4ZH1A

Complement factor h in complex with the gm1 glycan
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
293
structure length
293
Chain Sequence
RDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C3
publication title Complement Factor H and Simian Virus 40 bind the GM1 ganglioside in distinct conformations.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4zh1A00
1H39A 2R2LB 1GXOA 3HXCB 3DSUB 1KZOB 1N4RB 5JPMB 5FO8B 1HZFA 1N4QB 1S64B 3Q78B 1LTXB 1O5MB 5JPNB 4BOJA 1TNYB 1H36A 2WY7A 1W6JA 2XWJB 1N4SB 2WIIB 4ZRPA 1C3DA 4GTQB 4MU9A 1JCRB 3EUVB 4V1SA 2IEJB 3HXFB 1O6RA 1N9AB 3OEDA 3C72B 1O1RB 3K7XA 3E34B 4KKIA 3DSTB 4GTPB 1GHQA 4MBGB 3PZ4B 2SQCA 4D4AA 1QQFA 1S63B 1O6QA 1UMPA 3Q79B 2PMVA 3DSWB 1MZCB 4YDOB 2V8IA 1SQCA 4LNVA 2H6FB 4M76A 3Q7FB 2V8JA 1LD8B 2V8KA 4LNGB 3HXBB 4D4CA 3E37B 1QBQB 1R76A 3KQ4A 3G6JB 1NI1B 3E30B 3KSQB 5FOBB 2BBCA 1TNBB 2F0YB 3PZ2B 1O1TB 1H37A 1DCEB 3KSLB 3D5SA 4GTVB 4YDEB 3OXUA 1GXNA 4EHMB 1TN7B 3SFYB 2V3PA 4ZRQA 4BOKA 2BEDB 4D4BA 1FT2B 1W6KA 5FO7B 2PN5A 2B39A 3D5RA 2BB6A 1NL4B 2GOXA 2NOJA 3SQCA 3KLSA 3DSXB 4GTTB 3DRAB 1N95B 2BB5A 1N4PB 3DSSB 1GXMA 4ZH1A 3Q7AB 1JCQB 5FO9B 3PZ1B 3SFXB 1KZPB 1GSZA 2H6HB 1FT1B 4C1SA 4D4DA 1O1SB 2WINB 1TNUB 1H3CA 2WY8A 1TN6B 2H6IB 3DPYB 2ZIRB 2H6GB 2V3NA 1JCSB 3E32B 3E33B 4GTSB 2ZISB 3PZ3B 3HXDB 4ONTA 3CU7A 1LD7B 1H3BA 3Q73B 1D8EB 3RJ3A 1N94B 2XQWA 1O79A 2G0DA 1SA5B 1O6HA 3Q75B 4GTRB 2I07B 4L9PB 2XWBB 1FPPB 1QSJA 4V1RA 4GTMB 3HXEB 1X81B 1TN8B 2A73B 3DSVB 1TNOB 4GTOB 4FXKB 3EU5B 1D8DB 4KKJA 4D94A 1SA4B 5AGDA 1H3AA 4LNBB 1TNZB 4FXGB 2G02A 1H35A
chains in the Genus database with same CATH superfamily
1X1IA 3G4FA 2Z07A 2R2LB 1FO2A 4NEIA 1GXOA 3HXCB 2EABA 5JPMB 5FO8B 2CQSA 1KSCA 1LTXB 4L0GA 1H36A 1FCEA 3QFZA 1RW9A 2IEJB 3QXQA 1O6RA 4DODA 1N1BA 2GH4A 3S4BA 1O1RB 5EATA 2FBAA 4KKIA 1GHQA 3QG0A 3H3KA 1O6QA 2PMVA 4YDOB 2YIKA 3VSNA 2BRVX 2H6FB 1FP3A 3N0GA 3E37B 4WVBA 3G6JB 1K72A 3SAEA 1N7RA 2CQTA 1TNBB 3QWTA 5ILZA 3NNBA 3D5SA 4LIXA 1GXNA 4EHMB 1N7QA 1WU4A 3E7JA 3M76A 3N0FA 3QT3A 2BRPA 2B39A 2BB6A 1NL4B 2GOXA 4J5TA 1H14A 1TF4A 5ILKA 4AYOA 3DSXB 3ACSA 3QXFA 3DSSB 1VD5A 3PZ1B 2FV1A 1NXCA 2E24A 2JF4A 3M7LA 1W3YA 5ILYA 1O1SB 2WINB 5MEHA 3RX8A 1LF9A 2H6IB 1LF6A 1HMUA 2H6GB 3PYBA 2EAEA 3GZKA 1D8EB 1IS9A 1HM2A 2WDAA 3PYAA 4E1YA 2XQWA 4KTRA 1FPPB 4V1RA 2A73B 1TNOB 3QRYA 4FXKB 4KKJA 2WYNA 3WUXA 5ILIA 1G9GA 4FXGB 3H7LA 1C82A 1N7PA 3QT9A 4ZG8A 1GAIA 4F13A 5DGQA 3WC3A 1LXMA 2B4FA 3GLYA 1CB8A 4TF4A 3M75A 3LZ9A 5IKHA 2F6DA 3E80A 2EADA 5ILDA 2GZ6A 2WY7A 3GT5A 2XWJB 3X17A 4ZRPA 4GTQB 3HXFB 1F9DA 3C72B 2AHFA 3K7XA 4WVCA 4GTPB 3PZ4B 1HXGA 2SQCA 4XUVA 1S63B 1UMPA 3Q79B 2X03A 1MZCB 2ONGA 2VN7A 4MMIA 1SQCA 5IK0A 2FV0A 5ILJA 5ILHA 3Q7FB 2E22A 2V8KA 4WU0A 1OJOA 4OK2A 1UG9A 2RI8A 1R76A 3KQ4A 4MMHA 3T33A 4YCRA 5FOBB 2F0YB 1H13A 1FBOA 5M7IA 1DCEB 3KSLB 2NVPA 4QT9A 3W7SA 2RI9A 3SFYB 3ANIA 1LXKA 3M02A 3S9VA 1HXCA 4AYPA 3P2CA 4DOEA 1HV6A 4Q2BA 3D5RA 5IL8A 1EGUA 2NOJA 5DHIA 3SQCA 3KLSA 3QPFA 3W7XA 3DRAB 1H54A 2RGKA 4ZH1A 1JS4A 5FO9B 1F9GA 1V7VA 3M73A 5EASA 1KZPB 4WVAA 1FT1B 3CIHA 4Q88A 3RSYA 1TNUB 1H3CA 4F10A 1FO3A 2VN4A 5JMFA 2J5CA 3DPYB 4CE7A 2V3NA 1JCSB 2D5JA 4CJ1A 3VXDA 5CZLA 3P5PA 3W5NA 1LD7B 5E2JA 1KWFA 4GL3A 3QDEA 2G0DA 3Q75B 3PMMA 2I07B 1X81B 1TN8B 3DSVB 3EU5B 5GZKA 5CD2A 1SA4B 1N22A 5AGDA 5GY3A 1TNZB 1HMWA 2G02A 4GTMB 3M7CA 1HXAA 3M71A 3SDVA 1XW2A 3W7UA 1HZFA 1N24A 1GLMA 4GAXA 1HCUA 1S64B 1AYXA 4FJQA 1O5MB 5GW7A 5JPNB 3D3IA 1W6JA 5IM1A 1KSDA 1N4SB 1NC5A 3EQAA 4V1SA 1N9AB 1FAEA 1N7OA 5IL3A 4OZVA 1IA7A 3E6UA 1WU5A 4MBGB 3DSTB 3ANKA 2ONHA 1H12A 4FUSA 1N23A 3RENA 3WIWA 1OJPA 1RWCA 2DRQA 2BRWA 3VSMA 1HM3A 4D4CA 1GAHA 1G9JA 1QBQB 1NI1B 3E30B 1V7XA 3WIRA 2BBCA 2XFGA 3PZ2B 1F9OA 4TXTA 3NFVA 3S4DA 1RWFA 3OXUA 4YDEB 5JMDA 1V5DA 2D8LA 2DROA 2V3PA 1KREA 4D4BA 1FT2B 1W6KA 3G4DA 3M7EA 5C05A 2PN5A 1KKTA 3W7TA 1KRFA 1KFGA 3SDTA 1X1HA 4GTTB 4OZWA 3RRSA 4OJZA 1N95B 2FUQA 1N4PB 1GXMA 3QSPA 1JCQB 5DGRA 2WCOA 3SFXB 1CEMA 2H6HB 1GSZA 3TF4A 2ZZRA 4RNQA 4C1SA 2FUTA 1G6IA 2WY8A 4KTPA 1TN6B 1XWTA 5M7YA 2ZIRB 3EZ8A 1HX9A 3E32B 3A0OA 1KS8A 3E73A 1G87A 1GA2A 1J0NA 4ONTA 3M78A 3CU7A 4Z4JA 5IKAA 1QAZA 1O6HA 4GTRB 4L9PB 1V7WA 3ACTA 3HXEB 1WZZA 3M77A 1N20A 4GTOB 4CJ0A 1D8DB 3S4CA 1RWAA 2OKXA 1I8QA 1H35A 1H39A 3AFJA 1KZOB 1N4RB 1DL2A 3DSUB 3M7BA 1N4QB 3Q78B 3M72A 4BOJA 1TNYB 3RX7A 4EL8A 3SDRA 2WIIB 3ON6A 1C3DA 1FBWA 1OJNA 4MU9A 1JCRB 3EUVB 3OEDA 1DOGA 1UT9A 2DRSA 3K11A 3E34B 1RQ5A 4JJJA 4D4AA 1QQFA 1J0MA 3RX5A 3DSWB 3ANJA 2V8IA 4LNVA 3A3VA 4M76A 2V8JA 1LD8B 4LNGB 3HXBB 1WU6A 4AYRA 3KSQB 1O1TB 1H37A 1IA6A 4AYQA 4GTVB 2AHGA 1TN7B 2EACA 3VW5A 5EAUA 4ZRQA 4BOKA 1AGMA 2BEDB 5FO7B 3WKIA 4L6XA 5IK6A 3M00A 2FUZA 1N7NA 2A8ZA 1N1ZA 2P0VA 1HN0A 4DI5A 1OJMA 3QFYA 1CLCA 2QNOA 4ZH5A 3SDQA 2BB5A 1X9DA 5DHKA 1RWGA 3Q7AB 2Q1FA 3WKFA 3M01A 3EU8A 1X1JA 3W7WA 4D4DA 5KKBA 1L1YA 4Z4LA 1N21A 3W5MA 1XWQA 1F1SA 4OK4A 1V5CA 3M74A 3WKGA 3E33B 4GTSB 3S4AA 2ZISB 3PZ3B 3HXDB 4FNVA 3SDUA 1H3BA 3H2WA 3Q73B 3RJ3A 5CA3A 3P5RA 2JG0A 1N94B 3WKHA 5IK9A 1O79A 1L2AA 2DRRA 1SA5B 1LOHA 1ULVA 2XWBB 1QSJA 2JJBA 3AFLA 2AFAA 2ZBLA 3WIQA 1RWHA 4D94A 1H3AA 4LNBB 1FMIA
chains in the Genus database with same CATH topology
2Z07A 2R2LB 1FO2A 1GXOA 3HXCB 2EABA 5JPMB 5FO8B 2CQSA 1KSCA 1LTXB 4L0GA 1H36A 1FCEA 3QFZA 2IEJB 3QXQA 1O6RA 4DODA 2GH4A 3S4BA 1O1RB 2FBAA 4KKIA 1GHQA 3QG0A 3H3KA 1O6QA 2PMVA 4YDOB 2YIKA 2H6FB 1FP3A 3E37B 4WVBA 3G6JB 1K72A 3SAEA 2CQTA 1TNBB 3QWTA 3D5SA 4LIXA 1GXNA 4EHMB 1WU4A 3M76A 3QT3A 2B39A 2BB6A 1NL4B 2GOXA 4J5TA 1H14A 1TF4A 4AYOA 3DSXB 3ACSA 3QXFA 3DSSB 1VD5A 3PZ1B 2FV1A 1NXCA 2JF4A 3M7LA 1O1SB 2WINB 5MEHA 3RX8A 1LF9A 2H6IB 1LF6A 2H6GB 3PYBA 2EAEA 3GZKA 1D8EB 1IS9A 3PYAA 2XQWA 4KTRA 1FPPB 4V1RA 2A73B 1TNOB 3QRYA 4FXKB 4KKJA 2WYNA 3WUXA 1G9GA 4FXGB 3H7LA 3QT9A 4ZG8A 1GAIA 5DGQA 3WC3A 2B4FA 3GLYA 4TF4A 3M75A 2F6DA 2EADA 2GZ6A 2WY7A 3GT5A 2XWJB 3X17A 4ZRPA 4GTQB 3HXFB 1F9DA 3C72B 2AHFA 3K7XA 4WVCA 4GTPB 3PZ4B 2SQCA 4XUVA 1S63B 1UMPA 3Q79B 1MZCB 2VN7A 1SQCA 2FV0A 3Q7FB 2V8KA 4WU0A 1UG9A 2RI8A 1R76A 3KQ4A 3T33A 4YCRA 5FOBB 2F0YB 1H13A 1FBOA 5M7IA 1DCEB 3KSLB 2NVPA 4QT9A 3W7SA 2RI9A 3SFYB 3ANIA 3S9VA 4AYPA 3P2CA 4DOEA 4Q2BA 3D5RA 2NOJA 3SQCA 3KLSA 3QPFA 3W7XA 3DRAB 1H54A 2RGKA 4ZH1A 1JS4A 5FO9B 1V7VA 3M73A 1KZPB 4WVAA 1FT1B 3CIHA 4Q88A 3RSYA 1TNUB 1H3CA 1FO3A 2VN4A 3DPYB 4CE7A 2V3NA 1JCSB 2D5JA 4CJ1A 3VXDA 5CZLA 3P5PA 3W5NA 1LD7B 5E2JA 1KWFA 4GL3A 3QDEA 2G0DA 3Q75B 3PMMA 2I07B 1X81B 1TN8B 3DSVB 3EU5B 5GZKA 5CD2A 1SA4B 5AGDA 5GY3A 1TNZB 2G02A 4GTMB 3M7CA 3M71A 3SDVA 1XW2A 3W7UA 1HZFA 1GLMA 1HCUA 1S64B 1AYXA 1O5MB 5GW7A 5JPNB 3D3IA 1W6JA 1KSDA 1N4SB 1NC5A 3EQAA 4V1SA 1N9AB 1FAEA 1IA7A 3E6UA 1WU5A 4MBGB 3DSTB 3ANKA 1H12A 4FUSA 3RENA 3WIWA 2DRQA 4D4CA 1GAHA 1G9JA 1QBQB 1NI1B 3E30B 1V7XA 3WIRA 2BBCA 2XFGA 3PZ2B 1F9OA 4TXTA 3S4DA 4YDEB 3OXUA 1V5DA 2D8LA 2DROA 2V3PA 1KREA 4D4BA 1FT2B 1W6KA 3M7EA 2PN5A 1KKTA 3W7TA 1KRFA 1KFGA 3SDTA 4GTTB 3RRSA 1N95B 1N4PB 1GXMA 3QSPA 1JCQB 5DGRA 3SFXB 1CEMA 2H6HB 1GSZA 3TF4A 2ZZRA 4C1SA 1G6IA 2WY8A 4KTPA 1TN6B 1XWTA 5M7YA 2ZIRB 3EZ8A 3E32B 1KS8A 3E73A 1G87A 1GA2A 4ONTA 3M78A 3CU7A 4Z4JA 1O6HA 4GTRB 4L9PB 1V7WA 3ACTA 3HXEB 1WZZA 3M77A 4GTOB 4CJ0A 1D8DB 3S4CA 2OKXA 1H35A 1H39A 3AFJA 1KZOB 1N4RB 1DL2A 3DSUB 3M7BA 1N4QB 3Q78B 3M72A 4BOJA 1TNYB 3RX7A 4EL8A 3SDRA 2WIIB 3ON6A 1C3DA 1FBWA 4MU9A 1JCRB 3EUVB 3OEDA 1DOGA 1UT9A 2DRSA 3K11A 3E34B 1RQ5A 4JJJA 4D4AA 1QQFA 3RX5A 3DSWB 3ANJA 2V8IA 4LNVA 3A3VA 4M76A 2V8JA 1LD8B 4LNGB 3HXBB 1WU6A 4AYRA 3KSQB 1O1TB 1H37A 1IA6A 4AYQA 4GTVB 2AHGA 1TN7B 2EACA 3VW5A 4ZRQA 4BOKA 1AGMA 2BEDB 5FO7B 3WKIA 4L6XA 2FUZA 2A8ZA 2P0VA 3QFYA 1CLCA 2QNOA 4ZH5A 3SDQA 2BB5A 1X9DA 3Q7AB 3WKFA 3EU8A 3W7WA 4D4DA 5KKBA 1L1YA 4Z4LA 3W5MA 1XWQA 1V5CA 3M74A 3WKGA 3E33B 4GTSB 3S4AA 2ZISB 3PZ3B 3HXDB 3SDUA 1H3BA 3H2WA 3Q73B 3RJ3A 5CA3A 3P5RA 2JG0A 1N94B 3WKHA 1O79A 1L2AA 2DRRA 1SA5B 2XWBB 1ULVA 1QSJA 2JJBA 2AFAA 2ZBLA 3WIQA 4D94A 1H3AA 4LNBB 1FMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H39 A;  2R2L B;  1GXO A;  3HXC B;  3DSU B;  1KZO B;  1N4R B;  5JPM B;  5FO8 B;  1HZF A;  1N4Q B;  1S64 B;  3Q78 B;  1LTX B;  1O5M B;  5JPN B;  4BOJ A;  1TNY B;  1H36 A;  2WY7 A;  1W6J A;  2XWJ B;  1N4S B;  2WII B;  4ZRP A;  1C3D A;  4GTQ B;  4MU9 A;  1JCR B;  3EUV B;  4V1S A;  2IEJ B;  3HXF B;  1O6R A;  1N9A B;  3OED A;  3C72 B;  1O1R B;  3K7X A;  3E34 B;  4KKI A;  3DST B;  4GTP B;  1GHQ A;  4MBG B;  3PZ4 B;  2SQC A;  4D4A A;  1QQF A;  1S63 B;  1O6Q A;  1UMP A;  3Q79 B;  2PMV A;  3DSW B;  1MZC B;  4YDO B;  2V8I A;  1SQC A;  4LNV A;  2H6F B;  4M76 A;  3Q7F B;  2V8J A;  1LD8 B;  2V8K A;  4LNG B;  3HXB B;  4D4C A;  3E37 B;  1QBQ B;  1R76 A;  3KQ4 A;  3G6J B;  1NI1 B;  3E30 B;  3KSQ B;  5FOB B;  2BBC A;  1TNB B;  2F0Y B;  3PZ2 B;  1O1T B;  1H37 A;  1DCE B;  3KSL B;  3D5S A;  4GTV B;  4YDE B;  3OXU A;  1GXN A;  4EHM B;  1TN7 B;  3SFY B;  2V3P A;  4ZRQ A;  4BOK A;  2BED B;  4D4B A;  1FT2 B;  1W6K A;  5FO7 B;  2PN5 A;  2B39 A;  3D5R A;  2BB6 A;  1NL4 B;  2GOX A;  2NOJ A;  3SQC A;  3KLS A;  3DSX B;  4GTT B;  3DRA B;  1N95 B;  2BB5 A;  1N4P B;  3DSS B;  1GXM A;  4ZH1 A;  3Q7A B;  1JCQ B;  5FO9 B;  3PZ1 B;  3SFX B;  1KZP B;  1GSZ A;  2H6H B;  1FT1 B;  4C1S A;  4D4D A;  1O1S B;  2WIN B;  1TNU B;  1H3C A;  2WY8 A;  1TN6 B;  2H6I B;  3DPY B;  2ZIR B;  2H6G B;  2V3N A;  1JCS B;  3E32 B;  3E33 B;  4GTS B;  2ZIS B;  3PZ3 B;  3HXD B;  4ONT A;  3CU7 A;  1LD7 B;  1H3B A;  3Q73 B;  1D8E B;  3RJ3 A;  1N94 B;  2XQW A;  1O79 A;  2G0D A;  1SA5 B;  1O6H A;  3Q75 B;  4GTR B;  2I07 B;  4L9P B;  2XWB B;  1FPP B;  1QSJ A;  4V1R A;  4GTM B;  3HXE B;  1X81 B;  1TN8 B;  2A73 B;  3DSV B;  1TNO B;  4GTO B;  4FXK B;  3EU5 B;  1D8D B;  4KKJ A;  4D94 A;  1SA4 B;  5AGD A;  1H3A A;  4LNB B;  1TNZ B;  4FXG B;  2G02 A;  1H35 A; 
#chains in the Genus database with same CATH topology
 1X1I A;  3G4F A;  2Z07 A;  2R2L B;  1FO2 A;  4NEI A;  1GXO A;  3HXC B;  2EAB A;  5JPM B;  5FO8 B;  2CQS A;  1KSC A;  1LTX B;  4L0G A;  1H36 A;  1FCE A;  3QFZ A;  1RW9 A;  2IEJ B;  3QXQ A;  1O6R A;  4DOD A;  1N1B A;  2GH4 A;  3S4B A;  1O1R B;  5EAT A;  2FBA A;  4KKI A;  1GHQ A;  3QG0 A;  3H3K A;  1O6Q A;  2PMV A;  4YDO B;  2YIK A;  3VSN A;  2BRV X;  2H6F B;  1FP3 A;  3N0G A;  3E37 B;  4WVB A;  3G6J B;  1K72 A;  3SAE A;  1N7R A;  2CQT A;  1TNB B;  3QWT A;  5ILZ A;  3NNB A;  3D5S A;  4LIX A;  1GXN A;  4EHM B;  1N7Q A;  1WU4 A;  3E7J A;  3M76 A;  3N0F A;  3QT3 A;  2BRP A;  2B39 A;  2BB6 A;  1NL4 B;  2GOX A;  4J5T A;  1H14 A;  1TF4 A;  5ILK A;  4AYO A;  3DSX B;  3ACS A;  3QXF A;  3DSS B;  1VD5 A;  3PZ1 B;  2FV1 A;  1NXC A;  2E24 A;  2JF4 A;  3M7L A;  1W3Y A;  5ILY A;  1O1S B;  2WIN B;  5MEH A;  3RX8 A;  1LF9 A;  2H6I B;  1LF6 A;  1HMU A;  2H6G B;  3PYB A;  2EAE A;  3GZK A;  1D8E B;  1IS9 A;  1HM2 A;  2WDA A;  3PYA A;  4E1Y A;  2XQW A;  4KTR A;  1FPP B;  4V1R A;  2A73 B;  1TNO B;  3QRY A;  4FXK B;  4KKJ A;  2WYN A;  3WUX A;  5ILI A;  1G9G A;  4FXG B;  3H7L A;  1C82 A;  1N7P A;  3QT9 A;  4ZG8 A;  1GAI A;  4F13 A;  5DGQ A;  3WC3 A;  1LXM A;  2B4F A;  3GLY A;  1CB8 A;  4TF4 A;  3M75 A;  3LZ9 A;  5IKH A;  2F6D A;  3E80 A;  2EAD A;  5ILD A;  2GZ6 A;  2WY7 A;  3GT5 A;  2XWJ B;  3X17 A;  4ZRP A;  4GTQ B;  3HXF B;  1F9D A;  3C72 B;  2AHF A;  3K7X A;  4WVC A;  4GTP B;  3PZ4 B;  1HXG A;  2SQC A;  4XUV A;  1S63 B;  1UMP A;  3Q79 B;  2X03 A;  1MZC B;  2ONG A;  2VN7 A;  4MMI A;  1SQC A;  5IK0 A;  2FV0 A;  5ILJ A;  5ILH A;  3Q7F B;  2E22 A;  2V8K A;  4WU0 A;  1OJO A;  4OK2 A;  1UG9 A;  2RI8 A;  1R76 A;  3KQ4 A;  4MMH A;  3T33 A;  4YCR A;  5FOB B;  2F0Y B;  1H13 A;  1FBO A;  5M7I A;  1DCE B;  3KSL B;  2NVP A;  4QT9 A;  3W7S A;  2RI9 A;  3SFY B;  3ANI A;  1LXK A;  3M02 A;  3S9V A;  1HXC A;  4AYP A;  3P2C A;  4DOE A;  1HV6 A;  4Q2B A;  3D5R A;  5IL8 A;  1EGU A;  2NOJ A;  5DHI A;  3SQC A;  3KLS A;  3QPF A;  3W7X A;  3DRA B;  1H54 A;  2RGK A;  4ZH1 A;  1JS4 A;  5FO9 B;  1F9G A;  1V7V A;  3M73 A;  5EAS A;  1KZP B;  4WVA A;  1FT1 B;  3CIH A;  4Q88 A;  3RSY A;  1TNU B;  1H3C A;  4F10 A;  1FO3 A;  2VN4 A;  5JMF A;  2J5C A;  3DPY B;  4CE7 A;  2V3N A;  1JCS B;  2D5J A;  4CJ1 A;  3VXD A;  5CZL A;  3P5P A;  3W5N A;  1LD7 B;  5E2J A;  1KWF A;  4GL3 A;  3QDE A;  2G0D A;  3Q75 B;  3PMM A;  2I07 B;  1X81 B;  1TN8 B;  3DSV B;  3EU5 B;  5GZK A;  5CD2 A;  1SA4 B;  1N22 A;  5AGD A;  5GY3 A;  1TNZ B;  1HMW A;  2G02 A;  4GTM B;  3M7C A;  1HXA A;  3M71 A;  3SDV A;  1XW2 A;  3W7U A;  1HZF A;  1N24 A;  1GLM A;  4GAX A;  1HCU A;  1S64 B;  1AYX A;  4FJQ A;  1O5M B;  5GW7 A;  5JPN B;  3D3I A;  1W6J A;  5IM1 A;  1KSD A;  1N4S B;  1NC5 A;  3EQA A;  4V1S A;  1N9A B;  1FAE A;  1N7O A;  5IL3 A;  4OZV A;  1IA7 A;  3E6U A;  1WU5 A;  4MBG B;  3DST B;  3ANK A;  2ONH A;  1H12 A;  4FUS A;  1N23 A;  3REN A;  3WIW A;  1OJP A;  1RWC A;  2DRQ A;  2BRW A;  3VSM A;  1HM3 A;  4D4C A;  1GAH A;  1G9J A;  1QBQ B;  1NI1 B;  3E30 B;  1V7X A;  3WIR A;  2BBC A;  2XFG A;  3PZ2 B;  1F9O A;  4TXT A;  3NFV A;  3S4D A;  1RWF A;  3OXU A;  4YDE B;  5JMD A;  1V5D A;  2D8L A;  2DRO A;  2V3P A;  1KRE A;  4D4B A;  1FT2 B;  1W6K A;  3G4D A;  3M7E A;  5C05 A;  2PN5 A;  1KKT A;  3W7T A;  1KRF A;  1KFG A;  3SDT A;  1X1H A;  4GTT B;  4OZW A;  3RRS A;  4OJZ A;  1N95 B;  2FUQ A;  1N4P B;  1GXM A;  3QSP A;  1JCQ B;  5DGR A;  2WCO A;  3SFX B;  1CEM A;  2H6H B;  1GSZ A;  3TF4 A;  2ZZR A;  4RNQ A;  4C1S A;  2FUT A;  1G6I A;  2WY8 A;  4KTP A;  1TN6 B;  1XWT A;  5M7Y A;  2ZIR B;  3EZ8 A;  1HX9 A;  3E32 B;  3A0O A;  1KS8 A;  3E73 A;  1G87 A;  1GA2 A;  1J0N A;  4ONT A;  3M78 A;  3CU7 A;  4Z4J A;  5IKA A;  1QAZ A;  1O6H A;  4GTR B;  4L9P B;  1V7W A;  3ACT A;  3HXE B;  1WZZ A;  3M77 A;  1N20 A;  4GTO B;  4CJ0 A;  1D8D B;  3S4C A;  1RWA A;  2OKX A;  1I8Q A;  1H35 A;  1H39 A;  3AFJ A;  1KZO B;  1N4R B;  1DL2 A;  3DSU B;  3M7B A;  1N4Q B;  3Q78 B;  3M72 A;  4BOJ A;  1TNY B;  3RX7 A;  4EL8 A;  3SDR A;  2WII B;  3ON6 A;  1C3D A;  1FBW A;  1OJN A;  4MU9 A;  1JCR B;  3EUV B;  3OED A;  1DOG A;  1UT9 A;  2DRS A;  3K11 A;  3E34 B;  1RQ5 A;  4JJJ A;  4D4A A;  1QQF A;  1J0M A;  3RX5 A;  3DSW B;  3ANJ A;  2V8I A;  4LNV A;  3A3V A;  4M76 A;  2V8J A;  1LD8 B;  4LNG B;  3HXB B;  1WU6 A;  4AYR A;  3KSQ B;  1O1T B;  1H37 A;  1IA6 A;  4AYQ A;  4GTV B;  2AHG A;  1TN7 B;  2EAC A;  3VW5 A;  5EAU A;  4ZRQ A;  4BOK A;  1AGM A;  2BED B;  5FO7 B;  3WKI A;  4L6X A;  5IK6 A;  3M00 A;  2FUZ A;  1N7N A;  2A8Z A;  1N1Z A;  2P0V A;  1HN0 A;  4DI5 A;  1OJM A;  3QFY A;  1CLC A;  2QNO A;  4ZH5 A;  3SDQ A;  2BB5 A;  1X9D A;  5DHK A;  1RWG A;  3Q7A B;  2Q1F A;  3WKF A;  3M01 A;  3EU8 A;  1X1J A;  3W7W A;  4D4D A;  5KKB A;  1L1Y A;  4Z4L A;  1N21 A;  3W5M A;  1XWQ A;  1F1S A;  4OK4 A;  1V5C A;  3M74 A;  3WKG A;  3E33 B;  4GTS B;  3S4A A;  2ZIS B;  3PZ3 B;  3HXD B;  4FNV A;  3SDU A;  1H3B A;  3H2W A;  3Q73 B;  3RJ3 A;  5CA3 A;  3P5R A;  2JG0 A;  1N94 B;  3WKH A;  5IK9 A;  1O79 A;  1L2A A;  2DRR A;  1SA5 B;  1LOH A;  1ULV A;  2XWB B;  1QSJ A;  2JJB A;  3AFL A;  2AFA A;  2ZBL A;  3WIQ A;  1RWH A;  4D94 A;  1H3A A;  4LNB B;  1FMI A; 
#chains in the Genus database with same CATH homology
 2Z07 A;  2R2L B;  1FO2 A;  1GXO A;  3HXC B;  2EAB A;  5JPM B;  5FO8 B;  2CQS A;  1KSC A;  1LTX B;  4L0G A;  1H36 A;  1FCE A;  3QFZ A;  2IEJ B;  3QXQ A;  1O6R A;  4DOD A;  2GH4 A;  3S4B A;  1O1R B;  2FBA A;  4KKI A;  1GHQ A;  3QG0 A;  3H3K A;  1O6Q A;  2PMV A;  4YDO B;  2YIK A;  2H6F B;  1FP3 A;  3E37 B;  4WVB A;  3G6J B;  1K72 A;  3SAE A;  2CQT A;  1TNB B;  3QWT A;  3D5S A;  4LIX A;  1GXN A;  4EHM B;  1WU4 A;  3M76 A;  3QT3 A;  2B39 A;  2BB6 A;  1NL4 B;  2GOX A;  4J5T A;  1H14 A;  1TF4 A;  4AYO A;  3DSX B;  3ACS A;  3QXF A;  3DSS B;  1VD5 A;  3PZ1 B;  2FV1 A;  1NXC A;  2JF4 A;  3M7L A;  1O1S B;  2WIN B;  5MEH A;  3RX8 A;  1LF9 A;  2H6I B;  1LF6 A;  2H6G B;  3PYB A;  2EAE A;  3GZK A;  1D8E B;  1IS9 A;  3PYA A;  2XQW A;  4KTR A;  1FPP B;  4V1R A;  2A73 B;  1TNO B;  3QRY A;  4FXK B;  4KKJ A;  2WYN A;  3WUX A;  1G9G A;  4FXG B;  3H7L A;  3QT9 A;  4ZG8 A;  1GAI A;  5DGQ A;  3WC3 A;  2B4F A;  3GLY A;  4TF4 A;  3M75 A;  2F6D A;  2EAD A;  2GZ6 A;  2WY7 A;  3GT5 A;  2XWJ B;  3X17 A;  4ZRP A;  4GTQ B;  3HXF B;  1F9D A;  3C72 B;  2AHF A;  3K7X A;  4WVC A;  4GTP B;  3PZ4 B;  2SQC A;  4XUV A;  1S63 B;  1UMP A;  3Q79 B;  1MZC B;  2VN7 A;  1SQC A;  2FV0 A;  3Q7F B;  2V8K A;  4WU0 A;  1UG9 A;  2RI8 A;  1R76 A;  3KQ4 A;  3T33 A;  4YCR A;  5FOB B;  2F0Y B;  1H13 A;  1FBO A;  5M7I A;  1DCE B;  3KSL B;  2NVP A;  4QT9 A;  3W7S A;  2RI9 A;  3SFY B;  3ANI A;  3S9V A;  4AYP A;  3P2C A;  4DOE A;  4Q2B A;  3D5R A;  2NOJ A;  3SQC A;  3KLS A;  3QPF A;  3W7X A;  3DRA B;  1H54 A;  2RGK A;  4ZH1 A;  1JS4 A;  5FO9 B;  1V7V A;  3M73 A;  1KZP B;  4WVA A;  1FT1 B;  3CIH A;  4Q88 A;  3RSY A;  1TNU B;  1H3C A;  1FO3 A;  2VN4 A;  3DPY B;  4CE7 A;  2V3N A;  1JCS B;  2D5J A;  4CJ1 A;  3VXD A;  5CZL A;  3P5P A;  3W5N A;  1LD7 B;  5E2J A;  1KWF A;  4GL3 A;  3QDE A;  2G0D A;  3Q75 B;  3PMM A;  2I07 B;  1X81 B;  1TN8 B;  3DSV B;  3EU5 B;  5GZK A;  5CD2 A;  1SA4 B;  5AGD A;  5GY3 A;  1TNZ B;  2G02 A;  4GTM B;  3M7C A;  3M71 A;  3SDV A;  1XW2 A;  3W7U A;  1HZF A;  1GLM A;  1HCU A;  1S64 B;  1AYX A;  1O5M B;  5GW7 A;  5JPN B;  3D3I A;  1W6J A;  1KSD A;  1N4S B;  1NC5 A;  3EQA A;  4V1S A;  1N9A B;  1FAE A;  1IA7 A;  3E6U A;  1WU5 A;  4MBG B;  3DST B;  3ANK A;  1H12 A;  4FUS A;  3REN A;  3WIW A;  2DRQ A;  4D4C A;  1GAH A;  1G9J A;  1QBQ B;  1NI1 B;  3E30 B;  1V7X A;  3WIR A;  2BBC A;  2XFG A;  3PZ2 B;  1F9O A;  4TXT A;  3S4D A;  4YDE B;  3OXU A;  1V5D A;  2D8L A;  2DRO A;  2V3P A;  1KRE A;  4D4B A;  1FT2 B;  1W6K A;  3M7E A;  2PN5 A;  1KKT A;  3W7T A;  1KRF A;  1KFG A;  3SDT A;  4GTT B;  3RRS A;  1N95 B;  1N4P B;  1GXM A;  3QSP A;  1JCQ B;  5DGR A;  3SFX B;  1CEM A;  2H6H B;  1GSZ A;  3TF4 A;  2ZZR A;  4C1S A;  1G6I A;  2WY8 A;  4KTP A;  1TN6 B;  1XWT A;  5M7Y A;  2ZIR B;  3EZ8 A;  3E32 B;  1KS8 A;  3E73 A;  1G87 A;  1GA2 A;  4ONT A;  3M78 A;  3CU7 A;  4Z4J A;  1O6H A;  4GTR B;  4L9P B;  1V7W A;  3ACT A;  3HXE B;  1WZZ A;  3M77 A;  4GTO B;  4CJ0 A;  1D8D B;  3S4C A;  2OKX A;  1H35 A;  1H39 A;  3AFJ A;  1KZO B;  1N4R B;  1DL2 A;  3DSU B;  3M7B A;  1N4Q B;  3Q78 B;  3M72 A;  4BOJ A;  1TNY B;  3RX7 A;  4EL8 A;  3SDR A;  2WII B;  3ON6 A;  1C3D A;  1FBW A;  4MU9 A;  1JCR B;  3EUV B;  3OED A;  1DOG A;  1UT9 A;  2DRS A;  3K11 A;  3E34 B;  1RQ5 A;  4JJJ A;  4D4A A;  1QQF A;  3RX5 A;  3DSW B;  3ANJ A;  2V8I A;  4LNV A;  3A3V A;  4M76 A;  2V8J A;  1LD8 B;  4LNG B;  3HXB B;  1WU6 A;  4AYR A;  3KSQ B;  1O1T B;  1H37 A;  1IA6 A;  4AYQ A;  4GTV B;  2AHG A;  1TN7 B;  2EAC A;  3VW5 A;  4ZRQ A;  4BOK A;  1AGM A;  2BED B;  5FO7 B;  3WKI A;  4L6X A;  2FUZ A;  2A8Z A;  2P0V A;  3QFY A;  1CLC A;  2QNO A;  4ZH5 A;  3SDQ A;  2BB5 A;  1X9D A;  3Q7A B;  3WKF A;  3EU8 A;  3W7W A;  4D4D A;  5KKB A;  1L1Y A;  4Z4L A;  3W5M A;  1XWQ A;  1V5C A;  3M74 A;  3WKG A;  3E33 B;  4GTS B;  3S4A A;  2ZIS B;  3PZ3 B;  3HXD B;  3SDU A;  1H3B A;  3H2W A;  3Q73 B;  3RJ3 A;  5CA3 A;  3P5R A;  2JG0 A;  1N94 B;  3WKH A;  1O79 A;  1L2A A;  2DRR A;  1SA5 B;  2XWB B;  1ULV A;  1QSJ A;  2JJB A;  2AFA A;  2ZBL A;  3WIQ A;  4D94 A;  1H3A A;  4LNB B;  1FMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...