 1TN6B 4WU0A 3PZ2B 1KFGA 2V3PA 5EATA 3QT3A 3KLSA 5IM1A 1X1IA 1KRFA 1N21A 4YDEB 1N9AB 1FT2B 1L1YA 4M76A 5M7IA 3G4FA 4OZWA 1HM3A 3QT9A 1OJOA 1JCRB 1NXCA 1DOGA 1GXMA 1FAEA 3W7UA 5AGDA 3RX5A 5IK9A 5CZLA 3G6JB 2FUTA 4D4BA 3M7EA 5IL8A 2XWBB 1TN8B 2X03A 1H13A 4Q2BA 4GTPB 1FT1B 5M7YA 1XWTA 1X1HA 3D3IA 3S4BA 1GA2A 3QPFA 1NC5A 1FBOA 3WKIA 3E7JA 4YDOB 5JMDA 1W3YA 2B4FA 2P0VA 3E30B 3M7CA 2DRSA 1N24A 3DPYB 1FCEA 3CIHA 4MU9A 2XQWA 2EABA 3M72A 1CEMA 3RRSA 3WUXA 4AYQA 1WZZA 4Z4JA 1KZPB 2J5CA 2H6FB 3M02A 1N4SB 1TNYB 4JJJA 2F6DA 3Q78B 1O79A 4L0GA 1HV6A 3QFYA 3K7XA 1KKTA 3ANJA 2WIIB 3Q79B 4Q88A 3SDQA 4L9PB 1OJMA 1H36A 5IK0A 3WIRA 4C1SA 1I8QA 2OKXA 3RJ3A 1XWQA 2SQCA 2QNOA 1JS4A 3Q73B 3SFYB 2YIKA 1FBWA 5MEHA 2ZBLA 1RWGA 1O1SB 4WVAA 4ZRQA 1HX9A 2EADA 1RWAA 1N7OA 2ZISB 5DHKA 2JJBA 2H6GB 4D4DA 4XUVA 4ZH1A 2BB6A 2WINB 3PZ3B 3EZ8A 2BBCA 5KKBA 1O5MB 3ANKA 1HMUA 4KKJA 3OXUA 4LNBB 2V8JA 2BRPA 4DOEA 1QSJA 4AYOA 1J0NA 4OJZA 4E1YA 3H2WA 4NEIA 4WVCA 1JCSB 1KWFA 3S4AA 5GW7A 3WIQA 3PZ4B 1SA5B 2V8KA 4GTQB 3OEDA 3M77A 4FJQA 1GXNA 3GZKA 3HXFB 3QG0A 1LXMA 2V3NA 1RQ5A 4FUSA 5EASA 2JF4A 3E33B 2WY8A 1FO3A 3HXBB 2BRVX 4OK2A 2XFGA 4GTTB 2B39A 1N4PB 3D5RA 1TF4A 3E32B 2AFAA 2DRQA 1RW9A 1H54A 1LF9A 3EQAA 4V1RA 1W6JA 3RX8A 3VXDA 1AYXA 5FO8B 3X17A 2FUQA 3HXDB 3QRYA 1F1SA 4KTPA 3GT5A 4MBGB 1V7XA 1N94B 3PYBA 3M76A 1V7WA 2ONHA 3W7SA 3PYAA 1F9OA 2GH4A 1R76A 1KS8A 3Q7AB 3C72B 1K72A 4OK4A 4V1SA 1D8DB 3DSVB 1HXAA 3M7LA 1SA4B 4L6XA 4OZVA 1QBQB 2Z07A 3VW5A 3VSNA 3VSMA 3SAEA 3DSWB 2E22A 1O6RA 1H3BA 2EACA 1LTXB 1H37A 1UT9A 1O6HA 1GXOA 5ILKA 1F9GA 1MZCB 1X9DA 1NI1B 3DSTB 3E37B 1GAHA 1XW2A 1IA6A 3DRAB 5FO7B 1TN7B 1CB8A 3M78A 2GZ6A 4BOKA 1D8EB 2V8IA 5IL3A 1SQCA 2WCOA 2PMVA 5GZKA 3P5RA 1OJPA 1N95B 3K11A 4FXGB 5DGRA 4QT9A 1UMPA 4KKIA 3N0FA 4BOJA 1HM2A 1N7QA 2A73B 1WU5A 2WYNA 1LD7B 4MMIA 1N1BA 1UG9A 1NL4B 1RWHA 5IK6A 5CA3A 1HMWA 1OJNA 1N22A 1J0MA 3Q7FB 1HN0A 1GAIA 2AHGA 4GAXA 2WY7A 3M75A 3EU8A 1H14A 2XWJB 4EL8A 2FV1A 1W6KA 3PZ1B 5JMFA 4GTVB 2RI9A 1H3AA 1CLCA 4DI5A 4ZG8A 3RX7A 1F9DA 2I07B 5ILJA 1C82A 3S4DA 1FP3A 2EAEA 4GTOB 1LF6A 1HXGA 1X1JA 2NOJA 3M73A 1KZOB 1FO2A 1H12A 1H39A 4FNVA 3N0GA 5ILHA 1HCUA 1GSZA 2F0YB 4GL3A 4D4AA 1G6IA 1V5CA 5CD2A 5IKAA 3TF4A 1RWCA 1HZFA 2H6IB 3M71A 3SFXB 1N4QB 2RI8A 5DGQA 1HXCA 4TXTA 3S4CA 4GTMB 2D5JA 4ZH5A 5FO9B 5JPMB 1O6QA 4LNVA 3ACTA 3WKHA 3E34B 1VD5A 3KSLB 3W7WA 1N7RA 5GY3A 3PMMA 3ACSA 3RSYA 1FMIA 3A3VA 3HXEB 3QFZA 1JCQB 4DODA 1H3CA 4CJ0A 5IKHA 1DL2A 1KREA 1N7NA 2DRRA 1LOHA 3ANIA 1X81B 2GOXA 5DHIA 3E80A 3GLYA 1KSDA 5C05A 1G87A 1O1TB 3QSPA 1DCEB 3DSXB 4ONTA 3D5SA 1V7VA 3SDVA 2R2LB 4F13A 4GTSB 2JG0A 5FOBB 3S9VA 3W7TA 4CE7A 4ZRPA 3AFLA 3M01A 3W5NA 2AHFA 1G9JA 3A0OA 4EHMB 1QQFA 1TNUB 4LNGB 3WKFA 1S64B 4D94A 3LZ9A 3WC3A 3AFJA 1N7PA 4WVBA 2H6HB 5ILDA 1WU6A 2WDAA 2IEJB 3M74A 1KSCA 3SDRA 4Z4LA 3W5MA 1G9GA 2BEDB 2ZZRA 4LIXA 1GLMA 1FPPB 1AGMA 2ZIRB 2CQTA 3W7XA 5ILYA 1IS9A 1C3DA 3KQ4A 2CQSA 2G0DA 1QAZA 1LXKA 1N4RB 2E24A 2VN4A 4F10A 3KSQB 4AYPA 3E6UA 3Q75B 1IA7A 3WKGA 3ON6A 3QXQA 2D8LA 3P5PA 3QWTA 3QXFA 4FXKB 3H3KA 5EAUA 5JPNB 1RWFA 3EU5B 1LD8B 1GHQA 3DSUB 1WU4A 2A8ZA 1N1ZA 3EUVB 4J5TA 1EGUA 3P2CA 1N23A 1TNBB 2FUZA 3E73A 4D4CA 2PN5A 3NNBA 2FBAA 4TF4A 3CU7A 3H7LA 5ILZA 3M7BA 4MMHA 3QDEA 2VN7A 3HXCB 4YCRA 3SDUA 3M00A 3SQCA 3G4DA 3RENA 4KTRA 1O1RB 1TNZB 3NFVA 4AYRA 2BRWA 2RGKA 1ULVA 4CJ1A 5E2JA 2G02A 2Q1FA 2BB5A 2FV0A 3DSSB 1TNOB 1V5DA 4GTRB 1S63B 1N20A 3SDTA 4RNQA 2ONGA
chains in the Genus database with same CATH topology
3T33A 1H35A 3WIWA 1L2AA 2DROA 2NVPA 1TN6B 4WU0A 3PZ2B 1KFGA 2V3PA 3QT3A 3KLSA 1KRFA 4YDEB 1N9AB 1FT2B 1L1YA 4M76A 5M7IA 3QT9A 1JCRB 1NXCA 1DOGA 1GXMA 1FAEA 3W7UA 5AGDA 3RX5A 5CZLA 3G6JB 4D4BA 3M7EA 2XWBB 1TN8B 1H13A 4Q2BA 4GTPB 1FT1B 5M7YA 1XWTA 3D3IA 3S4BA 3QPFA 1GA2A 1NC5A 1FBOA 3WKIA 4YDOB 2B4FA 2P0VA 3E30B 3M7CA 2DRSA 3DPYB 1FCEA 3CIHA 4MU9A 2XQWA 2EABA 3M72A 1CEMA 3RRSA 3WUXA 4AYQA 1WZZA 4Z4JA 1KZPB 2H6FB 1N4SB 1TNYB 4JJJA 2F6DA 3Q78B 1O79A 4L0GA 3QFYA 3K7XA 1KKTA 3ANJA 2WIIB 3Q79B 4Q88A 3SDQA 4L9PB 1H36A 3WIRA 4C1SA 2OKXA 3RJ3A 1XWQA 2SQCA 2QNOA 1JS4A 3Q73B 3SFYB 2YIKA 1FBWA 5MEHA 2ZBLA 1O1SB 4WVAA 4ZRQA 2EADA 2ZISB 2JJBA 2H6GB 4D4DA 4XUVA 4ZH1A 2BB6A 2WINB 3PZ3B 3EZ8A 2BBCA 5KKBA 1O5MB 3ANKA 4KKJA 3OXUA 4LNBB 2V8JA 4DOEA 1QSJA 4AYOA 3H2WA 4WVCA 1JCSB 1KWFA 3S4AA 5GW7A 3WIQA 3PZ4B 1SA5B 2V8KA 4GTQB 3OEDA 3M77A 1GXNA 3GZKA 3HXFB 3QG0A 2V3NA 4FUSA 1RQ5A 2JF4A 3E33B 2WY8A 1FO3A 3HXBB 2XFGA 4GTTB 2B39A 1N4PB 3D5RA 1TF4A 3E32B 2AFAA 2DRQA 1H54A 1LF9A 3EQAA 4V1RA 1W6JA 3RX8A 3VXDA 1AYXA 5FO8B 3X17A 3HXDB 3QRYA 4KTPA 3GT5A 4MBGB 1V7XA 1N94B 3PYBA 3M76A 1V7WA 3W7SA 3PYAA 1F9OA 2GH4A 1R76A 1KS8A 3Q7AB 3C72B 1K72A 4V1SA 1D8DB 3DSVB 3M7LA 1SA4B 4L6XA 1QBQB 2Z07A 3VW5A 3SAEA 3DSWB 1O6RA 1H3BA 2EACA 1H37A 1LTXB 1UT9A 1O6HA 1GXOA 1MZCB 1X9DA 1NI1B 3DSTB 3E37B 1GAHA 1XW2A 1IA6A 3DRAB 5FO7B 1TN7B 3M78A 2GZ6A 4BOKA 1D8EB 2V8IA 1SQCA 2PMVA 5GZKA 3P5RA 1N95B 3K11A 4FXGB 5DGRA 4QT9A 1UMPA 4KKIA 4BOJA 2A73B 1WU5A 2WYNA 1LD7B 1UG9A 1NL4B 5CA3A 3Q7FB 1GAIA 2AHGA 2WY7A 3M75A 3EU8A 2XWJB 4EL8A 2FV1A 1W6KA 3PZ1B 4GTVB 2RI9A 1H3AA 1CLCA 4ZG8A 3RX7A 1F9DA 2I07B 3S4DA 1FP3A 2EAEA 4GTOB 1LF6A 2NOJA 3M73A 1KZOB 1FO2A 1H12A 1H39A 1HCUA 1GSZA 2F0YB 4GL3A 4D4AA 1G6IA 1V5CA 5CD2A 3TF4A 1HZFA 2H6IB 3M71A 3SFXB 1N4QB 2RI8A 5DGQA 4TXTA 3S4CA 4GTMB 2D5JA 4ZH5A 5FO9B 5JPMB 1O6QA 4LNVA 3ACTA 3WKHA 3E34B 1VD5A 3KSLB 3W7WA 5GY3A 3PMMA 3ACSA 3RSYA 1FMIA 3A3VA 3HXEB 3QFZA 1JCQB 4DODA 1H3CA 4CJ0A 1DL2A 1KREA 2DRRA 3ANIA 1X81B 2GOXA 3GLYA 1KSDA 1G87A 1O1TB 3QSPA 1DCEB 3DSXB 4ONTA 3D5SA 1V7VA 3SDVA 2R2LB 4GTSB 2JG0A 5FOBB 3S9VA 3W7TA 4CE7A 4ZRPA 3W5NA 2AHFA 1G9JA 4EHMB 1QQFA 1TNUB 4LNGB 3WKFA 1S64B 4D94A 3WC3A 3AFJA 4WVBA 2H6HB 1WU6A 2IEJB 3M74A 1KSCA 3SDRA 4Z4LA 3W5MA 1G9GA 2BEDB 2ZZRA 4LIXA 1GLMA 1FPPB 1AGMA 2ZIRB 2CQTA 3W7XA 1IS9A 1C3DA 3KQ4A 2CQSA 2G0DA 1N4RB 2VN4A 3KSQB 4AYPA 3E6UA 3Q75B 1IA7A 3WKGA 3ON6A 3QXQA 2D8LA 3P5PA 3QWTA 3QXFA 4FXKB 3H3KA 5JPNB 3EU5B 1LD8B 1GHQA 3DSUB 1WU4A 2A8ZA 3EUVB 4J5TA 3P2CA 1TNBB 2FUZA 3E73A 4D4CA 2PN5A 2FBAA 4TF4A 3CU7A 3H7LA 3M7BA 3QDEA 2VN7A 3HXCB 4YCRA 3SDUA 3SQCA 3RENA 4KTRA 1O1RB 1TNZB 4AYRA 2RGKA 1ULVA 4CJ1A 5E2JA 2G02A 2BB5A 2FV0A 3DSSB 1TNOB 1V5DA 4GTRB 1S63B 1H14A 3SDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5S A;  1O6H A;  1GXO A;  1H37 A;  1H35 A;  1MZC B;  1NI1 B;  1TN6 B;  1O1S B;  3PZ2 B;  2R2L B;  3DST B;  4ZRQ A;  2V3P A;  3E37 B;  4GTS B;  3DRA B;  5FOB B;  3KLS A;  5FO7 B;  1TN7 B;  4BOK A;  4ZRP A;  1D8E B;  2ZIS B;  4YDE B;  2V8I A;  1N9A B;  2H6G B;  4D4D A;  1SQC A;  1FT2 B;  2PMV A;  4ZH1 A;  4EHM B;  2BB6 A;  1QQF A;  1TNU B;  2WIN B;  1N95 B;  4LNG B;  4M76 A;  4FXG B;  3PZ3 B;  2BBC A;  1S64 B;  1UMP A;  4KKI A;  1O5M B;  4KKJ A;  4BOJ A;  4D94 A;  3OXU A;  1JCR B;  2A73 B;  4LNB B;  2V8J A;  2H6H B;  1GXM A;  1QSJ A;  1LD7 B;  5AGD A;  1JCS B;  1NL4 B;  3G6J B;  2IEJ B;  4D4B A;  4ONT A;  2XWB B;  3PZ4 B;  1TN8 B;  2BED B;  1SA5 B;  3Q7F B;  2V8K A;  4GTQ B;  1FPP B;  3OED A;  4GTP B;  1FT1 B;  2ZIR B;  1GXN A;  2WY7 A;  3HXF B;  3KQ4 A;  1C3D A;  2XWJ B;  1W6K A;  2V3N A;  3PZ1 B;  4GTV B;  3E33 B;  2G0D A;  2WY8 A;  1H3A A;  1N4R B;  3HXB B;  3KSQ B;  2I07 B;  3Q75 B;  4YDO B;  4GTO B;  4GTT B;  2NOJ A;  1KZO B;  2B39 A;  1N4P B;  4FXK B;  1H39 A;  3D5R A;  5JPN B;  3EU5 B;  1LD8 B;  3E30 B;  3E32 B;  1GHQ A;  3DSU B;  1GSZ A;  2F0Y B;  4D4A A;  3DPY B;  3EUV B;  4MU9 A;  2XQW A;  1W6J A;  4V1R A;  5FO8 B;  1HZF A;  2H6I B;  3SFX B;  1N4Q B;  1TNB B;  3HXD B;  4GTM B;  5FO9 B;  1KZP B;  4D4C A;  2H6F B;  2PN5 A;  5JPM B;  1O6Q A;  1N4S B;  4MBG B;  1N94 B;  4LNV A;  1TNY B;  3CU7 A;  3Q78 B;  3E34 B;  1O79 A;  3KSL B;  1R76 A;  3K7X A;  3SQC A;  2WII B;  3HXC B;  3Q7A B;  3HXE B;  3Q79 B;  3C72 B;  1JCQ B;  1H3C A;  1O1R B;  4L9P B;  4V1S A;  1D8D B;  1TNZ B;  1H36 A;  3DSV B;  4C1S A;  2G02 A;  3RJ3 A;  1SA4 B;  1QBQ B;  1X81 B;  2GOX A;  2BB5 A;  3DSW B;  2SQC A;  1TNO B;  3DSS B;  1O6R A;  1H3B A;  1S63 B;  3Q73 B;  1O1T B;  4GTR B;  3SFY B;  1LTX B;  1DCE B;  3DSX B; 
#chains in the Genus database with same CATH topology
 3T33 A;  5ILI A;  1H35 A;  3WIW A;  1L2A A;  2DRO A;  2NVP A;  1TN6 B;  4WU0 A;  3PZ2 B;  1KFG A;  2V3P A;  5EAT A;  3QT3 A;  3KLS A;  5IM1 A;  1X1I A;  1KRF A;  1N21 A;  4YDE B;  1N9A B;  1FT2 B;  1L1Y A;  4M76 A;  5M7I A;  3G4F A;  4OZW A;  1HM3 A;  3QT9 A;  1OJO A;  1JCR B;  1NXC A;  1DOG A;  1GXM A;  1FAE A;  3W7U A;  5AGD A;  3RX5 A;  5IK9 A;  5CZL A;  3G6J B;  2FUT A;  4D4B A;  3M7E A;  5IL8 A;  2XWB B;  1TN8 B;  2X03 A;  1H13 A;  4Q2B A;  4GTP B;  1FT1 B;  5M7Y A;  1XWT A;  1X1H A;  3D3I A;  3S4B A;  1GA2 A;  3QPF A;  1NC5 A;  1FBO A;  3WKI A;  3E7J A;  4YDO B;  5JMD A;  1W3Y A;  2B4F A;  2P0V A;  3E30 B;  3M7C A;  2DRS A;  1N24 A;  3DPY B;  1FCE A;  3CIH A;  4MU9 A;  2XQW A;  2EAB A;  3M72 A;  1CEM A;  3RRS A;  3WUX A;  4AYQ A;  1WZZ A;  4Z4J A;  1KZP B;  2J5C A;  2H6F B;  3M02 A;  1N4S B;  1TNY B;  4JJJ A;  2F6D A;  3Q78 B;  1O79 A;  4L0G A;  1HV6 A;  3QFY A;  3K7X A;  1KKT A;  3ANJ A;  2WII B;  3Q79 B;  4Q88 A;  3SDQ A;  4L9P B;  1OJM A;  1H36 A;  5IK0 A;  3WIR A;  4C1S A;  1I8Q A;  2OKX A;  3RJ3 A;  1XWQ A;  2SQC A;  2QNO A;  1JS4 A;  3Q73 B;  3SFY B;  2YIK A;  1FBW A;  5MEH A;  2ZBL A;  1RWG A;  1O1S B;  4WVA A;  4ZRQ A;  1HX9 A;  2EAD A;  1RWA A;  1N7O A;  2ZIS B;  5DHK A;  2JJB A;  2H6G B;  4D4D A;  4XUV A;  4ZH1 A;  2BB6 A;  2WIN B;  3PZ3 B;  3EZ8 A;  2BBC A;  5KKB A;  1O5M B;  3ANK A;  1HMU A;  4KKJ A;  3OXU A;  4LNB B;  2V8J A;  2BRP A;  4DOE A;  1QSJ A;  4AYO A;  1J0N A;  4OJZ A;  4E1Y A;  3H2W A;  4NEI A;  4WVC A;  1JCS B;  1KWF A;  3S4A A;  5GW7 A;  3WIQ A;  3PZ4 B;  1SA5 B;  2V8K A;  4GTQ B;  3OED A;  3M77 A;  4FJQ A;  1GXN A;  3GZK A;  3HXF B;  3QG0 A;  1LXM A;  2V3N A;  1RQ5 A;  4FUS A;  5EAS A;  2JF4 A;  3E33 B;  2WY8 A;  1FO3 A;  3HXB B;  2BRV X;  4OK2 A;  2XFG A;  4GTT B;  2B39 A;  1N4P B;  3D5R A;  1TF4 A;  3E32 B;  2AFA A;  2DRQ A;  1RW9 A;  1H54 A;  1LF9 A;  3EQA A;  4V1R A;  1W6J A;  3RX8 A;  3VXD A;  1AYX A;  5FO8 B;  3X17 A;  2FUQ A;  3HXD B;  3QRY A;  1F1S A;  4KTP A;  3GT5 A;  4MBG B;  1V7X A;  1N94 B;  3PYB A;  3M76 A;  1V7W A;  2ONH A;  3W7S A;  3PYA A;  1F9O A;  2GH4 A;  1R76 A;  1KS8 A;  3Q7A B;  3C72 B;  1K72 A;  4OK4 A;  4V1S A;  1D8D B;  3DSV B;  1HXA A;  3M7L A;  1SA4 B;  4L6X A;  4OZV A;  1QBQ B;  2Z07 A;  3VW5 A;  3VSN A;  3VSM A;  3SAE A;  3DSW B;  2E22 A;  1O6R A;  1H3B A;  2EAC A;  1LTX B;  1H37 A;  1UT9 A;  1O6H A;  1GXO A;  5ILK A;  1F9G A;  1MZC B;  1X9D A;  1NI1 B;  3DST B;  3E37 B;  1GAH A;  1XW2 A;  1IA6 A;  3DRA B;  5FO7 B;  1TN7 B;  1CB8 A;  3M78 A;  2GZ6 A;  4BOK A;  1D8E B;  2V8I A;  5IL3 A;  1SQC A;  2WCO A;  2PMV A;  5GZK A;  3P5R A;  1OJP A;  1N95 B;  3K11 A;  4FXG B;  5DGR A;  4QT9 A;  1UMP A;  4KKI A;  3N0F A;  4BOJ A;  1HM2 A;  1N7Q A;  2A73 B;  1WU5 A;  2WYN A;  1LD7 B;  4MMI A;  1N1B A;  1UG9 A;  1NL4 B;  1RWH A;  5IK6 A;  5CA3 A;  1HMW A;  1OJN A;  1N22 A;  1J0M A;  3Q7F B;  1HN0 A;  1GAI A;  2AHG A;  4GAX A;  2WY7 A;  3M75 A;  3EU8 A;  1H14 A;  2XWJ B;  4EL8 A;  2FV1 A;  1W6K A;  3PZ1 B;  5JMF A;  4GTV B;  2RI9 A;  1H3A A;  1CLC A;  4DI5 A;  4ZG8 A;  3RX7 A;  1F9D A;  2I07 B;  5ILJ A;  1C82 A;  3S4D A;  1FP3 A;  2EAE A;  4GTO B;  1LF6 A;  1HXG A;  1X1J A;  2NOJ A;  3M73 A;  1KZO B;  1FO2 A;  1H12 A;  1H39 A;  4FNV A;  3N0G A;  5ILH A;  1HCU A;  1GSZ A;  2F0Y B;  4GL3 A;  4D4A A;  1G6I A;  1V5C A;  5CD2 A;  5IKA A;  3TF4 A;  1RWC A;  1HZF A;  2H6I B;  3M71 A;  3SFX B;  1N4Q B;  2RI8 A;  5DGQ A;  1HXC A;  4TXT A;  3S4C A;  4GTM B;  2D5J A;  4ZH5 A;  5FO9 B;  5JPM B;  1O6Q A;  4LNV A;  3ACT A;  3WKH A;  3E34 B;  1VD5 A;  3KSL B;  3W7W A;  1N7R A;  5GY3 A;  3PMM A;  3ACS A;  3RSY A;  1FMI A;  3A3V A;  3HXE B;  3QFZ A;  1JCQ B;  4DOD A;  1H3C A;  4CJ0 A;  5IKH A;  1DL2 A;  1KRE A;  1N7N A;  2DRR A;  1LOH A;  3ANI A;  1X81 B;  2GOX A;  5DHI A;  3E80 A;  3GLY A;  1KSD A;  5C05 A;  1G87 A;  1O1T B;  3QSP A;  1DCE B;  3DSX B;  4ONT A;  3D5S A;  1V7V A;  3SDV A;  2R2L B;  4F13 A;  4GTS B;  2JG0 A;  5FOB B;  3S9V A;  3W7T A;  4CE7 A;  4ZRP A;  3AFL A;  3M01 A;  3W5N A;  2AHF A;  1G9J A;  3A0O A;  4EHM B;  1QQF A;  1TNU B;  4LNG B;  3WKF A;  1S64 B;  4D94 A;  3LZ9 A;  3WC3 A;  3AFJ A;  1N7P A;  4WVB A;  2H6H B;  5ILD A;  1WU6 A;  2WDA A;  2IEJ B;  3M74 A;  1KSC A;  3SDR A;  4Z4L A;  3W5M A;  1G9G A;  2BED B;  2ZZR A;  4LIX A;  1GLM A;  1FPP B;  1AGM A;  2ZIR B;  2CQT A;  3W7X A;  5ILY A;  1IS9 A;  1C3D A;  3KQ4 A;  2CQS A;  2G0D A;  1QAZ A;  1LXK A;  1N4R B;  2E24 A;  2VN4 A;  4F10 A;  3KSQ B;  4AYP A;  3E6U A;  3Q75 B;  1IA7 A;  3WKG A;  3ON6 A;  3QXQ A;  2D8L A;  3P5P A;  3QWT A;  3QXF A;  4FXK B;  3H3K A;  5EAU A;  5JPN B;  1RWF A;  3EU5 B;  1LD8 B;  1GHQ A;  3DSU B;  1WU4 A;  2A8Z A;  1N1Z A;  3EUV B;  4J5T A;  1EGU A;  3P2C A;  1N23 A;  1TNB B;  2FUZ A;  3E73 A;  4D4C A;  2PN5 A;  3NNB A;  2FBA A;  4TF4 A;  3CU7 A;  3H7L A;  5ILZ A;  3M7B A;  4MMH A;  3QDE A;  2VN7 A;  3HXC B;  4YCR A;  3SDU A;  3M00 A;  3SQC A;  3G4D A;  3REN A;  4KTR A;  1O1R B;  1TNZ B;  3NFV A;  4AYR A;  2BRW A;  2RGK A;  1ULV A;  4CJ1 A;  5E2J A;  2G02 A;  2Q1F A;  2BB5 A;  2FV0 A;  3DSS B;  1TNO B;  1V5D A;  4GTR B;  1S63 B;  1N20 A;  3SDT A;  4RNQ A;  2ONG A; 
#chains in the Genus database with same CATH homology
 3T33 A;  1H35 A;  3WIW A;  1L2A A;  2DRO A;  2NVP A;  1TN6 B;  4WU0 A;  3PZ2 B;  1KFG A;  2V3P A;  3QT3 A;  3KLS A;  1KRF A;  4YDE B;  1N9A B;  1FT2 B;  1L1Y A;  4M76 A;  5M7I A;  3QT9 A;  1JCR B;  1NXC A;  1DOG A;  1GXM A;  1FAE A;  3W7U A;  5AGD A;  3RX5 A;  5CZL A;  3G6J B;  4D4B A;  3M7E A;  2XWB B;  1TN8 B;  1H13 A;  4Q2B A;  4GTP B;  1FT1 B;  5M7Y A;  1XWT A;  3D3I A;  3S4B A;  3QPF A;  1GA2 A;  1NC5 A;  1FBO A;  3WKI A;  4YDO B;  2B4F A;  2P0V A;  3E30 B;  3M7C A;  2DRS A;  3DPY B;  1FCE A;  3CIH A;  4MU9 A;  2XQW A;  2EAB A;  3M72 A;  1CEM A;  3RRS A;  3WUX A;  4AYQ A;  1WZZ A;  4Z4J A;  1KZP B;  2H6F B;  1N4S B;  1TNY B;  4JJJ A;  2F6D A;  3Q78 B;  1O79 A;  4L0G A;  3QFY A;  3K7X A;  1KKT A;  3ANJ A;  2WII B;  3Q79 B;  4Q88 A;  3SDQ A;  4L9P B;  1H36 A;  3WIR A;  4C1S A;  2OKX A;  3RJ3 A;  1XWQ A;  2SQC A;  2QNO A;  1JS4 A;  3Q73 B;  3SFY B;  2YIK A;  1FBW A;  5MEH A;  2ZBL A;  1O1S B;  4WVA A;  4ZRQ A;  2EAD A;  2ZIS B;  2JJB A;  2H6G B;  4D4D A;  4XUV A;  4ZH1 A;  2BB6 A;  2WIN B;  3PZ3 B;  3EZ8 A;  2BBC A;  5KKB A;  1O5M B;  3ANK A;  4KKJ A;  3OXU A;  4LNB B;  2V8J A;  4DOE A;  1QSJ A;  4AYO A;  3H2W A;  4WVC A;  1JCS B;  1KWF A;  3S4A A;  5GW7 A;  3WIQ A;  3PZ4 B;  1SA5 B;  2V8K A;  4GTQ B;  3OED A;  3M77 A;  1GXN A;  3GZK A;  3HXF B;  3QG0 A;  2V3N A;  4FUS A;  1RQ5 A;  2JF4 A;  3E33 B;  2WY8 A;  1FO3 A;  3HXB B;  2XFG A;  4GTT B;  2B39 A;  1N4P B;  3D5R A;  1TF4 A;  3E32 B;  2AFA A;  2DRQ A;  1H54 A;  1LF9 A;  3EQA A;  4V1R A;  1W6J A;  3RX8 A;  3VXD A;  1AYX A;  5FO8 B;  3X17 A;  3HXD B;  3QRY A;  4KTP A;  3GT5 A;  4MBG B;  1V7X A;  1N94 B;  3PYB A;  3M76 A;  1V7W A;  3W7S A;  3PYA A;  1F9O A;  2GH4 A;  1R76 A;  1KS8 A;  3Q7A B;  3C72 B;  1K72 A;  4V1S A;  1D8D B;  3DSV B;  3M7L A;  1SA4 B;  4L6X A;  1QBQ B;  2Z07 A;  3VW5 A;  3SAE A;  3DSW B;  1O6R A;  1H3B A;  2EAC A;  1H37 A;  1LTX B;  1UT9 A;  1O6H A;  1GXO A;  1MZC B;  1X9D A;  1NI1 B;  3DST B;  3E37 B;  1GAH A;  1XW2 A;  1IA6 A;  3DRA B;  5FO7 B;  1TN7 B;  3M78 A;  2GZ6 A;  4BOK A;  1D8E B;  2V8I A;  1SQC A;  2PMV A;  5GZK A;  3P5R A;  1N95 B;  3K11 A;  4FXG B;  5DGR A;  4QT9 A;  1UMP A;  4KKI A;  4BOJ A;  2A73 B;  1WU5 A;  2WYN A;  1LD7 B;  1UG9 A;  1NL4 B;  5CA3 A;  3Q7F B;  1GAI A;  2AHG A;  2WY7 A;  3M75 A;  3EU8 A;  2XWJ B;  4EL8 A;  2FV1 A;  1W6K A;  3PZ1 B;  4GTV B;  2RI9 A;  1H3A A;  1CLC A;  4ZG8 A;  3RX7 A;  1F9D A;  2I07 B;  3S4D A;  1FP3 A;  2EAE A;  4GTO B;  1LF6 A;  2NOJ A;  3M73 A;  1KZO B;  1FO2 A;  1H12 A;  1H39 A;  1HCU A;  1GSZ A;  2F0Y B;  4GL3 A;  4D4A A;  1G6I A;  1V5C A;  5CD2 A;  3TF4 A;  1HZF A;  2H6I B;  3M71 A;  3SFX B;  1N4Q B;  2RI8 A;  5DGQ A;  4TXT A;  3S4C A;  4GTM B;  2D5J A;  4ZH5 A;  5FO9 B;  5JPM B;  1O6Q A;  4LNV A;  3ACT A;  3WKH A;  3E34 B;  1VD5 A;  3KSL B;  3W7W A;  5GY3 A;  3PMM A;  3ACS A;  3RSY A;  1FMI A;  3A3V A;  3HXE B;  3QFZ A;  1JCQ B;  4DOD A;  1H3C A;  4CJ0 A;  1DL2 A;  1KRE A;  2DRR A;  3ANI A;  1X81 B;  2GOX A;  3GLY A;  1KSD A;  1G87 A;  1O1T B;  3QSP A;  1DCE B;  3DSX B;  4ONT A;  3D5S A;  1V7V A;  3SDV A;  2R2L B;  4GTS B;  2JG0 A;  5FOB B;  3S9V A;  3W7T A;  4CE7 A;  4ZRP A;  3W5N A;  2AHF A;  1G9J A;  4EHM B;  1QQF A;  1TNU B;  4LNG B;  3WKF A;  1S64 B;  4D94 A;  3WC3 A;  3AFJ A;  4WVB A;  2H6H B;  1WU6 A;  2IEJ B;  3M74 A;  1KSC A;  3SDR A;  4Z4L A;  3W5M A;  1G9G A;  2BED B;  2ZZR A;  4LIX A;  1GLM A;  1FPP B;  1AGM A;  2ZIR B;  2CQT A;  3W7X A;  1IS9 A;  1C3D A;  3KQ4 A;  2CQS A;  2G0D A;  1N4R B;  2VN4 A;  3KSQ B;  4AYP A;  3E6U A;  3Q75 B;  1IA7 A;  3WKG A;  3ON6 A;  3QXQ A;  2D8L A;  3P5P A;  3QWT A;  3QXF A;  4FXK B;  3H3K A;  5JPN B;  3EU5 B;  1LD8 B;  1GHQ A;  3DSU B;  1WU4 A;  2A8Z A;  3EUV B;  4J5T A;  3P2C A;  1TNB B;  2FUZ A;  3E73 A;  4D4C A;  2PN5 A;  2FBA A;  4TF4 A;  3CU7 A;  3H7L A;  3M7B A;  3QDE A;  2VN7 A;  3HXC B;  4YCR A;  3SDU A;  3SQC A;  3REN A;  4KTR A;  1O1R B;  1TNZ B;  4AYR A;  2RGK A;  1ULV A;  4CJ1 A;  5E2J A;  2G02 A;  2BB5 A;  2FV0 A;  3DSS B;  1TNO B;  1V5D A;  4GTR B;  1S63 B;  1H14 A;  3SDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...