4ZH1A

Complement factor h in complex with the gm1 glycan
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
293
structure length
293
Chain Sequence
RDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Complement Factor H and Simian Virus 40 bind the GM1 ganglioside in distinct conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 118
structure length 293
sequence length 293
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4zh1A00
2F0YB 3DSSB 1O6RA 3E32B 4D4DA 4D4CA 2BBCA 2G0DA 3G6JB 4LNBB 4ONTA 5JPNB 1H37A 4GTRB 1N4SB 3KSQB 1KZPB 4ZH1A 3Q7AB 3OXUA 2V8JA 3DSVB 1FPPB 1SA5B 1QQFA 2V8IA 3KQ4A 4LNVA 1MZCB 1H35A 4D4BA 4KKIA 1SA4B 4YDOB 1TNOB 3HXDB 2I07B 1LD7B 1O1RB 3D5RA 1DCEB 3Q75B 3PZ4B 4GTQB 1JCSB 1D8DB 1H3AA 1W6KA 4FXGB 3DSTB 1O79A 2NOJA 4C1SA 1D8EB 4GTMB 2V8KA 4GTPB 4MU9A 1N9AB 1O6QA 1FT1B 2R2LB 3KLSA 3Q79B 3OEDA 1W6JA 2H6FB 2PN5A 2ZISB 2WINB 3E33B 2H6GB 4EHMB 3PZ2B 3SFYB 1S64B 3Q73B 1N4QB 5FO8B 3Q78B 2B39A 1N95B 1TN8B 1S63B 2BB5A 1N4PB 2V3NA 3E37B 3K7XA 5FOBB 2XWBB 3E30B 4GTOB 3RJ3A 1GHQA 1C3DA 1QSJA 1TNBB 2G02A 2PMVA 2WIIB 4D4AA 3SQCA 1H3BA 1O6HA 4M76A 2ZIRB 1NL4B 4FXKB 1O1TB 1FT2B 1O5MB 3EU5B 1TN6B 3DSWB 1GXOA 1NI1B 1GXNA 2H6IB 3DRAB 1GSZA 2XWJB 4D94A 3DPYB 1O1SB 2SQCA 1TNZB 1HZFA 3CU7A 1UMPA 3Q7FB 4ZRQA 3HXBB 3PZ3B 2GOXA 2BB6A 3HXCB 4GTSB 2V3PA 3EUVB 2WY7A 3E34B 3SFXB 3DSUB 3KSLB 3PZ1B 3DSXB 2H6HB 2IEJB 2BEDB 3D5SA 3HXEB 4L9PB 4ZRPA 4MBGB 4LNGB 5JPMB 1LD8B 1JCRB 1SQCA 4BOKA 1N94B 2A73B 2WY8A 3C72B 4GTTB 1LTXB 4V1SA 1JCQB 5FO7B 1H3CA 1N4RB 4V1RA 1H39A 4GTVB 5AGDA 1GXMA 1X81B 4YDEB 1TNUB 1TNYB 1H36A 2XQWA 3HXFB 1QBQB 4BOJA 1TN7B 5FO9B 4KKJA 1KZOB 1R76A
chains in the Genus database with same CATH superfamily
4D4CA 1O6RA 2BRWA 3RX7A 4L6XA 4KTRA 4Z4LA 3QFZA 3GLYA 4GTRB 1N4SB 1KZPB 4FUSA 2FUZA 2ZBLA 3W7XA 3SDRA 5JMDA 1SA5B 1QQFA 2ZZRA 4AYOA 1KSDA 1HXGA 1SA4B 4YDOB 4DOEA 3ON6A 5IK9A 1DCEB 1AGMA 1QAZA 4RNQA 1D8DB 1H3AA 4FXGB 1KS8A 3N0GA 1LOHA 3QXFA 2BRPA 4GTPB 1KFGA 1N20A 1N9AB 2R2LB 4WU0A 4Q2BA 2WINB 3WIWA 1FMIA 3SFYB 1LF6A 4Q88A 3D3IA 3Q73B 1N4QB 2Z07A 3Q78B 2B39A 3G4DA 1TN8B 3ANIA 4WVAA 1G9JA 5IK0A 3E30B 3RJ3A 1GHQA 1QSJA 2G02A 4D4AA 5IL8A 1N7RA 1O6HA 1G87A 1N24A 1X1HA 2FUQA 1W3YA 2ZIRB 4OK2A 3M7CA 2XWJB 1N7OA 3M78A 2A8ZA 1TNZB 3Q7FB 1KRFA 3HXCB 3WKIA 1AYXA 3E7JA 3SDVA 1K72A 2JF4A 1HMUA 2H6HB 2QNOA 2GZ6A 4MBGB 5DGQA 4LIXA 3RENA 3S9VA 4AYRA 1SQCA 2A73B 4QT9A 1OJOA 5FO7B 3W7UA 3QG0A 3SAEA 5DHIA 5MEHA 1FO3A 3M77A 5AGDA 3AFJA 3QDEA 2CQTA 2XQWA 1KKTA 4BOJA 1TN7B 1GLMA 4EL8A 2ONHA 2F0YB 3E32B 4LNBB 4ONTA 3M75A 1HV6A 2EAEA 2J5CA 3EQAA 1WZZA 3RX5A 2JJBA 1FPPB 3M73A 3QT3A 1F9OA 4D4BA 4YCRA 1CB8A 3M76A 5KKBA 1WU5A 1TNOB 2DRRA 3S4AA 2DROA 3GT5A 3P5RA 4CJ1A 4GTQB 1H54A 2BRVX 1OJPA 2NOJA 2AFAA 1D8EB 1FT1B 1FAEA 5ILIA 3KLSA 5ILDA 3OEDA 5IK6A 1W6JA 1XWQA 3E33B 1FBWA 5CA3A 1L2AA 1S64B 1NXCA 1CLCA 5FO8B 5ILYA 1HM3A 4AYPA 1N95B 2BB5A 5CD2A 2FBAA 3M01A 4GTOB 4FJQA 3K11A 1TNBB 3VSNA 2WIIB 2PMVA 3SQCA 3ANKA 1H3BA 2DRQA 4M76A 5C05A 1NL4B 4FXKB 1FT2B 2YIKA 5IM1A 3QXQA 1GXOA 1L1YA 1NI1B 3H7LA 4F10A 3DRAB 1KREA 1RWHA 4D94A 3DPYB 4J5TA 2SQCA 3M71A 3WUXA 1UMPA 4ZRQA 1HMWA 4OZVA 2V3PA 2WCOA 5GW7A 1X1IA 2WY7A 1H13A 3DSUB 2D8LA 5DHKA 2EABA 3SDTA 2BEDB 4XUVA 1X1JA 4L9PB 2RI8A 3WIRA 3SDQA 1LD8B 3VXDA 3W7TA 1RWAA 3C72B 3AFLA 5CZLA 4V1RA 1H39A 1CEMA 1F9GA 1FO2A 4YDEB 1TNUB 1RWFA 3WKHA 1QBQB 3M72A 4MMHA 3RSYA 4JJJA 4KTPA 1WU6A 1R76A 3DSSB 5ILJA 4D4DA 2BBCA 1GA2A 2G0DA 3G6JB 1RQ5A 1H37A 1GAHA 1LXMA 3M7EA 3G4FA 2V8JA 1F1SA 5M7YA 5IKHA 3A0OA 1KWFA 3VSMA 1WU4A 1N22A 1H35A 1N7PA 4KKIA 1N1ZA 5JMFA 1VD5A 3HXDB 4FNVA 1UT9A 3CIHA 3D5RA 5E2JA 3PZ4B 4GAXA 2Q1FA 2JG0A 1O79A 3NFVA 4Z4JA 5IKAA 2E22A 2F6DA 3WC3A 4MU9A 1O6QA 3Q79B 5EAUA 2RI9A 1N21A 1LXKA 2H6FB 4OZWA 2X03A 2H6GB 4EHMB 3PZ2B 2E24A 1TF4A 1V5DA 1V5CA 3WKFA 5EASA 1N4PB 3E37B 2FV0A 5GY3A 2AHGA 2XWBB 2P0VA 1I8QA 2FUTA 3W5MA 3H3KA 1FBOA 1OJMA 1RW9A 1O1TB 2EACA 2NVPA 2H6IB 2VN7A 1HN0A 1GSZA 3QT9A 1XW2A 3A3VA 4GL3A 1O1SB 1LF9A 1HZFA 3HXBB 3PZ3B 2BB6A 2GOXA 4GTSB 5GZKA 1G6IA 3EUVB 3QSPA 1KSCA 3E34B 1IA6A 3SFXB 3P2CA 1J0NA 1HM2A 2VN4A 1RWGA 5EATA 3E80A 1HCUA 3KSLB 3M7BA 3DSXB 2IEJB 4F13A 4WVCA 5ILHA 3S4DA 1J0MA 4LNGB 3M02A 3QPFA 1N94B 2WY8A 4ZH5A 3TF4A 4V1SA 3QRYA 1ULVA 1C82A 4GTVB 2CQSA 4CJ0A 1X81B 1UG9A 3HXFB 4WVBA 2GH4A 2B4FA 4KKJA 3VW5A 4E1YA 3M00A 4OK4A 5JPNB 3E6UA 4TXTA 4DODA 3W7SA 3KSQB 4ZH1A 3Q7AB 3OXUA 3DSVB 4CE7A 3NNBA 3GZKA 2V8IA 3KQ4A 4NEIA 3S4CA 4LNVA 2WYNA 2OKXA 1MZCB 3E73A 3LZ9A 1V7VA 1V7WA 3ANJA 3PYBA 2I07B 1F9DA 1LD7B 1N7QA 1O1RB 3SDUA 3Q75B 1IA7A 2XFGA 1JCSB 1X9DA 2WDAA 2DRSA 3ACTA 1EGUA 3DSTB 1JS4A 1W6KA 5DGRA 3RRSA 3W5NA 4TF4A 4C1SA 4GTMB 2V8KA 1H14A 3ACSA 3RX8A 3T33A 3P5PA 1OJNA 2PN5A 2ZISB 4MMIA 1NC5A 1HX9A 1DOGA 1IS9A 5IL3A 5M7IA 1DL2A 1HXCA 1S63B 2AHFA 2V3NA 3K7XA 5FOBB 3M7LA 1C3DA 3M74A 3QWTA 4ZG8A 1N23A 3WIQA 1O5MB 1H12A 3EU5B 1TN6B 3DSWB 3W7WA 1GXNA 1GAIA 1N7NA 2EADA 1FP3A 3X17A 3CU7A 1V7XA 2ONGA 3N0FA 1N1BA 5ILKA 3QFYA 4OJZA 3H2WA 3PZ1B 3EZ8A 3S4BA 4AYQA 3D5SA 3HXEB 4ZRPA 5JPMB 1HXAA 3PYAA 1JCRB 4BOKA 1G9GA 1RWCA 1XWTA 4GTTB 1LTXB 3PMMA 1JCQB 3EU8A 1H3CA 1N4RB 4L0GA 1GXMA 2FV1A 4DI5A 5ILZA 1TNYB 1H36A 3WKGA 2D5JA 2RGKA 5FO9B 1KZOB 1FCEA
chains in the Genus database with same CATH topology
4D4CA 1O6RA 3RX7A 4L6XA 4KTRA 4Z4LA 3QFZA 3GLYA 4GTRB 1N4SB 1KZPB 4FUSA 2FUZA 2ZBLA 3W7XA 3SDRA 1SA5B 1QQFA 2ZZRA 4AYOA 1KSDA 1SA4B 4YDOB 4DOEA 3ON6A 1DCEB 1AGMA 1D8DB 1H3AA 4FXGB 1KS8A 3QXFA 4GTPB 1KFGA 1N9AB 2R2LB 4WU0A 4Q2BA 2WINB 3WIWA 1FMIA 3SFYB 1LF6A 4Q88A 3D3IA 3Q73B 1N4QB 2Z07A 3Q78B 2B39A 1TN8B 3ANIA 4WVAA 1G9JA 3E30B 3RJ3A 1GHQA 1QSJA 2G02A 4D4AA 1O6HA 1G87A 2ZIRB 3M7CA 2XWJB 3M78A 2A8ZA 1TNZB 3Q7FB 1KRFA 3HXCB 3WKIA 1AYXA 3SDVA 1K72A 2JF4A 2H6HB 2QNOA 2GZ6A 4MBGB 5DGQA 4LIXA 3RENA 3S9VA 4AYRA 1SQCA 2A73B 4QT9A 5FO7B 3W7UA 3QG0A 3SAEA 5MEHA 1FO3A 3M77A 5AGDA 3AFJA 3QDEA 2CQTA 2XQWA 1KKTA 4BOJA 1TN7B 1GLMA 4EL8A 2F0YB 3E32B 4LNBB 4ONTA 3M75A 2EAEA 3EQAA 1WZZA 3RX5A 2JJBA 1FPPB 3M73A 3QT3A 1F9OA 4D4BA 4YCRA 3M76A 5KKBA 1WU5A 1TNOB 2DRRA 3S4AA 2DROA 3GT5A 3P5RA 4CJ1A 4GTQB 1H54A 2NOJA 2AFAA 1D8EB 1FT1B 1FAEA 3KLSA 3OEDA 1W6JA 1XWQA 3E33B 1FBWA 5CA3A 1L2AA 1S64B 1NXCA 1CLCA 5FO8B 4AYPA 1N95B 2BB5A 5CD2A 2FBAA 4GTOB 3K11A 1TNBB 2WIIB 2PMVA 3SQCA 3ANKA 1H3BA 2DRQA 4M76A 1NL4B 4FXKB 1FT2B 2YIKA 3QXQA 1GXOA 1L1YA 1NI1B 3H7LA 3DRAB 1KREA 4D94A 3DPYB 4J5TA 2SQCA 3M71A 3WUXA 1UMPA 4ZRQA 2V3PA 5GW7A 2WY7A 1H13A 3DSUB 2D8LA 2EABA 3SDTA 2BEDB 4XUVA 4L9PB 2RI8A 3WIRA 3SDQA 1LD8B 3VXDA 3W7TA 3C72B 5CZLA 4V1RA 1H39A 1CEMA 1FO2A 4YDEB 1TNUB 3WKHA 1QBQB 3M72A 3RSYA 4JJJA 4KTPA 1WU6A 1R76A 3DSSB 4D4DA 2BBCA 1GA2A 2G0DA 3G6JB 1RQ5A 1H37A 1GAHA 3M7EA 2V8JA 5M7YA 1KWFA 1WU4A 1H35A 4KKIA 1VD5A 3HXDB 1UT9A 3CIHA 3D5RA 5E2JA 3PZ4B 2JG0A 1O79A 4Z4JA 2F6DA 3WC3A 4MU9A 1O6QA 3Q79B 2RI9A 2H6FB 2H6GB 4EHMB 3PZ2B 1TF4A 1V5DA 1V5CA 3WKFA 1N4PB 3E37B 2FV0A 5GY3A 2AHGA 2XWBB 2P0VA 3W5MA 3H3KA 1FBOA 1O1TB 2EACA 2NVPA 2H6IB 2VN7A 1GSZA 3QT9A 1XW2A 3A3VA 4GL3A 1O1SB 1LF9A 1HZFA 3HXBB 3PZ3B 2BB6A 2GOXA 4GTSB 5GZKA 1G6IA 3EUVB 3QSPA 1KSCA 3E34B 1IA6A 3SFXB 3P2CA 2VN4A 3M7BA 1HCUA 3KSLB 3DSXB 2IEJB 4WVCA 3S4DA 4LNGB 3QPFA 1N94B 2WY8A 4ZH5A 3TF4A 4V1SA 3QRYA 1ULVA 4GTVB 2CQSA 4CJ0A 1X81B 1UG9A 3HXFB 4WVBA 2GH4A 2B4FA 4KKJA 3VW5A 5JPNB 3E6UA 4TXTA 4DODA 3W7SA 3KSQB 4ZH1A 3Q7AB 3OXUA 3DSVB 4CE7A 3GZKA 2V8IA 3KQ4A 3S4CA 4LNVA 2WYNA 2OKXA 1MZCB 3E73A 1V7VA 1V7WA 3ANJA 3PYBA 2I07B 1F9DA 1LD7B 1O1RB 3SDUA 3Q75B 1IA7A 2XFGA 1JCSB 1W6KA 1X9DA 2DRSA 3ACTA 5DGRA 3DSTB 1JS4A 3RRSA 3W5NA 4TF4A 4C1SA 4GTMB 2V8KA 1H14A 3ACSA 3RX8A 3T33A 3P5PA 2PN5A 2ZISB 1NC5A 1DOGA 1IS9A 5M7IA 1DL2A 1S63B 2AHFA 2V3NA 3K7XA 5FOBB 3M7LA 1C3DA 3M74A 3QWTA 4ZG8A 3WIQA 1O5MB 1H12A 3EU5B 1TN6B 3DSWB 3W7WA 1GXNA 1GAIA 2EADA 1FP3A 3X17A 3CU7A 1V7XA 3QFYA 3H2WA 3PZ1B 3EZ8A 3S4BA 4AYQA 3D5SA 3HXEB 4ZRPA 5JPMB 3PYAA 1JCRB 4BOKA 1G9GA 1XWTA 4GTTB 1LTXB 3PMMA 1JCQB 3EU8A 1H3CA 1N4RB 4L0GA 1GXMA 2FV1A 1TNYB 1H36A 3WKGA 2D5JA 2RGKA 5FO9B 1KZOB 1FCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Y B;  3DSS B;  1O6R A;  3E32 B;  4D4D A;  4D4C A;  2BBC A;  2G0D A;  3G6J B;  4LNB B;  4ONT A;  5JPN B;  1H37 A;  4GTR B;  1N4S B;  3KSQ B;  1KZP B;  4ZH1 A;  3Q7A B;  3OXU A;  2V8J A;  3DSV B;  1FPP B;  1SA5 B;  1QQF A;  2V8I A;  3KQ4 A;  4LNV A;  1MZC B;  1H35 A;  4D4B A;  4KKI A;  1SA4 B;  4YDO B;  1TNO B;  3HXD B;  2I07 B;  1LD7 B;  1O1R B;  3D5R A;  1DCE B;  3Q75 B;  3PZ4 B;  4GTQ B;  1JCS B;  1D8D B;  1H3A A;  1W6K A;  4FXG B;  3DST B;  1O79 A;  2NOJ A;  4C1S A;  1D8E B;  4GTM B;  2V8K A;  4GTP B;  4MU9 A;  1N9A B;  1O6Q A;  1FT1 B;  2R2L B;  3KLS A;  3Q79 B;  3OED A;  1W6J A;  2H6F B;  2PN5 A;  2ZIS B;  2WIN B;  3E33 B;  2H6G B;  4EHM B;  3PZ2 B;  3SFY B;  1S64 B;  3Q73 B;  1N4Q B;  5FO8 B;  3Q78 B;  2B39 A;  1N95 B;  1TN8 B;  1S63 B;  2BB5 A;  1N4P B;  2V3N A;  3E37 B;  3K7X A;  5FOB B;  2XWB B;  3E30 B;  4GTO B;  3RJ3 A;  1GHQ A;  1C3D A;  1QSJ A;  1TNB B;  2G02 A;  2PMV A;  2WII B;  4D4A A;  3SQC A;  1H3B A;  1O6H A;  4M76 A;  2ZIR B;  1NL4 B;  4FXK B;  1O1T B;  1FT2 B;  1O5M B;  3EU5 B;  1TN6 B;  3DSW B;  1GXO A;  1NI1 B;  1GXN A;  2H6I B;  3DRA B;  1GSZ A;  2XWJ B;  4D94 A;  3DPY B;  1O1S B;  2SQC A;  1TNZ B;  1HZF A;  3CU7 A;  1UMP A;  3Q7F B;  4ZRQ A;  3HXB B;  3PZ3 B;  2GOX A;  2BB6 A;  3HXC B;  4GTS B;  2V3P A;  3EUV B;  2WY7 A;  3E34 B;  3SFX B;  3DSU B;  3KSL B;  3PZ1 B;  3DSX B;  2H6H B;  2IEJ B;  2BED B;  3D5S A;  3HXE B;  4L9P B;  4ZRP A;  4MBG B;  4LNG B;  5JPM B;  1LD8 B;  1JCR B;  1SQC A;  4BOK A;  1N94 B;  2A73 B;  2WY8 A;  3C72 B;  4GTT B;  1LTX B;  4V1S A;  1JCQ B;  5FO7 B;  1H3C A;  1N4R B;  4V1R A;  1H39 A;  4GTV B;  5AGD A;  1GXM A;  1X81 B;  4YDE B;  1TNU B;  1TNY B;  1H36 A;  2XQW A;  3HXF B;  1QBQ B;  4BOJ A;  1TN7 B;  5FO9 B;  4KKJ A;  1KZO B;  1R76 A; 
#chains in the Genus database with same CATH topology
 4D4C A;  1O6R A;  2BRW A;  3RX7 A;  4L6X A;  4KTR A;  4Z4L A;  3QFZ A;  3GLY A;  4GTR B;  1N4S B;  1KZP B;  4FUS A;  2FUZ A;  2ZBL A;  3W7X A;  3SDR A;  5JMD A;  1SA5 B;  1QQF A;  2ZZR A;  4AYO A;  1KSD A;  1HXG A;  1SA4 B;  4YDO B;  4DOE A;  3ON6 A;  5IK9 A;  1DCE B;  1AGM A;  1QAZ A;  4RNQ A;  1D8D B;  1H3A A;  4FXG B;  1KS8 A;  3N0G A;  1LOH A;  3QXF A;  2BRP A;  4GTP B;  1KFG A;  1N20 A;  1N9A B;  2R2L B;  4WU0 A;  4Q2B A;  2WIN B;  3WIW A;  1FMI A;  3SFY B;  1LF6 A;  4Q88 A;  3D3I A;  3Q73 B;  1N4Q B;  2Z07 A;  3Q78 B;  2B39 A;  3G4D A;  1TN8 B;  3ANI A;  4WVA A;  1G9J A;  5IK0 A;  3E30 B;  3RJ3 A;  1GHQ A;  1QSJ A;  2G02 A;  4D4A A;  5IL8 A;  1N7R A;  1O6H A;  1G87 A;  1N24 A;  1X1H A;  2FUQ A;  1W3Y A;  2ZIR B;  4OK2 A;  3M7C A;  2XWJ B;  1N7O A;  3M78 A;  2A8Z A;  1TNZ B;  3Q7F B;  1KRF A;  3HXC B;  3WKI A;  1AYX A;  3E7J A;  3SDV A;  1K72 A;  2JF4 A;  1HMU A;  2H6H B;  2QNO A;  2GZ6 A;  4MBG B;  5DGQ A;  4LIX A;  3REN A;  3S9V A;  4AYR A;  1SQC A;  2A73 B;  4QT9 A;  1OJO A;  5FO7 B;  3W7U A;  3QG0 A;  3SAE A;  5DHI A;  5MEH A;  1FO3 A;  3M77 A;  5AGD A;  3AFJ A;  3QDE A;  2CQT A;  2XQW A;  1KKT A;  4BOJ A;  1TN7 B;  1GLM A;  4EL8 A;  2ONH A;  2F0Y B;  3E32 B;  4LNB B;  4ONT A;  3M75 A;  1HV6 A;  2EAE A;  2J5C A;  3EQA A;  1WZZ A;  3RX5 A;  2JJB A;  1FPP B;  3M73 A;  3QT3 A;  1F9O A;  4D4B A;  4YCR A;  1CB8 A;  3M76 A;  5KKB A;  1WU5 A;  1TNO B;  2DRR A;  3S4A A;  2DRO A;  3GT5 A;  3P5R A;  4CJ1 A;  4GTQ B;  1H54 A;  2BRV X;  1OJP A;  2NOJ A;  2AFA A;  1D8E B;  1FT1 B;  1FAE A;  5ILI A;  3KLS A;  5ILD A;  3OED A;  5IK6 A;  1W6J A;  1XWQ A;  3E33 B;  1FBW A;  5CA3 A;  1L2A A;  1S64 B;  1NXC A;  1CLC A;  5FO8 B;  5ILY A;  1HM3 A;  4AYP A;  1N95 B;  2BB5 A;  5CD2 A;  2FBA A;  3M01 A;  4GTO B;  4FJQ A;  3K11 A;  1TNB B;  3VSN A;  2WII B;  2PMV A;  3SQC A;  3ANK A;  1H3B A;  2DRQ A;  4M76 A;  5C05 A;  1NL4 B;  4FXK B;  1FT2 B;  2YIK A;  5IM1 A;  3QXQ A;  1GXO A;  1L1Y A;  1NI1 B;  3H7L A;  4F10 A;  3DRA B;  1KRE A;  1RWH A;  4D94 A;  3DPY B;  4J5T A;  2SQC A;  3M71 A;  3WUX A;  1UMP A;  4ZRQ A;  1HMW A;  4OZV A;  2V3P A;  2WCO A;  5GW7 A;  1X1I A;  2WY7 A;  1H13 A;  3DSU B;  2D8L A;  5DHK A;  2EAB A;  3SDT A;  2BED B;  4XUV A;  1X1J A;  4L9P B;  2RI8 A;  3WIR A;  3SDQ A;  1LD8 B;  3VXD A;  3W7T A;  1RWA A;  3C72 B;  3AFL A;  5CZL A;  4V1R A;  1H39 A;  1CEM A;  1F9G A;  1FO2 A;  4YDE B;  1TNU B;  1RWF A;  3WKH A;  1QBQ B;  3M72 A;  4MMH A;  3RSY A;  4JJJ A;  4KTP A;  1WU6 A;  1R76 A;  3DSS B;  5ILJ A;  4D4D A;  2BBC A;  1GA2 A;  2G0D A;  3G6J B;  1RQ5 A;  1H37 A;  1GAH A;  1LXM A;  3M7E A;  3G4F A;  2V8J A;  1F1S A;  5M7Y A;  5IKH A;  3A0O A;  1KWF A;  3VSM A;  1WU4 A;  1N22 A;  1H35 A;  1N7P A;  4KKI A;  1N1Z A;  5JMF A;  1VD5 A;  3HXD B;  4FNV A;  1UT9 A;  3CIH A;  3D5R A;  5E2J A;  3PZ4 B;  4GAX A;  2Q1F A;  2JG0 A;  1O79 A;  3NFV A;  4Z4J A;  5IKA A;  2E22 A;  2F6D A;  3WC3 A;  4MU9 A;  1O6Q A;  3Q79 B;  5EAU A;  2RI9 A;  1N21 A;  1LXK A;  2H6F B;  4OZW A;  2X03 A;  2H6G B;  4EHM B;  3PZ2 B;  2E24 A;  1TF4 A;  1V5D A;  1V5C A;  3WKF A;  5EAS A;  1N4P B;  3E37 B;  2FV0 A;  5GY3 A;  2AHG A;  2XWB B;  2P0V A;  1I8Q A;  2FUT A;  3W5M A;  3H3K A;  1FBO A;  1OJM A;  1RW9 A;  1O1T B;  2EAC A;  2NVP A;  2H6I B;  2VN7 A;  1HN0 A;  1GSZ A;  3QT9 A;  1XW2 A;  3A3V A;  4GL3 A;  1O1S B;  1LF9 A;  1HZF A;  3HXB B;  3PZ3 B;  2BB6 A;  2GOX A;  4GTS B;  5GZK A;  1G6I A;  3EUV B;  3QSP A;  1KSC A;  3E34 B;  1IA6 A;  3SFX B;  3P2C A;  1J0N A;  1HM2 A;  2VN4 A;  1RWG A;  5EAT A;  3E80 A;  1HCU A;  3KSL B;  3M7B A;  3DSX B;  2IEJ B;  4F13 A;  4WVC A;  5ILH A;  3S4D A;  1J0M A;  4LNG B;  3M02 A;  3QPF A;  1N94 B;  2WY8 A;  4ZH5 A;  3TF4 A;  4V1S A;  3QRY A;  1ULV A;  1C82 A;  4GTV B;  2CQS A;  4CJ0 A;  1X81 B;  1UG9 A;  3HXF B;  4WVB A;  2GH4 A;  2B4F A;  4KKJ A;  3VW5 A;  4E1Y A;  3M00 A;  4OK4 A;  5JPN B;  3E6U A;  4TXT A;  4DOD A;  3W7S A;  3KSQ B;  4ZH1 A;  3Q7A B;  3OXU A;  3DSV B;  4CE7 A;  3NNB A;  3GZK A;  2V8I A;  3KQ4 A;  4NEI A;  3S4C A;  4LNV A;  2WYN A;  2OKX A;  1MZC B;  3E73 A;  3LZ9 A;  1V7V A;  1V7W A;  3ANJ A;  3PYB A;  2I07 B;  1F9D A;  1LD7 B;  1N7Q A;  1O1R B;  3SDU A;  3Q75 B;  1IA7 A;  2XFG A;  1JCS B;  1X9D A;  2WDA A;  2DRS A;  3ACT A;  1EGU A;  3DST B;  1JS4 A;  1W6K A;  5DGR A;  3RRS A;  3W5N A;  4TF4 A;  4C1S A;  4GTM B;  2V8K A;  1H14 A;  3ACS A;  3RX8 A;  3T33 A;  3P5P A;  1OJN A;  2PN5 A;  2ZIS B;  4MMI A;  1NC5 A;  1HX9 A;  1DOG A;  1IS9 A;  5IL3 A;  5M7I A;  1DL2 A;  1HXC A;  1S63 B;  2AHF A;  2V3N A;  3K7X A;  5FOB B;  3M7L A;  1C3D A;  3M74 A;  3QWT A;  4ZG8 A;  1N23 A;  3WIQ A;  1O5M B;  1H12 A;  3EU5 B;  1TN6 B;  3DSW B;  3W7W A;  1GXN A;  1GAI A;  1N7N A;  2EAD A;  1FP3 A;  3X17 A;  3CU7 A;  1V7X A;  2ONG A;  3N0F A;  1N1B A;  5ILK A;  3QFY A;  4OJZ A;  3H2W A;  3PZ1 B;  3EZ8 A;  3S4B A;  4AYQ A;  3D5S A;  3HXE B;  4ZRP A;  5JPM B;  1HXA A;  3PYA A;  1JCR B;  4BOK A;  1G9G A;  1RWC A;  1XWT A;  4GTT B;  1LTX B;  3PMM A;  1JCQ B;  3EU8 A;  1H3C A;  1N4R B;  4L0G A;  1GXM A;  2FV1 A;  4DI5 A;  5ILZ A;  1TNY B;  1H36 A;  3WKG A;  2D5J A;  2RGK A;  5FO9 B;  1KZO B;  1FCE A; 
#chains in the Genus database with same CATH homology
 4D4C A;  1O6R A;  3RX7 A;  4L6X A;  4KTR A;  4Z4L A;  3QFZ A;  3GLY A;  4GTR B;  1N4S B;  1KZP B;  4FUS A;  2FUZ A;  2ZBL A;  3W7X A;  3SDR A;  1SA5 B;  1QQF A;  2ZZR A;  4AYO A;  1KSD A;  1SA4 B;  4YDO B;  4DOE A;  3ON6 A;  1DCE B;  1AGM A;  1D8D B;  1H3A A;  4FXG B;  1KS8 A;  3QXF A;  4GTP B;  1KFG A;  1N9A B;  2R2L B;  4WU0 A;  4Q2B A;  2WIN B;  3WIW A;  1FMI A;  3SFY B;  1LF6 A;  4Q88 A;  3D3I A;  3Q73 B;  1N4Q B;  2Z07 A;  3Q78 B;  2B39 A;  1TN8 B;  3ANI A;  4WVA A;  1G9J A;  3E30 B;  3RJ3 A;  1GHQ A;  1QSJ A;  2G02 A;  4D4A A;  1O6H A;  1G87 A;  2ZIR B;  3M7C A;  2XWJ B;  3M78 A;  2A8Z A;  1TNZ B;  3Q7F B;  1KRF A;  3HXC B;  3WKI A;  1AYX A;  3SDV A;  1K72 A;  2JF4 A;  2H6H B;  2QNO A;  2GZ6 A;  4MBG B;  5DGQ A;  4LIX A;  3REN A;  3S9V A;  4AYR A;  1SQC A;  2A73 B;  4QT9 A;  5FO7 B;  3W7U A;  3QG0 A;  3SAE A;  5MEH A;  1FO3 A;  3M77 A;  5AGD A;  3AFJ A;  3QDE A;  2CQT A;  2XQW A;  1KKT A;  4BOJ A;  1TN7 B;  1GLM A;  4EL8 A;  2F0Y B;  3E32 B;  4LNB B;  4ONT A;  3M75 A;  2EAE A;  3EQA A;  1WZZ A;  3RX5 A;  2JJB A;  1FPP B;  3M73 A;  3QT3 A;  1F9O A;  4D4B A;  4YCR A;  3M76 A;  5KKB A;  1WU5 A;  1TNO B;  2DRR A;  3S4A A;  2DRO A;  3GT5 A;  3P5R A;  4CJ1 A;  4GTQ B;  1H54 A;  2NOJ A;  2AFA A;  1D8E B;  1FT1 B;  1FAE A;  3KLS A;  3OED A;  1W6J A;  1XWQ A;  3E33 B;  1FBW A;  5CA3 A;  1L2A A;  1S64 B;  1NXC A;  1CLC A;  5FO8 B;  4AYP A;  1N95 B;  2BB5 A;  5CD2 A;  2FBA A;  4GTO B;  3K11 A;  1TNB B;  2WII B;  2PMV A;  3SQC A;  3ANK A;  1H3B A;  2DRQ A;  4M76 A;  1NL4 B;  4FXK B;  1FT2 B;  2YIK A;  3QXQ A;  1GXO A;  1L1Y A;  1NI1 B;  3H7L A;  3DRA B;  1KRE A;  4D94 A;  3DPY B;  4J5T A;  2SQC A;  3M71 A;  3WUX A;  1UMP A;  4ZRQ A;  2V3P A;  5GW7 A;  2WY7 A;  1H13 A;  3DSU B;  2D8L A;  2EAB A;  3SDT A;  2BED B;  4XUV A;  4L9P B;  2RI8 A;  3WIR A;  3SDQ A;  1LD8 B;  3VXD A;  3W7T A;  3C72 B;  5CZL A;  4V1R A;  1H39 A;  1CEM A;  1FO2 A;  4YDE B;  1TNU B;  3WKH A;  1QBQ B;  3M72 A;  3RSY A;  4JJJ A;  4KTP A;  1WU6 A;  1R76 A;  3DSS B;  4D4D A;  2BBC A;  1GA2 A;  2G0D A;  3G6J B;  1RQ5 A;  1H37 A;  1GAH A;  3M7E A;  2V8J A;  5M7Y A;  1KWF A;  1WU4 A;  1H35 A;  4KKI A;  1VD5 A;  3HXD B;  1UT9 A;  3CIH A;  3D5R A;  5E2J A;  3PZ4 B;  2JG0 A;  1O79 A;  4Z4J A;  2F6D A;  3WC3 A;  4MU9 A;  1O6Q A;  3Q79 B;  2RI9 A;  2H6F B;  2H6G B;  4EHM B;  3PZ2 B;  1TF4 A;  1V5D A;  1V5C A;  3WKF A;  1N4P B;  3E37 B;  2FV0 A;  5GY3 A;  2AHG A;  2XWB B;  2P0V A;  3W5M A;  3H3K A;  1FBO A;  1O1T B;  2EAC A;  2NVP A;  2H6I B;  2VN7 A;  1GSZ A;  3QT9 A;  1XW2 A;  3A3V A;  4GL3 A;  1O1S B;  1LF9 A;  1HZF A;  3HXB B;  3PZ3 B;  2BB6 A;  2GOX A;  4GTS B;  5GZK A;  1G6I A;  3EUV B;  3QSP A;  1KSC A;  3E34 B;  1IA6 A;  3SFX B;  3P2C A;  2VN4 A;  3M7B A;  1HCU A;  3KSL B;  3DSX B;  2IEJ B;  4WVC A;  3S4D A;  4LNG B;  3QPF A;  1N94 B;  2WY8 A;  4ZH5 A;  3TF4 A;  4V1S A;  3QRY A;  1ULV A;  4GTV B;  2CQS A;  4CJ0 A;  1X81 B;  1UG9 A;  3HXF B;  4WVB A;  2GH4 A;  2B4F A;  4KKJ A;  3VW5 A;  5JPN B;  3E6U A;  4TXT A;  4DOD A;  3W7S A;  3KSQ B;  4ZH1 A;  3Q7A B;  3OXU A;  3DSV B;  4CE7 A;  3GZK A;  2V8I A;  3KQ4 A;  3S4C A;  4LNV A;  2WYN A;  2OKX A;  1MZC B;  3E73 A;  1V7V A;  1V7W A;  3ANJ A;  3PYB A;  2I07 B;  1F9D A;  1LD7 B;  1O1R B;  3SDU A;  3Q75 B;  1IA7 A;  2XFG A;  1JCS B;  1W6K A;  1X9D A;  2DRS A;  3ACT A;  5DGR A;  3DST B;  1JS4 A;  3RRS A;  3W5N A;  4TF4 A;  4C1S A;  4GTM B;  2V8K A;  1H14 A;  3ACS A;  3RX8 A;  3T33 A;  3P5P A;  2PN5 A;  2ZIS B;  1NC5 A;  1DOG A;  1IS9 A;  5M7I A;  1DL2 A;  1S63 B;  2AHF A;  2V3N A;  3K7X A;  5FOB B;  3M7L A;  1C3D A;  3M74 A;  3QWT A;  4ZG8 A;  3WIQ A;  1O5M B;  1H12 A;  3EU5 B;  1TN6 B;  3DSW B;  3W7W A;  1GXN A;  1GAI A;  2EAD A;  1FP3 A;  3X17 A;  3CU7 A;  1V7X A;  3QFY A;  3H2W A;  3PZ1 B;  3EZ8 A;  3S4B A;  4AYQ A;  3D5S A;  3HXE B;  4ZRP A;  5JPM B;  3PYA A;  1JCR B;  4BOK A;  1G9G A;  1XWT A;  4GTT B;  1LTX B;  3PMM A;  1JCQ B;  3EU8 A;  1H3C A;  1N4R B;  4L0G A;  1GXM A;  2FV1 A;  1TNY B;  1H36 A;  3WKG A;  2D5J A;  2RGK A;  5FO9 B;  1KZO B;  1FCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...