5MEHA

Crystal structure of alpha-1,2-mannosidase from caulobacter k31 strain in complex with 1-deoxymannojirimycin
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
438
structure length
438
Chain Sequence
ASETTPEDWKALAADVRSEFQWAWQGYVAKAWGKDEINPVSGTSRSFFIEGHDLGLSLVEALDTLWIMGLDAEFQAGVDWVKANLSFDVDGNAQVFETNIRLVGGLLSAHLASGDPVLLAKARDLADRLAKAFEASPHGLPWRYVNLRTGAVSDPETNLAEIGTYLSEFGVLSQLTGERKYFDMAKRAMRHTLDRRSKIGLMAANIHAMTGAFTSRNASIDVYADSFYEYLWDAWALFGDEDCKRWAVECVDAQLAHQAKRYDGRLWFPMVDFETGAVTGTAQSELAAYYAGLLGQVGRKAQGDDYLASFTYLQATFGVIPESIDVTTGQPRRKHTGLRPEYPDACLNLWLIDRDPRYRRLAAIHYREMKATSRAAFGYTALKDITTRPMTQDDNCPGYWWSEQMKYYYLLFSDTPRIDYGQLQLSTEANVLRGFRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mannosyl-oligosaccharide 1,2-alpha-mannosidase
publication title Conformational Behaviour of Azasugars Based on Mannuronic Acid.
pubmed doi rcsb
source organism Caulobacter sp.
molecule tags Hydrolase
total genus 181
structure length 438
sequence length 438
ec nomenclature ec 3.2.1.113: Mannosyl-oligosaccharide 1,2-alpha-mannosidase.
pdb deposition date 2016-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01532 Glyco_hydro_47 Glycosyl hydrolase family 47
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 5mehA00
2A8ZA 2EABA 3GLYA 1K72A 1L2AA 3QPFA 2AFAA 1GLMA 3TF4A 5CZLA 2DRQA 3WUXA 5CD2A 4FUSA 4TF4A 2FV1A 3W7TA 2DRRA 4L0GA 1FO3A 2VN4A 1G87A 1FCEA 3QDEA 1FP3A 1FAEA 2XFGA 2Z07A 3GZKA 3ANJA 1F9OA 1FBOA 3GT5A 2FUZA 2JG0A 1CEMA 1H54A 3T33A 2NVPA 1JS4A 1RQ5A 1H13A 2RI9A 2JJBA 4AYRA 4WVBA 4ZH5A 3W7WA 3CIHA 5M7YA 3QT3A 3RRSA 4EL8A 1KS8A 4KTRA 1L1YA 1TF4A 1V5DA 2GZ6A 3RX8A 3QXQA 3W7XA 4Q2BA 1KREA 4WVAA 3K11A 3QT9A 1G9GA 3E6UA 3ON6A 3VXDA 1LF6A 4TXTA 4WVCA 3H7LA 1G9JA 1FMIA 3QWTA 3S4BA 2B4FA 2YIKA 4CJ0A 5MEHA 1CLCA 4XUVA 1NXCA 2D5JA 2AHFA 4AYQA 2EACA 3H2WA 2RGKA 3WC3A 1KKTA 1G6IA 3S4AA 3WKHA 5E2JA 1GA2A 3S4CA 1WU6A 3WKGA 2EAEA 1F9DA 2ZZRA 4WU0A 4JJJA 2P0VA 3E73A 4ZG8A 4DODA 3WIWA 1VD5A 3P2CA 1X9DA 3ANIA 3X17A 5GW7A 1WZZA 3QG0A 3W5MA 3S4DA 2JF4A 1V5CA 3EQAA 5DGQA 1KSCA 1V7XA 1GAHA 1LF9A 4KTPA 2EADA 2VN7A 3PMMA 2DROA 3VW5A 1XW2A 3QRYA 3QXFA 3ACSA 1XWTA 2DRSA 3A3VA 1KSDA 1KWFA 3RX7A 1V7WA 1DL2A 2AHGA 4AYPA 3RSYA 2OKXA 4DOEA 1HCUA 1H12A 3EZ8A 4Z4JA 4CE7A 5DGRA 3W5NA 3RX5A 4L6XA 4Q88A 3ACTA 2D8LA 1AYXA 1NC5A 3QSPA 1WU4A 1KRFA 2CQSA 3WKFA 1AGMA 5KKBA 2FBAA 1FBWA 2CQTA 3WKIA 3RENA 3QFZA 5CA3A 3WIRA 3W7UA 2WYNA 1UG9A 1KFGA 1IA7A 2GH4A 2QNOA 5M7IA 3H3KA 1IS9A 3AFJA 1FO2A 2RI8A 1H14A 4AYOA 3W7SA 1WU5A 1UT9A 3WIQA 1IA6A 2ZBLA 1ULVA 1GAIA 3D3IA 2FV0A 4Z4LA 3QFYA 1V7VA 3ANKA 4J5TA 1XWQA 1DOGA 2F6DA 5GY3A 4CJ1A
chains in the Genus database with same CATH superfamily
2A8ZA 4KKIA 1L2AA 5IM1A 5CZLA 2DRQA 2FV1A 3W7TA 1FO3A 3PZ3B 2ZISB 2Z07A 4GTVB 3M00A 1F9OA 2GOXA 1H54A 3E32B 1HXGA 2J5CA 4ZRQA 2NVPA 3PZ1B 3DRAB 1N4PB 2ONGA 5JPMB 1D8DB 5FO8B 3W7WA 1N24A 2XWJB 3RRSA 4F13A 1W3YA 3Q7AB 1TF4A 3QXQA 1N4RB 2WIIB 1KREA 1QBQB 4FXGB 3DPYB 3K11A 2BB6A 4WVCA 2B4FA 4CJ0A 2BBCA 1O1TB 2EACA 1N4SB 1GXNA 4E1YA 3P5PA 3WKHA 1WU6A 1OJNA 1F9DA 4WU0A 3D5SA 4JJJA 4ZG8A 5EAUA 1JCRB 2BRPA 3Q75B 2XQWA 3P2CA 1X9DA 4BOKA 1N7OA 3ANIA 1N1BA 3W5MA 4LNGB 2BRVX 1V5CA 1V7XA 4KTPA 4FJQA 2IEJB 2VN7A 3DSSB 5DHKA 3VSMA 3VW5A 2R2LB 4FXKB 3SDQA 2SQCA 1XWTA 1KSDA 1KWFA 2AHGA 4AYPA 4DI5A 3EZ8A 4YCRA 2WCOA 3HXBB 5DGRA 3RX5A 1KZPB 1NC5A 2H6IB 1RWCA 5KKBA 5ILYA 4OZVA 3SQCA 4GTPB 3HXFB 1KFGA 2GH4A 3H3KA 1FO2A 2RI8A 3W7SA 1N7RA 1WU5A 1TNBB 2B39A 3D3IA 5EATA 2FV0A 1V7VA 1N21A 1O6RA 1DOGA 1OJMA 1XWQA 1N9AB 2F6DA 3KQ4A 4CE7A 3P5RA 4V1RA 2EABA 2E22A 4CJ1A 3VSNA 2I07B 2AFAA 3EUVB 4FUSA 1TNOB 1RWFA 3NFVA 5JPNB 4ONTA 3EU5B 3QDEA 2BRWA 1FAEA 1GHQA 3ANJA 5IK6A 3M74A 1FBOA 3GT5A 2FUQA 1CEMA 3T33A 1JCSB 3KSQB 4QT9A 1RQ5A 1H13A 2WINB 4WVBA 4ZRPA 5M7YA 3M77A 4GTMB 3D5RA 4EL8A 1O1SB 3RX8A 1GSZA 5JMFA 4GL3A 4WVAA 1H3BA 3QT9A 1G9GA 4TXTA 1G9JA 1C3DA 5ILIA 2YIKA 2V3PA 1CLCA 1NXCA 1HMUA 1HV6A 2AHFA 4AYQA 1HMWA 3SDTA 1QSJA 4M76A 2H6FB 1FPPB 3S4AA 4BOJA 3Q73B 1GA2A 3Q79B 5IL8A 1RWGA 5IK9A 4DODA 1J0MA 2H6HB 1KSCA 2EADA 3DSWB 1X1HA 2DROA 4D4BA 3QXFA 3QRYA 3ACSA 2DRSA 1I8QA 2F0YB 1V7WA 1DL2A 3RSYA 4OK2A 4DOEA 3PYAA 1H12A 1KZOB 2NOJA 1RWAA 3K7XA 5C05A 3W5NA 4D4CA 1QQFA 4L6XA 3C72B 3ACTA 2D8LA 3NNBA 3QSPA 4KKJA 1AGMA 2XWBB 4MMIA 2X03A 1RWHA 1SQCA 1FBWA 2PMVA 3M76A 5CA3A 2H6GB 1N1ZA 4LNBB 1N23A 5JMDA 4EHMB 1IS9A 2ZIRB 3M73A 3AFJA 4LIXA 2PN5A 1F1SA 3SFYB 3DSXB 2WY8A 2ZBLA 1LXMA 1S64B 3QFYA 4OK4A 1X81B 3M02A 1HM3A 4LNVA 3E80A 1K72A 1LOHA 1GLMA 1J0NA 3PZ4B 3KSLB 3WUXA 5CD2A 2E24A 5GZKA 4TF4A 2WDAA 4L0GA 3M7EA 1NI1B 3SDUA 1LTXB 1O6HA 1JCQB 2ONHA 3E33B 3EU8A 3M75A 3RJ3A 4C1SA 2V8KA 1S63B 2RI9A 1MZCB 1TNYB 4D4DA 3E37B 1D8EB 5DHIA 3SAEA 2Q1FA 3S9VA 2GZ6A 3W7XA 4Q2BA 2G0DA 1N95B 3SDRA 3ON6A 5ILJA 3VXDA 1TN7B 1LF6A 3H7LA 3QWTA 1FMIA 2V3NA 3Q7FB 5MEHA 1LD8B 4XUVA 1QAZA 5IKAA 2D5JA 4ZH1A 3KLSA 3PZ2B 4GTTB 3WC3A 1KKTA 3OXUA 1O79A 5E2JA 1GXOA 2EAEA 2ZZRA 3DSVB 4OJZA 1VD5A 3M72A 5GW7A 1WZZA 3QG0A 3EQAA 1TN8B 1LF9A 1GXMA 3PMMA 4YDOB 3G4DA 3RX7A 3DSUB 3M7CA 3G6JB 2BB5A 1OJOA 1RW9A 5EASA 1HX9A 5ILHA 1WU4A 1KRFA 1HZFA 3HXEB 2CQTA 3WKIA 3QFZA 1EGUA 2WYNA 3HXDB 3M01A 4GTQB 2G02A 5AGDA 1IA7A 5FOBB 1N7NA 3N0FA 1DCEB 2V8IA 1H14A 1UT9A 4GTRB 1O6QA 3AFLA 1ULVA 1GAIA 4NEIA 5IL3A 3ANKA 4J5TA 1W6KA 2V8JA 3GLYA 3QPFA 3TF4A 1H3AA 2DRRA 2VN4A 3SDVA 4MBGB 5IK0A 2WY7A 1G87A 1FCEA 1FP3A 1F9GA 2XFGA 3GZKA 4L9PB 1X1JA 4D94A 1H37A 1N4QB 4GTOB 2FUZA 2JG0A 5ILZA 3M7LA 3N0GA 1JS4A 3E7JA 1HN0A 3OEDA 4AYRA 2JJBA 1FT1B 3M71A 4ZH5A 3CIHA 3QT3A 4OZWA 1KS8A 4KTRA 1L1YA 1V5DA 1N94B 4D4AA 1C82A 1N7QA 1H36A 1HXCA 3E6UA 1TN6B 4V1SA 3S4BA 1N7PA 4GAXA 1H3CA 3SFXB 3CU7A 3G4FA 1N22A 3H2WA 4F10A 2RGKA 1FT2B 1LD7B 1G6IA 3S4CA 5IKHA 1CB8A 4YDEB 3WKGA 4MU9A 2BEDB 2P0VA 3E73A 5ILKA 3WIWA 3E30B 3X17A 1X1IA 1NL4B 3S4DA 2JF4A 5DGQA 1H35A 1GAHA 4RNQA 1H39A 1XW2A 3A3VA 3PYBA 1O1RB 5FO9B 2OKXA 1HCUA 4Z4JA 3Q78B 3A0OA 5FO7B 1TNUB 4Q88A 1UMPA 1AYXA 1SA4B 3LZ9A 2A73B 2CQSA 3M7BA 3WKFA 1SA5B 1HXAA 1N20A 1OJPA 2FBAA 3HXCB 1R76A 3E34B 3RENA 3DSTB 1HM2A 3WIRA 3W7UA 4MMHA 1UG9A 1W6JA 2QNOA 5M7IA 2FUTA 5ILDA 1TNZB 4AYOA 3M78A 4FNVA 4GTSB 3WIQA 1IA6A 1O5MB 4Z4LA 1LXKA 5GY3A
chains in the Genus database with same CATH topology
2A8ZA 4KKIA 1L2AA 5CZLA 2DRQA 2FV1A 3W7TA 1FO3A 3PZ3B 2ZISB 2Z07A 4GTVB 1F9OA 2GOXA 1H54A 3E32B 4ZRQA 2NVPA 3PZ1B 3DRAB 1N4PB 5JPMB 1D8DB 5FO8B 3W7WA 2XWJB 3RRSA 3Q7AB 1TF4A 3QXQA 1N4RB 2WIIB 1KREA 1QBQB 4FXGB 3DPYB 3K11A 2BB6A 4WVCA 2B4FA 4CJ0A 2BBCA 1O1TB 2EACA 1N4SB 1GXNA 3P5PA 3WKHA 1WU6A 1F9DA 4WU0A 3D5SA 4JJJA 4ZG8A 1JCRB 3Q75B 2XQWA 3P2CA 1X9DA 4BOKA 3ANIA 3W5MA 4LNGB 1V5CA 1V7XA 4KTPA 2IEJB 2VN7A 3DSSB 3VW5A 2R2LB 4FXKB 3SDQA 2SQCA 1XWTA 1KSDA 1KWFA 2AHGA 4AYPA 3EZ8A 4YCRA 3HXBB 5DGRA 3RX5A 1KZPB 1NC5A 2H6IB 5KKBA 3SQCA 4GTPB 3HXFB 1KFGA 2GH4A 3H3KA 1FO2A 2RI8A 3W7SA 1WU5A 1TNBB 2B39A 3D3IA 2FV0A 1V7VA 1O6RA 1DOGA 1XWQA 2F6DA 1N9AB 3KQ4A 4CE7A 3P5RA 4V1RA 2EABA 4CJ1A 2I07B 2AFAA 3EUVB 4FUSA 1TNOB 5JPNB 4ONTA 3EU5B 3QDEA 1FAEA 1GHQA 3ANJA 3M74A 1FBOA 3GT5A 1CEMA 3T33A 1JCSB 3KSQB 4QT9A 1RQ5A 1H13A 2WINB 4WVBA 4ZRPA 5M7YA 3M77A 4GTMB 3D5RA 4EL8A 1O1SB 3RX8A 1GSZA 4GL3A 4WVAA 1H3BA 3QT9A 1G9GA 4TXTA 1G9JA 1C3DA 2YIKA 2V3PA 1CLCA 1NXCA 2AHFA 4AYQA 3SDTA 1QSJA 4M76A 2H6FB 1FPPB 3S4AA 4BOJA 3Q73B 1GA2A 3Q79B 4DODA 2H6HB 1KSCA 2EADA 3DSWB 4D4BA 2DROA 3QXFA 3QRYA 3ACSA 2DRSA 2F0YB 1V7WA 1DL2A 3RSYA 4DOEA 3PYAA 1H12A 1KZOB 2NOJA 3K7XA 3W5NA 4D4CA 1QQFA 4L6XA 3C72B 3ACTA 2D8LA 3QSPA 4KKJA 1AGMA 2XWBB 2PMVA 1SQCA 1FBWA 3M76A 5CA3A 2H6GB 4LNBB 4EHMB 1IS9A 2ZIRB 3M73A 3AFJA 4LIXA 2PN5A 3SFYB 3DSXB 2WY8A 2ZBLA 1S64B 3QFYA 1X81B 4LNVA 1K72A 1GLMA 3PZ4B 3KSLB 3WUXA 5CD2A 5GZKA 4TF4A 4L0GA 3M7EA 1NI1B 3SDUA 1LTXB 1O6HA 1JCQB 3E33B 3EU8A 3M75A 3RJ3A 4C1SA 2V8KA 1S63B 2RI9A 1MZCB 1TNYB 4D4DA 3E37B 1D8EB 3SAEA 3S9VA 2GZ6A 3W7XA 4Q2BA 2G0DA 1N95B 3SDRA 3ON6A 1LF6A 3VXDA 1TN7B 3H7LA 3QWTA 1FMIA 2V3NA 3Q7FB 5MEHA 1LD8B 4XUVA 2D5JA 4ZH1A 3KLSA 3PZ2B 4GTTB 3WC3A 1KKTA 3OXUA 1O79A 5E2JA 1GXOA 2EAEA 2ZZRA 3DSVB 1VD5A 3M72A 5GW7A 1WZZA 3QG0A 3EQAA 1TN8B 1LF9A 1GXMA 3PMMA 4YDOB 3RX7A 3DSUB 3M7CA 3G6JB 2BB5A 1WU4A 1KRFA 1HZFA 3HXEB 2CQTA 3WKIA 3QFZA 2WYNA 3HXDB 4GTQB 2G02A 5AGDA 1IA7A 5FOBB 1DCEB 2V8IA 1H14A 1UT9A 4GTRB 1O6QA 1ULVA 1GAIA 3ANKA 4J5TA 1W6KA 2V8JA 3GLYA 3QPFA 3TF4A 1H3AA 2DRRA 2VN4A 3SDVA 4MBGB 2WY7A 1G87A 1FCEA 1FP3A 2XFGA 3GZKA 4L9PB 4D94A 1H37A 1N4QB 4GTOB 2FUZA 2JG0A 3M7LA 1JS4A 3OEDA 4AYRA 2JJBA 1FT1B 3M71A 4ZH5A 3CIHA 3QT3A 1KS8A 4KTRA 1L1YA 1V5DA 1N94B 4D4AA 1H36A 3E6UA 1TN6B 4V1SA 3S4BA 1H3CA 3SFXB 3CU7A 3H2WA 2RGKA 1FT2B 1LD7B 1G6IA 3S4CA 4YDEB 3WKGA 4MU9A 2BEDB 2P0VA 3E73A 3WIWA 3E30B 3X17A 1NL4B 3S4DA 2JF4A 5DGQA 1H35A 1GAHA 1H39A 1XW2A 3A3VA 3PYBA 1O1RB 5FO9B 2OKXA 1HCUA 4Z4JA 3Q78B 5FO7B 1TNUB 4Q88A 1UMPA 1AYXA 1SA4B 2A73B 2CQSA 3M7BA 3WKFA 1SA5B 2FBAA 3HXCB 1R76A 3E34B 3RENA 3DSTB 3WIRA 3W7UA 1UG9A 1W6JA 2QNOA 5M7IA 1TNZB 4AYOA 3M78A 4GTSB 3WIQA 1IA6A 1O5MB 4Z4LA 5GY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8Z A;  2EAB A;  3GLY A;  1K72 A;  1L2A A;  3QPF A;  2AFA A;  1GLM A;  3TF4 A;  5CZL A;  2DRQ A;  3WUX A;  5CD2 A;  4FUS A;  4TF4 A;  2FV1 A;  3W7T A;  2DRR A;  4L0G A;  1FO3 A;  2VN4 A;  1G87 A;  1FCE A;  3QDE A;  1FP3 A;  1FAE A;  2XFG A;  2Z07 A;  3GZK A;  3ANJ A;  1F9O A;  1FBO A;  3GT5 A;  2FUZ A;  2JG0 A;  1CEM A;  1H54 A;  3T33 A;  2NVP A;  1JS4 A;  1RQ5 A;  1H13 A;  2RI9 A;  2JJB A;  4AYR A;  4WVB A;  4ZH5 A;  3W7W A;  3CIH A;  5M7Y A;  3QT3 A;  3RRS A;  4EL8 A;  1KS8 A;  4KTR A;  1L1Y A;  1TF4 A;  1V5D A;  2GZ6 A;  3RX8 A;  3QXQ A;  3W7X A;  4Q2B A;  1KRE A;  4WVA A;  3K11 A;  3QT9 A;  1G9G A;  3E6U A;  3ON6 A;  3VXD A;  1LF6 A;  4TXT A;  4WVC A;  3H7L A;  1G9J A;  1FMI A;  3QWT A;  3S4B A;  2B4F A;  2YIK A;  4CJ0 A;  5MEH A;  1CLC A;  4XUV A;  1NXC A;  2D5J A;  2AHF A;  4AYQ A;  2EAC A;  3H2W A;  2RGK A;  3WC3 A;  1KKT A;  1G6I A;  3S4A A;  3WKH A;  5E2J A;  1GA2 A;  3S4C A;  1WU6 A;  3WKG A;  2EAE A;  1F9D A;  2ZZR A;  4WU0 A;  4JJJ A;  2P0V A;  3E73 A;  4ZG8 A;  4DOD A;  3WIW A;  1VD5 A;  3P2C A;  1X9D A;  3ANI A;  3X17 A;  5GW7 A;  1WZZ A;  3QG0 A;  3W5M A;  3S4D A;  2JF4 A;  1V5C A;  3EQA A;  5DGQ A;  1KSC A;  1V7X A;  1GAH A;  1LF9 A;  4KTP A;  2EAD A;  2VN7 A;  3PMM A;  2DRO A;  3VW5 A;  1XW2 A;  3QRY A;  3QXF A;  3ACS A;  1XWT A;  2DRS A;  3A3V A;  1KSD A;  1KWF A;  3RX7 A;  1V7W A;  1DL2 A;  2AHG A;  4AYP A;  3RSY A;  2OKX A;  4DOE A;  1HCU A;  1H12 A;  3EZ8 A;  4Z4J A;  4CE7 A;  5DGR A;  3W5N A;  3RX5 A;  4L6X A;  4Q88 A;  3ACT A;  2D8L A;  1AYX A;  1NC5 A;  3QSP A;  1WU4 A;  1KRF A;  2CQS A;  3WKF A;  1AGM A;  5KKB A;  2FBA A;  1FBW A;  2CQT A;  3WKI A;  3REN A;  3QFZ A;  5CA3 A;  3WIR A;  3W7U A;  2WYN A;  1UG9 A;  1KFG A;  1IA7 A;  2GH4 A;  2QNO A;  5M7I A;  3H3K A;  1IS9 A;  3AFJ A;  1FO2 A;  2RI8 A;  1H14 A;  4AYO A;  3W7S A;  1WU5 A;  1UT9 A;  3WIQ A;  1IA6 A;  2ZBL A;  1ULV A;  1GAI A;  3D3I A;  2FV0 A;  4Z4L A;  3QFY A;  1V7V A;  3ANK A;  4J5T A;  1XWQ A;  1DOG A;  2F6D A;  5GY3 A;  4CJ1 A; 
#chains in the Genus database with same CATH topology
 2A8Z A;  4KKI A;  1L2A A;  5IM1 A;  5CZL A;  2DRQ A;  2FV1 A;  3W7T A;  1FO3 A;  3PZ3 B;  2ZIS B;  2Z07 A;  4GTV B;  3M00 A;  1F9O A;  2GOX A;  1H54 A;  3E32 B;  1HXG A;  2J5C A;  4ZRQ A;  2NVP A;  3PZ1 B;  3DRA B;  1N4P B;  2ONG A;  5JPM B;  1D8D B;  5FO8 B;  3W7W A;  1N24 A;  2XWJ B;  3RRS A;  4F13 A;  1W3Y A;  3Q7A B;  1TF4 A;  3QXQ A;  1N4R B;  2WII B;  1KRE A;  1QBQ B;  4FXG B;  3DPY B;  3K11 A;  2BB6 A;  4WVC A;  2B4F A;  4CJ0 A;  2BBC A;  1O1T B;  2EAC A;  1N4S B;  1GXN A;  4E1Y A;  3P5P A;  3WKH A;  1WU6 A;  1OJN A;  1F9D A;  4WU0 A;  3D5S A;  4JJJ A;  4ZG8 A;  5EAU A;  1JCR B;  2BRP A;  3Q75 B;  2XQW A;  3P2C A;  1X9D A;  4BOK A;  1N7O A;  3ANI A;  1N1B A;  3W5M A;  4LNG B;  2BRV X;  1V5C A;  1V7X A;  4KTP A;  4FJQ A;  2IEJ B;  2VN7 A;  3DSS B;  5DHK A;  3VSM A;  3VW5 A;  2R2L B;  4FXK B;  3SDQ A;  2SQC A;  1XWT A;  1KSD A;  1KWF A;  2AHG A;  4AYP A;  4DI5 A;  3EZ8 A;  4YCR A;  2WCO A;  3HXB B;  5DGR A;  3RX5 A;  1KZP B;  1NC5 A;  2H6I B;  1RWC A;  5KKB A;  5ILY A;  4OZV A;  3SQC A;  4GTP B;  3HXF B;  1KFG A;  2GH4 A;  3H3K A;  1FO2 A;  2RI8 A;  3W7S A;  1N7R A;  1WU5 A;  1TNB B;  2B39 A;  3D3I A;  5EAT A;  2FV0 A;  1V7V A;  1N21 A;  1O6R A;  1DOG A;  1OJM A;  1XWQ A;  1N9A B;  2F6D A;  3KQ4 A;  4CE7 A;  3P5R A;  4V1R A;  2EAB A;  2E22 A;  4CJ1 A;  3VSN A;  2I07 B;  2AFA A;  3EUV B;  4FUS A;  1TNO B;  1RWF A;  3NFV A;  5JPN B;  4ONT A;  3EU5 B;  3QDE A;  2BRW A;  1FAE A;  1GHQ A;  3ANJ A;  5IK6 A;  3M74 A;  1FBO A;  3GT5 A;  2FUQ A;  1CEM A;  3T33 A;  1JCS B;  3KSQ B;  4QT9 A;  1RQ5 A;  1H13 A;  2WIN B;  4WVB A;  4ZRP A;  5M7Y A;  3M77 A;  4GTM B;  3D5R A;  4EL8 A;  1O1S B;  3RX8 A;  1GSZ A;  5JMF A;  4GL3 A;  4WVA A;  1H3B A;  3QT9 A;  1G9G A;  4TXT A;  1G9J A;  1C3D A;  5ILI A;  2YIK A;  2V3P A;  1CLC A;  1NXC A;  1HMU A;  1HV6 A;  2AHF A;  4AYQ A;  1HMW A;  3SDT A;  1QSJ A;  4M76 A;  2H6F B;  1FPP B;  3S4A A;  4BOJ A;  3Q73 B;  1GA2 A;  3Q79 B;  5IL8 A;  1RWG A;  5IK9 A;  4DOD A;  1J0M A;  2H6H B;  1KSC A;  2EAD A;  3DSW B;  1X1H A;  2DRO A;  4D4B A;  3QXF A;  3QRY A;  3ACS A;  2DRS A;  1I8Q A;  2F0Y B;  1V7W A;  1DL2 A;  3RSY A;  4OK2 A;  4DOE A;  3PYA A;  1H12 A;  1KZO B;  2NOJ A;  1RWA A;  3K7X A;  5C05 A;  3W5N A;  4D4C A;  1QQF A;  4L6X A;  3C72 B;  3ACT A;  2D8L A;  3NNB A;  3QSP A;  4KKJ A;  1AGM A;  2XWB B;  4MMI A;  2X03 A;  1RWH A;  1SQC A;  1FBW A;  2PMV A;  3M76 A;  5CA3 A;  2H6G B;  1N1Z A;  4LNB B;  1N23 A;  5JMD A;  4EHM B;  1IS9 A;  2ZIR B;  3M73 A;  3AFJ A;  4LIX A;  2PN5 A;  1F1S A;  3SFY B;  3DSX B;  2WY8 A;  2ZBL A;  1LXM A;  1S64 B;  3QFY A;  4OK4 A;  1X81 B;  3M02 A;  1HM3 A;  4LNV A;  3E80 A;  1K72 A;  1LOH A;  1GLM A;  1J0N A;  3PZ4 B;  3KSL B;  3WUX A;  5CD2 A;  2E24 A;  5GZK A;  4TF4 A;  2WDA A;  4L0G A;  3M7E A;  1NI1 B;  3SDU A;  1LTX B;  1O6H A;  1JCQ B;  2ONH A;  3E33 B;  3EU8 A;  3M75 A;  3RJ3 A;  4C1S A;  2V8K A;  1S63 B;  2RI9 A;  1MZC B;  1TNY B;  4D4D A;  3E37 B;  1D8E B;  5DHI A;  3SAE A;  2Q1F A;  3S9V A;  2GZ6 A;  3W7X A;  4Q2B A;  2G0D A;  1N95 B;  3SDR A;  3ON6 A;  5ILJ A;  3VXD A;  1TN7 B;  1LF6 A;  3H7L A;  3QWT A;  1FMI A;  2V3N A;  3Q7F B;  5MEH A;  1LD8 B;  4XUV A;  1QAZ A;  5IKA A;  2D5J A;  4ZH1 A;  3KLS A;  3PZ2 B;  4GTT B;  3WC3 A;  1KKT A;  3OXU A;  1O79 A;  5E2J A;  1GXO A;  2EAE A;  2ZZR A;  3DSV B;  4OJZ A;  1VD5 A;  3M72 A;  5GW7 A;  1WZZ A;  3QG0 A;  3EQA A;  1TN8 B;  1LF9 A;  1GXM A;  3PMM A;  4YDO B;  3G4D A;  3RX7 A;  3DSU B;  3M7C A;  3G6J B;  2BB5 A;  1OJO A;  1RW9 A;  5EAS A;  1HX9 A;  5ILH A;  1WU4 A;  1KRF A;  1HZF A;  3HXE B;  2CQT A;  3WKI A;  3QFZ A;  1EGU A;  2WYN A;  3HXD B;  3M01 A;  4GTQ B;  2G02 A;  5AGD A;  1IA7 A;  5FOB B;  1N7N A;  3N0F A;  1DCE B;  2V8I A;  1H14 A;  1UT9 A;  4GTR B;  1O6Q A;  3AFL A;  1ULV A;  1GAI A;  4NEI A;  5IL3 A;  3ANK A;  4J5T A;  1W6K A;  2V8J A;  3GLY A;  3QPF A;  3TF4 A;  1H3A A;  2DRR A;  2VN4 A;  3SDV A;  4MBG B;  5IK0 A;  2WY7 A;  1G87 A;  1FCE A;  1FP3 A;  1F9G A;  2XFG A;  3GZK A;  4L9P B;  1X1J A;  4D94 A;  1H37 A;  1N4Q B;  4GTO B;  2FUZ A;  2JG0 A;  5ILZ A;  3M7L A;  3N0G A;  1JS4 A;  3E7J A;  1HN0 A;  3OED A;  4AYR A;  2JJB A;  1FT1 B;  3M71 A;  4ZH5 A;  3CIH A;  3QT3 A;  4OZW A;  1KS8 A;  4KTR A;  1L1Y A;  1V5D A;  1N94 B;  4D4A A;  1C82 A;  1N7Q A;  1H36 A;  1HXC A;  3E6U A;  1TN6 B;  4V1S A;  3S4B A;  1N7P A;  4GAX A;  1H3C A;  3SFX B;  3CU7 A;  3G4F A;  1N22 A;  3H2W A;  4F10 A;  2RGK A;  1FT2 B;  1LD7 B;  1G6I A;  3S4C A;  5IKH A;  1CB8 A;  4YDE B;  3WKG A;  4MU9 A;  2BED B;  2P0V A;  3E73 A;  5ILK A;  3WIW A;  3E30 B;  3X17 A;  1X1I A;  1NL4 B;  3S4D A;  2JF4 A;  5DGQ A;  1H35 A;  1GAH A;  4RNQ A;  1H39 A;  1XW2 A;  3A3V A;  3PYB A;  1O1R B;  5FO9 B;  2OKX A;  1HCU A;  4Z4J A;  3Q78 B;  3A0O A;  5FO7 B;  1TNU B;  4Q88 A;  1UMP A;  1AYX A;  1SA4 B;  3LZ9 A;  2A73 B;  2CQS A;  3M7B A;  3WKF A;  1SA5 B;  1HXA A;  1N20 A;  1OJP A;  2FBA A;  3HXC B;  1R76 A;  3E34 B;  3REN A;  3DST B;  1HM2 A;  3WIR A;  3W7U A;  4MMH A;  1UG9 A;  1W6J A;  2QNO A;  5M7I A;  2FUT A;  5ILD A;  1TNZ B;  4AYO A;  3M78 A;  4FNV A;  4GTS B;  3WIQ A;  1IA6 A;  1O5M B;  4Z4L A;  1LXK A;  5GY3 A; 
#chains in the Genus database with same CATH homology
 2A8Z A;  4KKI A;  1L2A A;  5CZL A;  2DRQ A;  2FV1 A;  3W7T A;  1FO3 A;  3PZ3 B;  2ZIS B;  2Z07 A;  4GTV B;  1F9O A;  2GOX A;  1H54 A;  3E32 B;  4ZRQ A;  2NVP A;  3PZ1 B;  3DRA B;  1N4P B;  5JPM B;  1D8D B;  5FO8 B;  3W7W A;  2XWJ B;  3RRS A;  3Q7A B;  1TF4 A;  3QXQ A;  1N4R B;  2WII B;  1KRE A;  1QBQ B;  4FXG B;  3DPY B;  3K11 A;  2BB6 A;  4WVC A;  2B4F A;  4CJ0 A;  2BBC A;  1O1T B;  2EAC A;  1N4S B;  1GXN A;  3P5P A;  3WKH A;  1WU6 A;  1F9D A;  4WU0 A;  3D5S A;  4JJJ A;  4ZG8 A;  1JCR B;  3Q75 B;  2XQW A;  3P2C A;  1X9D A;  4BOK A;  3ANI A;  3W5M A;  4LNG B;  1V5C A;  1V7X A;  4KTP A;  2IEJ B;  2VN7 A;  3DSS B;  3VW5 A;  2R2L B;  4FXK B;  3SDQ A;  2SQC A;  1XWT A;  1KSD A;  1KWF A;  2AHG A;  4AYP A;  3EZ8 A;  4YCR A;  3HXB B;  5DGR A;  3RX5 A;  1KZP B;  1NC5 A;  2H6I B;  5KKB A;  3SQC A;  4GTP B;  3HXF B;  1KFG A;  2GH4 A;  3H3K A;  1FO2 A;  2RI8 A;  3W7S A;  1WU5 A;  1TNB B;  2B39 A;  3D3I A;  2FV0 A;  1V7V A;  1O6R A;  1DOG A;  1XWQ A;  2F6D A;  1N9A B;  3KQ4 A;  4CE7 A;  3P5R A;  4V1R A;  2EAB A;  4CJ1 A;  2I07 B;  2AFA A;  3EUV B;  4FUS A;  1TNO B;  5JPN B;  4ONT A;  3EU5 B;  3QDE A;  1FAE A;  1GHQ A;  3ANJ A;  3M74 A;  1FBO A;  3GT5 A;  1CEM A;  3T33 A;  1JCS B;  3KSQ B;  4QT9 A;  1RQ5 A;  1H13 A;  2WIN B;  4WVB A;  4ZRP A;  5M7Y A;  3M77 A;  4GTM B;  3D5R A;  4EL8 A;  1O1S B;  3RX8 A;  1GSZ A;  4GL3 A;  4WVA A;  1H3B A;  3QT9 A;  1G9G A;  4TXT A;  1G9J A;  1C3D A;  2YIK A;  2V3P A;  1CLC A;  1NXC A;  2AHF A;  4AYQ A;  3SDT A;  1QSJ A;  4M76 A;  2H6F B;  1FPP B;  3S4A A;  4BOJ A;  3Q73 B;  1GA2 A;  3Q79 B;  4DOD A;  2H6H B;  1KSC A;  2EAD A;  3DSW B;  4D4B A;  2DRO A;  3QXF A;  3QRY A;  3ACS A;  2DRS A;  2F0Y B;  1V7W A;  1DL2 A;  3RSY A;  4DOE A;  3PYA A;  1H12 A;  1KZO B;  2NOJ A;  3K7X A;  3W5N A;  4D4C A;  1QQF A;  4L6X A;  3C72 B;  3ACT A;  2D8L A;  3QSP A;  4KKJ A;  1AGM A;  2XWB B;  2PMV A;  1SQC A;  1FBW A;  3M76 A;  5CA3 A;  2H6G B;  4LNB B;  4EHM B;  1IS9 A;  2ZIR B;  3M73 A;  3AFJ A;  4LIX A;  2PN5 A;  3SFY B;  3DSX B;  2WY8 A;  2ZBL A;  1S64 B;  3QFY A;  1X81 B;  4LNV A;  1K72 A;  1GLM A;  3PZ4 B;  3KSL B;  3WUX A;  5CD2 A;  5GZK A;  4TF4 A;  4L0G A;  3M7E A;  1NI1 B;  3SDU A;  1LTX B;  1O6H A;  1JCQ B;  3E33 B;  3EU8 A;  3M75 A;  3RJ3 A;  4C1S A;  2V8K A;  1S63 B;  2RI9 A;  1MZC B;  1TNY B;  4D4D A;  3E37 B;  1D8E B;  3SAE A;  3S9V A;  2GZ6 A;  3W7X A;  4Q2B A;  2G0D A;  1N95 B;  3SDR A;  3ON6 A;  1LF6 A;  3VXD A;  1TN7 B;  3H7L A;  3QWT A;  1FMI A;  2V3N A;  3Q7F B;  5MEH A;  1LD8 B;  4XUV A;  2D5J A;  4ZH1 A;  3KLS A;  3PZ2 B;  4GTT B;  3WC3 A;  1KKT A;  3OXU A;  1O79 A;  5E2J A;  1GXO A;  2EAE A;  2ZZR A;  3DSV B;  1VD5 A;  3M72 A;  5GW7 A;  1WZZ A;  3QG0 A;  3EQA A;  1TN8 B;  1LF9 A;  1GXM A;  3PMM A;  4YDO B;  3RX7 A;  3DSU B;  3M7C A;  3G6J B;  2BB5 A;  1WU4 A;  1KRF A;  1HZF A;  3HXE B;  2CQT A;  3WKI A;  3QFZ A;  2WYN A;  3HXD B;  4GTQ B;  2G02 A;  5AGD A;  1IA7 A;  5FOB B;  1DCE B;  2V8I A;  1H14 A;  1UT9 A;  4GTR B;  1O6Q A;  1ULV A;  1GAI A;  3ANK A;  4J5T A;  1W6K A;  2V8J A;  3GLY A;  3QPF A;  3TF4 A;  1H3A A;  2DRR A;  2VN4 A;  3SDV A;  4MBG B;  2WY7 A;  1G87 A;  1FCE A;  1FP3 A;  2XFG A;  3GZK A;  4L9P B;  4D94 A;  1H37 A;  1N4Q B;  4GTO B;  2FUZ A;  2JG0 A;  3M7L A;  1JS4 A;  3OED A;  4AYR A;  2JJB A;  1FT1 B;  3M71 A;  4ZH5 A;  3CIH A;  3QT3 A;  1KS8 A;  4KTR A;  1L1Y A;  1V5D A;  1N94 B;  4D4A A;  1H36 A;  3E6U A;  1TN6 B;  4V1S A;  3S4B A;  1H3C A;  3SFX B;  3CU7 A;  3H2W A;  2RGK A;  1FT2 B;  1LD7 B;  1G6I A;  3S4C A;  4YDE B;  3WKG A;  4MU9 A;  2BED B;  2P0V A;  3E73 A;  3WIW A;  3E30 B;  3X17 A;  1NL4 B;  3S4D A;  2JF4 A;  5DGQ A;  1H35 A;  1GAH A;  1H39 A;  1XW2 A;  3A3V A;  3PYB A;  1O1R B;  5FO9 B;  2OKX A;  1HCU A;  4Z4J A;  3Q78 B;  5FO7 B;  1TNU B;  4Q88 A;  1UMP A;  1AYX A;  1SA4 B;  2A73 B;  2CQS A;  3M7B A;  3WKF A;  1SA5 B;  2FBA A;  3HXC B;  1R76 A;  3E34 B;  3REN A;  3DST B;  3WIR A;  3W7U A;  1UG9 A;  1W6J A;  2QNO A;  5M7I A;  1TNZ B;  4AYO A;  3M78 A;  4GTS B;  3WIQ A;  1IA6 A;  1O5M B;  4Z4L A;  5GY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...