5MEHA

Crystal structure of alpha-1,2-mannosidase from caulobacter k31 strain in complex with 1-deoxymannojirimycin
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
438
structure length
438
Chain Sequence
ASETTPEDWKALAADVRSEFQWAWQGYVAKAWGKDEINPVSGTSRSFFIEGHDLGLSLVEALDTLWIMGLDAEFQAGVDWVKANLSFDVDGNAQVFETNIRLVGGLLSAHLASGDPVLLAKARDLADRLAKAFEASPHGLPWRYVNLRTGAVSDPETNLAEIGTYLSEFGVLSQLTGERKYFDMAKRAMRHTLDRRSKIGLMAANIHAMTGAFTSRNASIDVYADSFYEYLWDAWALFGDEDCKRWAVECVDAQLAHQAKRYDGRLWFPMVDFETGAVTGTAQSELAAYYAGLLGQVGRKAQGDDYLASFTYLQATFGVIPESIDVTTGQPRRKHTGLRPEYPDACLNLWLIDRDPRYRRLAAIHYREMKATSRAAFGYTALKDITTRPMTQDDNCPGYWWSEQMKYYYLLFSDTPRIDYGQLQLSTEANVLRGFRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Mannosyl-oligosaccharide 1,2-alpha-mannosidase
publication title Conformational Behaviour of Azasugars Based on Mannuronic Acid.
pubmed doi rcsb
source organism Caulobacter sp.
total genus 181
structure length 438
sequence length 438
ec nomenclature ec 3.2.1.113: Mannosyl-oligosaccharide 1,2-alpha-mannosidase.
pdb deposition date 2016-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5mehA00
2AFAA 1FAEA 3RX8A 1GA2A 1XWTA 3QXFA 3W7TA 4ZG8A 3QG0A 1H14A 1G9GA 4WVAA 1KFGA 2DRQA 3ACSA 2D8LA 2FV0A 2DRSA 1G6IA 2CQSA 4TF4A 3TF4A 1KSCA 1KSDA 3QFYA 4KTRA 2F6DA 3RX5A 1LF6A 1KKTA 1FBWA 3W5MA 2WYNA 1F9OA 4Q88A 3WC3A 1FO2A 4FUSA 2EAEA 2B4FA 5CA3A 1WU6A 3ANJA 3S4BA 2JG0A 2RI8A 2QNOA 1LF9A 1H13A 1IA7A 2JF4A 3RENA 3WKFA 1NXCA 3A3VA 4AYQA 3W7SA 2P0VA 1KREA 1RQ5A 5E2JA 3RX7A 3VXDA 5CZLA 3QFZA 3AFJA 1XW2A 4CE7A 1G87A 1L2AA 3W5NA 2JJBA 3WIWA 4ZH5A 2EACA 4Q2BA 3RSYA 3PMMA 3S4CA 3X17A 3W7WA 3ACTA 3QSPA 1X9DA 3QWTA 2GH4A 1FMIA 3K11A 2AHFA 1AGMA 1JS4A 1V7XA 3WKIA 1IS9A 2XFGA 3QT9A 3W7XA 1WU4A 1XWQA 2EADA 3WUXA 4XUVA 2GZ6A 1V5DA 2AHGA 3ANIA 2DROA 2OKXA 2CQTA 4JJJA 3GZKA 3QRYA 4L6XA 3QT3A 4Z4LA 5M7IA 4KTPA 2A8ZA 4AYPA 3ON6A 2ZZRA 3RRSA 2FV1A 3P2CA 5KKBA 3CIHA 3EZ8A 2DRRA 4DODA 5GW7A 4DOEA 4WVCA 1V7VA 1GLMA 2RI9A 2RGKA 1CEMA 1IA6A 1F9DA 2YIKA 3T33A 1DL2A 5M7YA 3WIQA 4J5TA 3E6UA 4L0GA 5GY3A 4TXTA 4CJ0A 2VN4A 5MEHA 1KRFA 3QDEA 3QXQA 2FBAA 2ZBLA 1TF4A 4WU0A 5DGRA 4EL8A 3GT5A 2NVPA 3VW5A 2FUZA 2D5JA 3W7UA 3WIRA 3H2WA 1H12A 3S4DA 1FCEA 4CJ1A 1ULVA 1KS8A 1WZZA 4AYOA 1FP3A 3S4AA 3H3KA 2EABA 1AYXA 3WKHA 3ANKA 3QPFA 1CLCA 1UG9A 1NC5A 1GAIA 4Z4JA 1FO3A 4AYRA 1FBOA 1HCUA 2Z07A 3E73A 1G9JA 5CD2A 5DGQA 1K72A 3D3IA 1V5CA 1VD5A 3GLYA 1DOGA 3H7LA 3WKGA 1GAHA 3EQAA 1H54A 1V7WA 2VN7A 4WVBA 1L1YA 1KWFA 1UT9A 1WU5A
chains in the Genus database with same CATH superfamily
3RX8A 5ILKA 4ZG8A 5DHIA 4F10A 3ACSA 3E32B 2FV0A 4D4DA 3TF4A 1KSCA 4V1SA 1GHQA 4KTRA 1N4PB 1LF6A 1JCRB 3KSQB 4Q88A 3WC3A 1FO2A 2V8KA 4FUSA 5ILHA 4ONTA 1WU6A 3A0OA 3OXUA 1N4QB 1LF9A 1H13A 2JF4A 3WKFA 2WDAA 4AYQA 3W7SA 5IM1A 3M7BA 1N23A 5AGDA 3QFZA 1JCSB 3PYBA 4ZH5A 2EACA 1J0MA 1O1RB 3HXEB 3M71A 3SAEA 2H6GB 2ONGA 3K7XA 3QWTA 1LD8B 2AHFA 3P5PA 3M74A 4D4AA 3QT9A 1R76A 3N0GA 3DRAB 1TN7B 2WY8A 3QRYA 3HXDB 5FO8B 5JPNB 2B39A 2J5CA 4GTOB 1GLMA 1O5MB 3SDVA 1I8QA 3CU7A 3M01A 5ILJA 1HXGA 4MMHA 1TNOB 1TN6B 1KZPB 3SDQA 4D4CA 4L0GA 1CB8A 3M73A 1C82A 4LNBB 4CJ0A 2V3NA 4V1RA 5MEHA 1HZFA 1O1SB 4WU0A 1N94B 1RWAA 1FPPB 1RWGA 3G4FA 4LNGB 2D5JA 3W7UA 1ULVA 1KS8A 1W6JA 5ILIA 1GXOA 1RW9A 2H6FB 3H3KA 3WKHA 3LZ9A 4DI5A 3M78A 1VD5A 1DOGA 1GAHA 1H54A 1O6RA 1GSZA 1V7WA 3Q78B 1X1JA 3N0FA 1GA2A 1XWTA 1LXKA 3QXFA 3QG0A 1H14A 1G9GA 1NI1B 3Q7AB 1KFGA 2DRQA 1C3DA 1F1SA 3SDTA 4KKIA 2H6HB 1H37A 1D8DB 2D8LA 2DRSA 3DSXB 4MBGB 1G6IA 2SQCA 1GXNA 4YCRA 4OZVA 1KKTA 1FBWA 3W5MA 5ILDA 4RNQA 2WYNA 2V8JA 1F9OA 2EAEA 5IK6A 3S4BA 3ANJA 3D5SA 1OJPA 2JG0A 5DHKA 2RI8A 4OZWA 1IA7A 3KQ4A 3RENA 1NXCA 4ZRPA 2BRPA 5E2JA 3RX7A 1N24A 1XW2A 4CE7A 3W5NA 2JJBA 1TNUB 4Q2BA 3RSYA 3X17A 2PMVA 3W7WA 2GOXA 1TNBB 4OK4A 1N7PA 3PYAA 3PZ1B 1RWHA 3M77A 3VSNA 1X9DA 4FXKB 3W7XA 5IKHA 1WU4A 3WUXA 1N4RB 3KLSA 2X03A 1TNZB 1SA4B 2OKXA 3DSUB 4MU9A 1GXMA 4JJJA 3SFYB 2WINB 4Z4LA 4KTPA 2ZZRA 1J0NA 1OJMA 3EZ8A 3G6JB 5JMFA 4DOEA 5JMDA 1O1TB 5IL8A 1CEMA 1HXCA 2YIKA 4GTSB 1QQFA 5M7YA 2XWJB 3WIQA 2BB5A 3D5RA 3E37B 3E6UA 4D4BA 1H39A 1KRFA 1HN0A 3M02A 4EL8A 1LD7B 3VW5A 4LIXA 1H12A 3NFVA 3S4DA 3E7JA 1F9GA 1FP3A 2NOJA 4AYOA 1HM3A 2EABA 3QPFA 2G02A 3E73A 2A73B 1K72A 3D3IA 3GLYA 3H7LA 3RJ3A 1KWFA 3HXFB 1UT9A 1SA5B 3DSWB 1WU5A 2AFAA 1FAEA 3PZ4B 1N7QA 5IK0A 3M7LA 2WIIB 1HV6A 2PN5A 1QAZA 2XQWA 4L9PB 3E34B 4FXGB 4FJQA 4F13A 2E22A 3QFYA 5IKAA 1HM2A 4YDEB 2FUTA 4GTRB 4M76A 1X81B 2BRVX 2WY7A 1MZCB 3E80A 5JPMB 4OJZA 1N21A 2F0YB 3A3VA 3Q79B 1KREA 1RQ5A 1LXMA 5CZLA 1L2AA 3WIWA 1TNYB 3PMMA 1S64B 3AFLA 3ACTA 3Q75B 5ILZA 2GH4A 2V8IA 3S9VA 1FMIA 1JS4A 2XFGA 2EADA 5C05A 1H3CA 2BEDB 5FO9B 2GZ6A 2I07B 2CQTA 1JCQB 2WCOA 3GZKA 1RWCA 3EUVB 1O6HA 3DSVB 1N1ZA 5KKBA 4DODA 4WVCA 1V7VA 1IA6A 3P5RA 4QT9A 1H36A 4GTTB 3PZ2B 5GZKA 2FUQA 2H6IB 4TXTA 4GL3A 2E24A 3QXQA 1H3AA 2FBAA 2ZBLA 5DGRA 1X1HA 3H2WA 1D8EB 4CJ1A 1H3BA 2BRWA 3M00A 1X1IA 3PZ3B 1UG9A 1GAIA 4Z4JA 1FO3A 1G9JA 1V5CA 3HXCB 3DSSB 3M76A 5IK9A 2VN7A 4GAXA 4WVBA 1L1YA 2V3PA 4GTMB 4EHMB 3SQCA 1N7OA 3Q7FB 3W7TA 1N1BA 5EATA 4WVAA 1N4SB 1O79A 1KZOB 2CQSA 4GTVB 4TF4A 4YDOB 1KSDA 2F6DA 3RX5A 5FOBB 3VSMA 4D94A 2XWBB 1FT2B 2B4FA 5CA3A 5EASA 4E1YA 1HX9A 1RWFA 1H35A 2QNOA 3SDRA 3E33B 4NEIA 1HMWA 1DCEB 3NNBA 1N95B 2P0VA 3VXDA 3AFJA 1G87A 3SFXB 3S4CA 1QBQB 1O6QA 3M72A 3QSPA 3OEDA 3C72B 3SDUA 1UMPA 3M7CA 1FT1B 3K11A 1N22A 1AGMA 1V7XA 3WKIA 1IS9A 4KKJA 1XWQA 1LTXB 4XUVA 4ZH1A 5EAUA 3DSTB 3ANIA 1V5DA 2AHGA 1N7RA 4FNVA 1HMUA 2IEJB 2DROA 2ZIRB 1SQCA 4L6XA 3QT3A 5M7IA 2A8ZA 4AYPA 2ZISB 4GTPB 3ON6A 3RRSA 4BOKA 2FV1A 3P2CA 3CIHA 2DRRA 2G0DA 1S63B 5FO7B 5GW7A 1N7NA 2RI9A 1W6KA 2RGKA 3KSLB 1W3YA 1F9DA 3T33A 4MMIA 1DL2A 3G4DA 3EU8A 4J5TA 1QSJA 4ZRQA 1TN8B 1OJNA 5GY3A 2VN4A 3QDEA 1TF4A 2Q1FA 3GT5A 3EU5B 2NVPA 2FUZA 3DPYB 1N20A 3WIRA 1EGUA 4LNVA 3E30B 1FCEA 1WZZA 2BBCA 4C1SA 1NL4B 3S4AA 2BB6A 1OJOA 2R2LB 1AYXA 3ANKA 1CLCA 1HXAA 1LOHA 1NC5A 4AYRA 1FBOA 1HCUA 2Z07A 3Q73B 5CD2A 5DGQA 3M75A 4OK2A 4BOJA 3M7EA 2ONHA 5IL3A 3WKGA 3EQAA 4GTQB 5ILYA 1N9AB 3HXBB
chains in the Genus database with same CATH topology
3RX8A 4ZG8A 3ACSA 3E32B 2FV0A 4D4DA 3TF4A 1KSCA 4V1SA 1GHQA 4KTRA 1N4PB 1LF6A 1JCRB 3KSQB 4Q88A 3WC3A 1FO2A 2V8KA 4FUSA 4ONTA 1WU6A 3OXUA 1N4QB 1LF9A 1H13A 2JF4A 3WKFA 4AYQA 3W7SA 3M7BA 5AGDA 3QFZA 1JCSB 3PYBA 4ZH5A 2EACA 1O1RB 3HXEB 3M71A 3SAEA 2H6GB 3K7XA 3QWTA 1LD8B 2AHFA 3P5PA 3M74A 4D4AA 3QT9A 1R76A 3DRAB 1TN7B 2WY8A 3QRYA 3HXDB 5FO8B 5JPNB 2B39A 4GTOB 1GLMA 1O5MB 3SDVA 3CU7A 1TNOB 1TN6B 1KZPB 3SDQA 4D4CA 4L0GA 3M73A 4LNBB 4CJ0A 2V3NA 4V1RA 5MEHA 1HZFA 1O1SB 4WU0A 1N94B 1FPPB 4LNGB 2D5JA 3W7UA 1ULVA 1KS8A 1W6JA 1GXOA 2H6FB 3H3KA 3WKHA 3M78A 1VD5A 1DOGA 1GAHA 1H54A 1O6RA 1GSZA 1V7WA 3Q78B 1GA2A 1XWTA 3QXFA 3QG0A 1H14A 1G9GA 1NI1B 3Q7AB 1KFGA 2DRQA 1C3DA 3SDTA 4KKIA 2H6HB 1H37A 1D8DB 2D8LA 2DRSA 3DSXB 4MBGB 1G6IA 2SQCA 1GXNA 4YCRA 1KKTA 1FBWA 3W5MA 2WYNA 2V8JA 1F9OA 2EAEA 3S4BA 3ANJA 3D5SA 2JG0A 2RI8A 1IA7A 3KQ4A 3RENA 1NXCA 4ZRPA 5E2JA 3RX7A 1XW2A 4CE7A 3W5NA 2JJBA 1TNUB 4Q2BA 3RSYA 3X17A 2PMVA 3W7WA 2GOXA 1TNBB 3PYAA 3PZ1B 3M77A 1X9DA 4FXKB 3W7XA 1WU4A 3WUXA 1N4RB 3KLSA 1TNZB 1SA4B 2OKXA 3DSUB 4MU9A 1GXMA 4JJJA 3SFYB 2WINB 4Z4LA 4KTPA 2ZZRA 3EZ8A 3G6JB 4DOEA 1O1TB 1CEMA 2YIKA 4GTSB 1QQFA 5M7YA 2XWJB 3WIQA 2BB5A 3D5RA 3E37B 3E6UA 4D4BA 1H39A 1KRFA 4EL8A 1LD7B 3VW5A 4LIXA 1H12A 3S4DA 4AYOA 1FP3A 2NOJA 2EABA 3QPFA 2G02A 3E73A 2A73B 1K72A 3D3IA 3GLYA 3H7LA 3RJ3A 1KWFA 3HXFB 1UT9A 1SA5B 3DSWB 1WU5A 2AFAA 1FAEA 3PZ4B 3M7LA 2WIIB 2PN5A 2XQWA 4L9PB 3E34B 4FXGB 3QFYA 4YDEB 4GTRB 4M76A 1X81B 2WY7A 1MZCB 5JPMB 2F0YB 3A3VA 3Q79B 1KREA 1RQ5A 5CZLA 1L2AA 3WIWA 1TNYB 3PMMA 1S64B 3ACTA 3Q75B 2GH4A 2V8IA 3S9VA 1FMIA 1JS4A 2XFGA 2EADA 1H3CA 2BEDB 5FO9B 2GZ6A 2I07B 2CQTA 1JCQB 3GZKA 3EUVB 1O6HA 3DSVB 5KKBA 4DODA 4WVCA 1V7VA 1IA6A 3P5RA 4QT9A 1H36A 4GTTB 3PZ2B 5GZKA 2H6IB 4TXTA 4GL3A 3QXQA 1H3AA 2FBAA 2ZBLA 5DGRA 3H2WA 1D8EB 4CJ1A 1H3BA 3PZ3B 1UG9A 1GAIA 4Z4JA 1FO3A 1G9JA 1V5CA 3HXCB 3DSSB 3M76A 2VN7A 4WVBA 1L1YA 2V3PA 4GTMB 4EHMB 3SQCA 3Q7FB 3W7TA 4WVAA 1N4SB 1O79A 1KZOB 2CQSA 4GTVB 4TF4A 4YDOB 1KSDA 2F6DA 3RX5A 5FOBB 4D94A 2XWBB 1FT2B 2B4FA 5CA3A 1H35A 2QNOA 3SDRA 3E33B 1DCEB 1N95B 2P0VA 3VXDA 3AFJA 1G87A 3SFXB 3S4CA 1QBQB 1O6QA 3M72A 3QSPA 3OEDA 3C72B 3SDUA 1UMPA 3M7CA 1FT1B 3K11A 1AGMA 1V7XA 3WKIA 1IS9A 4KKJA 1XWQA 1LTXB 4XUVA 4ZH1A 3DSTB 3ANIA 1V5DA 2AHGA 2ZIRB 2IEJB 2DROA 1SQCA 4L6XA 3QT3A 5M7IA 2A8ZA 4AYPA 2ZISB 4GTPB 3ON6A 3RRSA 4BOKA 2FV1A 3P2CA 3CIHA 2DRRA 2G0DA 1S63B 5FO7B 5GW7A 2RI9A 1W6KA 2RGKA 3KSLB 1F9DA 3T33A 1DL2A 3EU8A 4J5TA 1QSJA 4ZRQA 1TN8B 5GY3A 2VN4A 3QDEA 1TF4A 3GT5A 3EU5B 2NVPA 2FUZA 3DPYB 3WIRA 4LNVA 3E30B 1FCEA 1WZZA 2BBCA 4C1SA 1NL4B 3S4AA 2BB6A 2R2LB 1AYXA 3ANKA 1CLCA 1NC5A 4AYRA 1FBOA 1HCUA 2Z07A 3Q73B 5CD2A 5DGQA 3M75A 4BOJA 3M7EA 3WKGA 3EQAA 4GTQB 1N9AB 3HXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFA A;  1FAE A;  3RX8 A;  1GA2 A;  1XWT A;  3QXF A;  3W7T A;  4ZG8 A;  3QG0 A;  1H14 A;  1G9G A;  4WVA A;  1KFG A;  2DRQ A;  3ACS A;  2D8L A;  2FV0 A;  2DRS A;  1G6I A;  2CQS A;  4TF4 A;  3TF4 A;  1KSC A;  1KSD A;  3QFY A;  4KTR A;  2F6D A;  3RX5 A;  1LF6 A;  1KKT A;  1FBW A;  3W5M A;  2WYN A;  1F9O A;  4Q88 A;  3WC3 A;  1FO2 A;  4FUS A;  2EAE A;  2B4F A;  5CA3 A;  1WU6 A;  3ANJ A;  3S4B A;  2JG0 A;  2RI8 A;  2QNO A;  1LF9 A;  1H13 A;  1IA7 A;  2JF4 A;  3REN A;  3WKF A;  1NXC A;  3A3V A;  4AYQ A;  3W7S A;  2P0V A;  1KRE A;  1RQ5 A;  5E2J A;  3RX7 A;  3VXD A;  5CZL A;  3QFZ A;  3AFJ A;  1XW2 A;  4CE7 A;  1G87 A;  1L2A A;  3W5N A;  2JJB A;  3WIW A;  4ZH5 A;  2EAC A;  4Q2B A;  3RSY A;  3PMM A;  3S4C A;  3X17 A;  3W7W A;  3ACT A;  3QSP A;  1X9D A;  3QWT A;  2GH4 A;  1FMI A;  3K11 A;  2AHF A;  1AGM A;  1JS4 A;  1V7X A;  3WKI A;  1IS9 A;  2XFG A;  3QT9 A;  3W7X A;  1WU4 A;  1XWQ A;  2EAD A;  3WUX A;  4XUV A;  2GZ6 A;  1V5D A;  2AHG A;  3ANI A;  2DRO A;  2OKX A;  2CQT A;  4JJJ A;  3GZK A;  3QRY A;  4L6X A;  3QT3 A;  4Z4L A;  5M7I A;  4KTP A;  2A8Z A;  4AYP A;  3ON6 A;  2ZZR A;  3RRS A;  2FV1 A;  3P2C A;  5KKB A;  3CIH A;  3EZ8 A;  2DRR A;  4DOD A;  5GW7 A;  4DOE A;  4WVC A;  1V7V A;  1GLM A;  2RI9 A;  2RGK A;  1CEM A;  1IA6 A;  1F9D A;  2YIK A;  3T33 A;  1DL2 A;  5M7Y A;  3WIQ A;  4J5T A;  3E6U A;  4L0G A;  5GY3 A;  4TXT A;  4CJ0 A;  2VN4 A;  5MEH A;  1KRF A;  3QDE A;  3QXQ A;  2FBA A;  2ZBL A;  1TF4 A;  4WU0 A;  5DGR A;  4EL8 A;  3GT5 A;  2NVP A;  3VW5 A;  2FUZ A;  2D5J A;  3W7U A;  3WIR A;  3H2W A;  1H12 A;  3S4D A;  1FCE A;  4CJ1 A;  1ULV A;  1KS8 A;  1WZZ A;  4AYO A;  1FP3 A;  3S4A A;  3H3K A;  2EAB A;  1AYX A;  3WKH A;  3ANK A;  3QPF A;  1CLC A;  1UG9 A;  1NC5 A;  1GAI A;  4Z4J A;  1FO3 A;  4AYR A;  1FBO A;  1HCU A;  2Z07 A;  3E73 A;  1G9J A;  5CD2 A;  5DGQ A;  1K72 A;  3D3I A;  1V5C A;  1VD5 A;  3GLY A;  1DOG A;  3H7L A;  3WKG A;  1GAH A;  3EQA A;  1H54 A;  1V7W A;  2VN7 A;  4WVB A;  1L1Y A;  1KWF A;  1UT9 A;  1WU5 A; 
#chains in the Genus database with same CATH topology
 3RX8 A;  5ILK A;  4ZG8 A;  5DHI A;  4F10 A;  3ACS A;  3E32 B;  2FV0 A;  4D4D A;  3TF4 A;  1KSC A;  4V1S A;  1GHQ A;  4KTR A;  1N4P B;  1LF6 A;  1JCR B;  3KSQ B;  4Q88 A;  3WC3 A;  1FO2 A;  2V8K A;  4FUS A;  5ILH A;  4ONT A;  1WU6 A;  3A0O A;  3OXU A;  1N4Q B;  1LF9 A;  1H13 A;  2JF4 A;  3WKF A;  2WDA A;  4AYQ A;  3W7S A;  5IM1 A;  3M7B A;  1N23 A;  5AGD A;  3QFZ A;  1JCS B;  3PYB A;  4ZH5 A;  2EAC A;  1J0M A;  1O1R B;  3HXE B;  3M71 A;  3SAE A;  2H6G B;  2ONG A;  3K7X A;  3QWT A;  1LD8 B;  2AHF A;  3P5P A;  3M74 A;  4D4A A;  3QT9 A;  1R76 A;  3N0G A;  3DRA B;  1TN7 B;  2WY8 A;  3QRY A;  3HXD B;  5FO8 B;  5JPN B;  2B39 A;  2J5C A;  4GTO B;  1GLM A;  1O5M B;  3SDV A;  1I8Q A;  3CU7 A;  3M01 A;  5ILJ A;  1HXG A;  4MMH A;  1TNO B;  1TN6 B;  1KZP B;  3SDQ A;  4D4C A;  4L0G A;  1CB8 A;  3M73 A;  1C82 A;  4LNB B;  4CJ0 A;  2V3N A;  4V1R A;  5MEH A;  1HZF A;  1O1S B;  4WU0 A;  1N94 B;  1RWA A;  1FPP B;  1RWG A;  3G4F A;  4LNG B;  2D5J A;  3W7U A;  1ULV A;  1KS8 A;  1W6J A;  5ILI A;  1GXO A;  1RW9 A;  2H6F B;  3H3K A;  3WKH A;  3LZ9 A;  4DI5 A;  3M78 A;  1VD5 A;  1DOG A;  1GAH A;  1H54 A;  1O6R A;  1GSZ A;  1V7W A;  3Q78 B;  1X1J A;  3N0F A;  1GA2 A;  1XWT A;  1LXK A;  3QXF A;  3QG0 A;  1H14 A;  1G9G A;  1NI1 B;  3Q7A B;  1KFG A;  2DRQ A;  1C3D A;  1F1S A;  3SDT A;  4KKI A;  2H6H B;  1H37 A;  1D8D B;  2D8L A;  2DRS A;  3DSX B;  4MBG B;  1G6I A;  2SQC A;  1GXN A;  4YCR A;  4OZV A;  1KKT A;  1FBW A;  3W5M A;  5ILD A;  4RNQ A;  2WYN A;  2V8J A;  1F9O A;  2EAE A;  5IK6 A;  3S4B A;  3ANJ A;  3D5S A;  1OJP A;  2JG0 A;  5DHK A;  2RI8 A;  4OZW A;  1IA7 A;  3KQ4 A;  3REN A;  1NXC A;  4ZRP A;  2BRP A;  5E2J A;  3RX7 A;  1N24 A;  1XW2 A;  4CE7 A;  3W5N A;  2JJB A;  1TNU B;  4Q2B A;  3RSY A;  3X17 A;  2PMV A;  3W7W A;  2GOX A;  1TNB B;  4OK4 A;  1N7P A;  3PYA A;  3PZ1 B;  1RWH A;  3M77 A;  3VSN A;  1X9D A;  4FXK B;  3W7X A;  5IKH A;  1WU4 A;  3WUX A;  1N4R B;  3KLS A;  2X03 A;  1TNZ B;  1SA4 B;  2OKX A;  3DSU B;  4MU9 A;  1GXM A;  4JJJ A;  3SFY B;  2WIN B;  4Z4L A;  4KTP A;  2ZZR A;  1J0N A;  1OJM A;  3EZ8 A;  3G6J B;  5JMF A;  4DOE A;  5JMD A;  1O1T B;  5IL8 A;  1CEM A;  1HXC A;  2YIK A;  4GTS B;  1QQF A;  5M7Y A;  2XWJ B;  3WIQ A;  2BB5 A;  3D5R A;  3E37 B;  3E6U A;  4D4B A;  1H39 A;  1KRF A;  1HN0 A;  3M02 A;  4EL8 A;  1LD7 B;  3VW5 A;  4LIX A;  1H12 A;  3NFV A;  3S4D A;  3E7J A;  1F9G A;  1FP3 A;  2NOJ A;  4AYO A;  1HM3 A;  2EAB A;  3QPF A;  2G02 A;  3E73 A;  2A73 B;  1K72 A;  3D3I A;  3GLY A;  3H7L A;  3RJ3 A;  1KWF A;  3HXF B;  1UT9 A;  1SA5 B;  3DSW B;  1WU5 A;  2AFA A;  1FAE A;  3PZ4 B;  1N7Q A;  5IK0 A;  3M7L A;  2WII B;  1HV6 A;  2PN5 A;  1QAZ A;  2XQW A;  4L9P B;  3E34 B;  4FXG B;  4FJQ A;  4F13 A;  2E22 A;  3QFY A;  5IKA A;  1HM2 A;  4YDE B;  2FUT A;  4GTR B;  4M76 A;  1X81 B;  2BRV X;  2WY7 A;  1MZC B;  3E80 A;  5JPM B;  4OJZ A;  1N21 A;  2F0Y B;  3A3V A;  3Q79 B;  1KRE A;  1RQ5 A;  1LXM A;  5CZL A;  1L2A A;  3WIW A;  1TNY B;  3PMM A;  1S64 B;  3AFL A;  3ACT A;  3Q75 B;  5ILZ A;  2GH4 A;  2V8I A;  3S9V A;  1FMI A;  1JS4 A;  2XFG A;  2EAD A;  5C05 A;  1H3C A;  2BED B;  5FO9 B;  2GZ6 A;  2I07 B;  2CQT A;  1JCQ B;  2WCO A;  3GZK A;  1RWC A;  3EUV B;  1O6H A;  3DSV B;  1N1Z A;  5KKB A;  4DOD A;  4WVC A;  1V7V A;  1IA6 A;  3P5R A;  4QT9 A;  1H36 A;  4GTT B;  3PZ2 B;  5GZK A;  2FUQ A;  2H6I B;  4TXT A;  4GL3 A;  2E24 A;  3QXQ A;  1H3A A;  2FBA A;  2ZBL A;  5DGR A;  1X1H A;  3H2W A;  1D8E B;  4CJ1 A;  1H3B A;  2BRW A;  3M00 A;  1X1I A;  3PZ3 B;  1UG9 A;  1GAI A;  4Z4J A;  1FO3 A;  1G9J A;  1V5C A;  3HXC B;  3DSS B;  3M76 A;  5IK9 A;  2VN7 A;  4GAX A;  4WVB A;  1L1Y A;  2V3P A;  4GTM B;  4EHM B;  3SQC A;  1N7O A;  3Q7F B;  3W7T A;  1N1B A;  5EAT A;  4WVA A;  1N4S B;  1O79 A;  1KZO B;  2CQS A;  4GTV B;  4TF4 A;  4YDO B;  1KSD A;  2F6D A;  3RX5 A;  5FOB B;  3VSM A;  4D94 A;  2XWB B;  1FT2 B;  2B4F A;  5CA3 A;  5EAS A;  4E1Y A;  1HX9 A;  1RWF A;  1H35 A;  2QNO A;  3SDR A;  3E33 B;  4NEI A;  1HMW A;  1DCE B;  3NNB A;  1N95 B;  2P0V A;  3VXD A;  3AFJ A;  1G87 A;  3SFX B;  3S4C A;  1QBQ B;  1O6Q A;  3M72 A;  3QSP A;  3OED A;  3C72 B;  3SDU A;  1UMP A;  3M7C A;  1FT1 B;  3K11 A;  1N22 A;  1AGM A;  1V7X A;  3WKI A;  1IS9 A;  4KKJ A;  1XWQ A;  1LTX B;  4XUV A;  4ZH1 A;  5EAU A;  3DST B;  3ANI A;  1V5D A;  2AHG A;  1N7R A;  4FNV A;  1HMU A;  2IEJ B;  2DRO A;  2ZIR B;  1SQC A;  4L6X A;  3QT3 A;  5M7I A;  2A8Z A;  4AYP A;  2ZIS B;  4GTP B;  3ON6 A;  3RRS A;  4BOK A;  2FV1 A;  3P2C A;  3CIH A;  2DRR A;  2G0D A;  1S63 B;  5FO7 B;  5GW7 A;  1N7N A;  2RI9 A;  1W6K A;  2RGK A;  3KSL B;  1W3Y A;  1F9D A;  3T33 A;  4MMI A;  1DL2 A;  3G4D A;  3EU8 A;  4J5T A;  1QSJ A;  4ZRQ A;  1TN8 B;  1OJN A;  5GY3 A;  2VN4 A;  3QDE A;  1TF4 A;  2Q1F A;  3GT5 A;  3EU5 B;  2NVP A;  2FUZ A;  3DPY B;  1N20 A;  3WIR A;  1EGU A;  4LNV A;  3E30 B;  1FCE A;  1WZZ A;  2BBC A;  4C1S A;  1NL4 B;  3S4A A;  2BB6 A;  1OJO A;  2R2L B;  1AYX A;  3ANK A;  1CLC A;  1HXA A;  1LOH A;  1NC5 A;  4AYR A;  1FBO A;  1HCU A;  2Z07 A;  3Q73 B;  5CD2 A;  5DGQ A;  3M75 A;  4OK2 A;  4BOJ A;  3M7E A;  2ONH A;  5IL3 A;  3WKG A;  3EQA A;  4GTQ B;  5ILY A;  1N9A B;  3HXB B; 
#chains in the Genus database with same CATH homology
 3RX8 A;  4ZG8 A;  3ACS A;  3E32 B;  2FV0 A;  4D4D A;  3TF4 A;  1KSC A;  4V1S A;  1GHQ A;  4KTR A;  1N4P B;  1LF6 A;  1JCR B;  3KSQ B;  4Q88 A;  3WC3 A;  1FO2 A;  2V8K A;  4FUS A;  4ONT A;  1WU6 A;  3OXU A;  1N4Q B;  1LF9 A;  1H13 A;  2JF4 A;  3WKF A;  4AYQ A;  3W7S A;  3M7B A;  5AGD A;  3QFZ A;  1JCS B;  3PYB A;  4ZH5 A;  2EAC A;  1O1R B;  3HXE B;  3M71 A;  3SAE A;  2H6G B;  3K7X A;  3QWT A;  1LD8 B;  2AHF A;  3P5P A;  3M74 A;  4D4A A;  3QT9 A;  1R76 A;  3DRA B;  1TN7 B;  2WY8 A;  3QRY A;  3HXD B;  5FO8 B;  5JPN B;  2B39 A;  4GTO B;  1GLM A;  1O5M B;  3SDV A;  3CU7 A;  1TNO B;  1TN6 B;  1KZP B;  3SDQ A;  4D4C A;  4L0G A;  3M73 A;  4LNB B;  4CJ0 A;  2V3N A;  4V1R A;  5MEH A;  1HZF A;  1O1S B;  4WU0 A;  1N94 B;  1FPP B;  4LNG B;  2D5J A;  3W7U A;  1ULV A;  1KS8 A;  1W6J A;  1GXO A;  2H6F B;  3H3K A;  3WKH A;  3M78 A;  1VD5 A;  1DOG A;  1GAH A;  1H54 A;  1O6R A;  1GSZ A;  1V7W A;  3Q78 B;  1GA2 A;  1XWT A;  3QXF A;  3QG0 A;  1H14 A;  1G9G A;  1NI1 B;  3Q7A B;  1KFG A;  2DRQ A;  1C3D A;  3SDT A;  4KKI A;  2H6H B;  1H37 A;  1D8D B;  2D8L A;  2DRS A;  3DSX B;  4MBG B;  1G6I A;  2SQC A;  1GXN A;  4YCR A;  1KKT A;  1FBW A;  3W5M A;  2WYN A;  2V8J A;  1F9O A;  2EAE A;  3S4B A;  3ANJ A;  3D5S A;  2JG0 A;  2RI8 A;  1IA7 A;  3KQ4 A;  3REN A;  1NXC A;  4ZRP A;  5E2J A;  3RX7 A;  1XW2 A;  4CE7 A;  3W5N A;  2JJB A;  1TNU B;  4Q2B A;  3RSY A;  3X17 A;  2PMV A;  3W7W A;  2GOX A;  1TNB B;  3PYA A;  3PZ1 B;  3M77 A;  1X9D A;  4FXK B;  3W7X A;  1WU4 A;  3WUX A;  1N4R B;  3KLS A;  1TNZ B;  1SA4 B;  2OKX A;  3DSU B;  4MU9 A;  1GXM A;  4JJJ A;  3SFY B;  2WIN B;  4Z4L A;  4KTP A;  2ZZR A;  3EZ8 A;  3G6J B;  4DOE A;  1O1T B;  1CEM A;  2YIK A;  4GTS B;  1QQF A;  5M7Y A;  2XWJ B;  3WIQ A;  2BB5 A;  3D5R A;  3E37 B;  3E6U A;  4D4B A;  1H39 A;  1KRF A;  4EL8 A;  1LD7 B;  3VW5 A;  4LIX A;  1H12 A;  3S4D A;  4AYO A;  1FP3 A;  2NOJ A;  2EAB A;  3QPF A;  2G02 A;  3E73 A;  2A73 B;  1K72 A;  3D3I A;  3GLY A;  3H7L A;  3RJ3 A;  1KWF A;  3HXF B;  1UT9 A;  1SA5 B;  3DSW B;  1WU5 A;  2AFA A;  1FAE A;  3PZ4 B;  3M7L A;  2WII B;  2PN5 A;  2XQW A;  4L9P B;  3E34 B;  4FXG B;  3QFY A;  4YDE B;  4GTR B;  4M76 A;  1X81 B;  2WY7 A;  1MZC B;  5JPM B;  2F0Y B;  3A3V A;  3Q79 B;  1KRE A;  1RQ5 A;  5CZL A;  1L2A A;  3WIW A;  1TNY B;  3PMM A;  1S64 B;  3ACT A;  3Q75 B;  2GH4 A;  2V8I A;  3S9V A;  1FMI A;  1JS4 A;  2XFG A;  2EAD A;  1H3C A;  2BED B;  5FO9 B;  2GZ6 A;  2I07 B;  2CQT A;  1JCQ B;  3GZK A;  3EUV B;  1O6H A;  3DSV B;  5KKB A;  4DOD A;  4WVC A;  1V7V A;  1IA6 A;  3P5R A;  4QT9 A;  1H36 A;  4GTT B;  3PZ2 B;  5GZK A;  2H6I B;  4TXT A;  4GL3 A;  3QXQ A;  1H3A A;  2FBA A;  2ZBL A;  5DGR A;  3H2W A;  1D8E B;  4CJ1 A;  1H3B A;  3PZ3 B;  1UG9 A;  1GAI A;  4Z4J A;  1FO3 A;  1G9J A;  1V5C A;  3HXC B;  3DSS B;  3M76 A;  2VN7 A;  4WVB A;  1L1Y A;  2V3P A;  4GTM B;  4EHM B;  3SQC A;  3Q7F B;  3W7T A;  4WVA A;  1N4S B;  1O79 A;  1KZO B;  2CQS A;  4GTV B;  4TF4 A;  4YDO B;  1KSD A;  2F6D A;  3RX5 A;  5FOB B;  4D94 A;  2XWB B;  1FT2 B;  2B4F A;  5CA3 A;  1H35 A;  2QNO A;  3SDR A;  3E33 B;  1DCE B;  1N95 B;  2P0V A;  3VXD A;  3AFJ A;  1G87 A;  3SFX B;  3S4C A;  1QBQ B;  1O6Q A;  3M72 A;  3QSP A;  3OED A;  3C72 B;  3SDU A;  1UMP A;  3M7C A;  1FT1 B;  3K11 A;  1AGM A;  1V7X A;  3WKI A;  1IS9 A;  4KKJ A;  1XWQ A;  1LTX B;  4XUV A;  4ZH1 A;  3DST B;  3ANI A;  1V5D A;  2AHG A;  2ZIR B;  2IEJ B;  2DRO A;  1SQC A;  4L6X A;  3QT3 A;  5M7I A;  2A8Z A;  4AYP A;  2ZIS B;  4GTP B;  3ON6 A;  3RRS A;  4BOK A;  2FV1 A;  3P2C A;  3CIH A;  2DRR A;  2G0D A;  1S63 B;  5FO7 B;  5GW7 A;  2RI9 A;  1W6K A;  2RGK A;  3KSL B;  1F9D A;  3T33 A;  1DL2 A;  3EU8 A;  4J5T A;  1QSJ A;  4ZRQ A;  1TN8 B;  5GY3 A;  2VN4 A;  3QDE A;  1TF4 A;  3GT5 A;  3EU5 B;  2NVP A;  2FUZ A;  3DPY B;  3WIR A;  4LNV A;  3E30 B;  1FCE A;  1WZZ A;  2BBC A;  4C1S A;  1NL4 B;  3S4A A;  2BB6 A;  2R2L B;  1AYX A;  3ANK A;  1CLC A;  1NC5 A;  4AYR A;  1FBO A;  1HCU A;  2Z07 A;  3Q73 B;  5CD2 A;  5DGQ A;  3M75 A;  4BOJ A;  3M7E A;  3WKG A;  3EQA A;  4GTQ B;  1N9A B;  3HXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...