3D5SA

Crystal structure of efb-c (r131a) / c3d complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
297
structure length
297
Chain Sequence
GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 117
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3d5sA00
2WINB 3SFXB 1O1TB 1TN7B 4GTSB 4BOJA 4V1RA 4C1SA 1O6HA 2H6IB 1FT1B 1NL4B 1O5MB 2PN5A 4GTTB 1N95B 2XWBB 4M76A 1N4RB 1SA5B 3G6JB 3PZ1B 1TN6B 4GTVB 4ZRQA 1N94B 1QSJA 1N4PB 1H35A 4GTMB 3D5SA 1O79A 3SFYB 4D4BA 2R2LB 4YDEB 4ZH1A 4GTOB 1KZOB 1FPPB 1W6JA 3EUVB 2GOXA 3RJ3A 4ZRPA 2V3NA 2I07B 2V8KA 3DSWB 4FXKB 3DSXB 1H3CA 4D4AA 1O1RB 1GXMA 2H6HB 3E32B 1HZFA 2V8JA 3DSVB 3HXBB 4BOKA 3DSSB 1JCQB 1KZPB 1NI1B 1TNYB 1TNZB 5FOBB 2XWJB 3SQCA 1GSZA 1GXNA 1TN8B 2WIIB 1R76A 3Q7AB 1D8DB 2ZIRB 3OEDA 2V3PA 2BEDB 5FO7B 2XQWA 1LTXB 4MBGB 2H6GB 2G02A 5JPNB 2F0YB 2A73B 4LNBB 1H3BA 5JPMB 1O1SB 1JCSB 2WY7A 3Q7FB 5FO9B 1W6KA 2B39A 3D5RA 4LNVA 4GTQB 4D4DA 3DSUB 1MZCB 4KKIA 5AGDA 3HXFB 3HXDB 3KLSA 3KSLB 1UMPA 2G0DA 3Q75B 1LD8B 2V8IA 2BB5A 2SQCA 3C72B 3DRAB 3HXEB 3PZ3B 3Q73B 3E37B 3PZ2B 3KQ4A 1TNUB 3HXCB 3DPYB 3CU7A 4V1SA 3E33B 5FO8B 1H36A 3KSQB 3DSTB 4MU9A 1C3DA 1H37A 1S63B 3Q79B 2IEJB 3PZ4B 1LD7B 4EHMB 3EU5B 1SQCA 2ZISB 1O6RA 2BB6A 2WY8A 1TNOB 1S64B 3OXUA 1D8EB 1N4QB 1N9AB 4D4CA 1QBQB 1TNBB 4D94A 1SA4B 1X81B 4GTPB 1GHQA 2PMVA 1GXOA 4YDOB 1JCRB 1DCEB 1FT2B 4KKJA 3E30B 4FXGB 4ONTA 3K7XA 2NOJA 1H3AA 4LNGB 4GTRB 2H6FB 3E34B 4L9PB 1QQFA 1H39A 1N4SB 2BBCA 1O6QA 3Q78B
chains in the Genus database with same CATH superfamily
1O1TB 1KREA 4FJQA 3SDRA 1RWAA 3N0GA 4V1RA 4C1SA 5EASA 1NL4B 4GTTB 3SDUA 4CJ0A 1ULVA 1GLMA 1N4RB 3PZ1B 1G6IA 1N4PB 2D5JA 1O79A 2R2LB 1G9GA 1FPPB 1W6JA 3RJ3A 1RQ5A 3SDVA 2BRWA 1F1SA 1N7QA 3QFZA 2E24A 5MEHA 1O1RB 3E32B 3SAEA 3P5RA 4CE7A 4F13A 3DSVB 4BOKA 2NVPA 4OK4A 1C82A 2YIKA 1LF9A 3E7JA 1XW2A 1L1YA 3H3KA 4WU0A 4OZWA 1WU4A 1TN8B 1R76A 3Q7AB 3QFYA 4GL3A 3M72A 1OJPA 2V3PA 2GZ6A 1DL2A 2BEDB 1N7PA 1QAZA 1N7OA 3M7BA 1H12A 4LNBB 3RX5A 3WKHA 5E2JA 3Q7FB 3E73A 1HN0A 5FO9B 4GAXA 1J0MA 4JJJA 5ILIA 3D5RA 1MZCB 2RI8A 1G87A 1W3YA 3Q75B 1HXGA 2F6DA 3LZ9A 3RSYA 3QXQA 3PZ3B 1GAHA 3EZ8A 3HXCB 3E33B 1K72A 4WVBA 3G4FA 4MU9A 1RWGA 3M01A 1S63B 2IEJB 2EABA 3EU5B 2B4FA 2J5CA 2ZISB 2BB6A 1TNOB 1S64B 4D4CA 1QBQB 4MMHA 1H14A 1SA4B 3QSPA 1N7NA 1HMUA 1IS9A 5IL8A 1DOGA 3M75A 1GXOA 1RWHA 3PYBA 4ONTA 3K7XA 3M78A 4Z4LA 3WIWA 1J0NA 1KSCA 4L9PB 3E34B 1H13A 3EUVB 1KS8A 2BBCA 3Q78B 2WINB 3W7UA 1HM3A 1HV6A 1EGUA 1LXMA 1UT9A 5IK6A 2H6IB 1O5MB 1FCEA 4Q2BA 5ILKA 3ANIA 2XWBB 4M76A 3G6JB 2FUTA 1F9OA 3ON6A 1TF4A 1N94B 1WU5A 5M7IA 3RRSA 1G9JA 1UG9A 3SFYB 4D4BA 5CA3A 4LIXA 4TF4A 1KZOB 5CZLA 3AFJA 2CQSA 5IK9A 2I07B 2V8KA 4FNVA 2XFGA 3M71A 3ACSA 1AYXA 3AFLA 5ILZA 5ILYA 4Z4JA 3NNBA 3HXBB 2AFAA 2Z07A 3H2WA 3ANJA 5IKAA 3P5PA 3SQCA 1GXNA 1LXKA 1GAIA 3T33A 5ILJA 3OEDA 1N1BA 3QXFA 2BRPA 3S9VA 5FO7B 4DI5A 4MBGB 3A3VA 2H6GB 2A73B 5JPMB 4CJ1A 1O1SB 1JCSB 3QG0A 1KRFA 2RI9A 2JG0A 5DGQA 4GTQB 2ZBLA 4FUSA 3DSUB 2FUQA 4KKIA 4AYOA 3A0OA 3VXDA 2EADA 3K11A 1JS4A 2G0DA 3M7LA 2DRRA 1LD8B 3DRAB 2VN4A 3Q73B 3WKGA 4RNQA 5GW7A 1V7VA 1OJMA 3QWTA 5FO8B 1WZZA 4L6XA 1N24A 3W5MA 2EACA 3E80A 3DSTB 3PYAA 1H37A 1AGMA 3WIRA 1O6RA 3EQAA 3NFVA 2RGKA 4OJZA 4D94A 2P0VA 1TNBB 1LOHA 4QT9A 1X81B 4GTPB 1HMWA 2AHFA 3M00A 5GZKA 2PMVA 4YDOB 1OJOA 3E30B 4FXGB 5IKHA 1XWQA 2NOJA 4LNGB 1QQFA 4AYQA 5ILDA 1KWFA 1TN7B 1L2AA 1NXCA 4GTSB 1O6HA 1V5DA 1KKTA 1FT1B 3VSNA 4Q88A 1N22A 1N95B 1RW9A 4NEIA 1SA5B 1TN6B 4ZRQA 1OJNA 3GZKA 1H35A 1XWTA 1FBWA 1HXCA 4ZH1A 2VN7A 2ONGA 4GTOB 3SDQA 2V3NA 1F9DA 3DSWB 4FXKB 3E6UA 1H3CA 3PMMA 4D4AA 2H6HB 2WDAA 5GY3A 3RX8A 4DOEA 2DRQA 4TXTA 3WKIA 3QDEA 1NI1B 1TNYB 1TNZB 5FOBB 2X03A 2XWJB 1GSZA 3M02A 3X17A 5ILHA 1D8DB 1CEMA 1I8QA 4WVAA 3ACTA 5M7YA 2XQWA 2CQTA 1N20A 3W5NA 3D3IA 1H3BA 1X9DA 3N0FA 1W6KA 2B39A 4LNVA 4EL8A 2ZZRA 4AYRA 4D4DA 3W7XA 5CD2A 4AYPA 5AGDA 1WU6A 3HXFB 1FO2A 3W7WA 4KTPA 3W7SA 2FUZA 5JMDA 3M74A 2BB5A 3HXEB 3E37B 1TNUB 4V1SA 2FBAA 2EAEA 2OKXA 3P2CA 3QT3A 1C3DA 2QNOA 1N7RA 3Q79B 3M7EA 3PZ4B 1LD7B 4EHMB 1FO3A 3QRYA 2WY8A 1D8EB 2JF4A 1N21A 1HM2A 5KKBA 1CB8A 2WYNA 1GHQA 2A8ZA 4GTRB 2GH4A 2DROA 1H39A 1N4SB 3QT9A 2SQCA 1O6QA 3S4DA 5JMFA 4J5TA 3SFXB 3M77A 4BOJA 1CLCA 1V7XA 4WVCA 1V7WA 2PN5A 1V5CA 2DRSA 3GT5A 1HXAA 5IK0A 4GTVB 3WC3A 1QSJA 4KTRA 4GTMB 5EAUA 3D5SA 4YDEB 1X1JA 1IA6A 2GOXA 3H7LA 4ZRPA 5C05A 3VSMA 3DSXB 1N1ZA 2Q1FA 1GXMA 5DHKA 1X1HA 1HZFA 3WIQA 2V8JA 3WKFA 3TF4A 5DHIA 3DSSB 1JCQB 1KZPB 1HX9A 4OK2A 5EATA 2ONHA 1IA7A 2WIIB 2ZIRB 3QPFA 1LTXB 1H54A 2G02A 2F0YB 1FP3A 5JPNB 2FV0A 3G4DA 1RWFA 1VD5A 2WY7A 3WUXA 3S4CA 5IL3A 1FBOA 3HXDB 1RWCA 3KLSA 4ZH5A 2FV1A 3KSLB 4MMIA 1GA2A 2WCOA 5IM1A 1UMPA 4ZG8A 4F10A 1F9GA 3RX7A 3C72B 3M7CA 3PZ2B 4OZVA 3RENA 3KQ4A 3DPYB 1HCUA 3CU7A 3S4BA 3SDTA 1KFGA 1H36A 1N23A 1FAEA 2BRVX 3KSQB 3M76A 3M73A 3ANKA 1SQCA 1X1IA 2AHGA 3OXUA 1KSDA 1N4QB 1N9AB 3W7TA 2JJBA 4YCRA 3VW5A 2E22A 5DGRA 4E1YA 1NC5A 3CIHA 1JCRB 2D8LA 1FMIA 1DCEB 1FT2B 4KKJA 3GLYA 4L0GA 4DODA 1LF6A 1H3AA 3S4AA 3EU8A 2H6FB 2V8IA 4XUVA
chains in the Genus database with same CATH topology
1O1TB 1KREA 3SDRA 4V1RA 4C1SA 1NL4B 4GTTB 3SDUA 4CJ0A 1ULVA 1GLMA 1N4RB 3PZ1B 1G6IA 1N4PB 2D5JA 1O79A 2R2LB 1G9GA 1FPPB 1W6JA 3RJ3A 1RQ5A 3SDVA 3QFZA 5MEHA 1O1RB 3E32B 3SAEA 3P5RA 4CE7A 3DSVB 4BOKA 2NVPA 2YIKA 1LF9A 1XW2A 1L1YA 3H3KA 4WU0A 1WU4A 1TN8B 1R76A 3Q7AB 3QFYA 4GL3A 3M72A 2V3PA 2GZ6A 1DL2A 2BEDB 3M7BA 1H12A 4LNBB 3RX5A 3WKHA 5E2JA 3Q7FB 3E73A 5FO9B 4JJJA 3D5RA 1MZCB 2RI8A 1G87A 3Q75B 2F6DA 3RSYA 3QXQA 3PZ3B 1GAHA 3EZ8A 3HXCB 3E33B 1K72A 4WVBA 4MU9A 1S63B 2IEJB 2EABA 2B4FA 3EU5B 2ZISB 2BB6A 1TNOB 1S64B 4D4CA 1QBQB 1H14A 1SA4B 3QSPA 1IS9A 1DOGA 3M75A 1GXOA 3PYBA 4ONTA 3K7XA 3M78A 4Z4LA 3WIWA 1KSCA 4L9PB 3E34B 1H13A 1KS8A 3EUVB 2BBCA 3Q78B 2WINB 3W7UA 1UT9A 2H6IB 1O5MB 1FCEA 4Q2BA 3ANIA 2XWBB 4M76A 3G6JB 1F9OA 3ON6A 1TF4A 1N94B 1WU5A 5M7IA 3RRSA 1G9JA 1UG9A 3SFYB 4D4BA 5CA3A 4LIXA 4TF4A 1KZOB 5CZLA 3AFJA 2CQSA 2I07B 2V8KA 2XFGA 3M71A 3ACSA 1AYXA 4Z4JA 3HXBB 2AFAA 2Z07A 3H2WA 3ANJA 3P5PA 3SQCA 1GXNA 1GAIA 3T33A 3OEDA 3QXFA 3S9VA 5FO7B 4MBGB 3A3VA 2H6GB 2A73B 5JPMB 4CJ1A 1O1SB 1JCSB 3QG0A 1KRFA 2RI9A 2JG0A 5DGQA 4GTQB 2ZBLA 4FUSA 3DSUB 4KKIA 4AYOA 3VXDA 2EADA 3K11A 1JS4A 2G0DA 3M7LA 2DRRA 1LD8B 3DRAB 2VN4A 3Q73B 3WKGA 5GW7A 1V7VA 3QWTA 5FO8B 1WZZA 4L6XA 3W5MA 2EACA 3DSTB 3PYAA 1H37A 1AGMA 3WIRA 1O6RA 3EQAA 2RGKA 4D94A 2P0VA 1TNBB 4QT9A 1X81B 4GTPB 2AHFA 5GZKA 2PMVA 4YDOB 3E30B 4FXGB 1XWQA 2NOJA 4LNGB 1QQFA 4AYQA 1KWFA 1TN7B 1L2AA 1NXCA 4GTSB 1O6HA 1V5DA 1KKTA 1FT1B 4Q88A 1N95B 1SA5B 1TN6B 4ZRQA 3GZKA 1H35A 1XWTA 1FBWA 4ZH1A 2VN7A 4GTOB 3SDQA 2V3NA 1F9DA 3DSWB 4FXKB 3E6UA 1H3CA 3PMMA 4D4AA 2H6HB 5GY3A 3RX8A 4DOEA 2DRQA 4TXTA 3WKIA 3QDEA 1NI1B 1TNYB 1TNZB 5FOBB 2XWJB 1GSZA 3X17A 1D8DB 1CEMA 4WVAA 3ACTA 5M7YA 2XQWA 2CQTA 3W5NA 3D3IA 1H3BA 1X9DA 1W6KA 2B39A 4LNVA 4EL8A 2ZZRA 4AYRA 4D4DA 3W7XA 5CD2A 4AYPA 5AGDA 1WU6A 3HXFB 1FO2A 3W7WA 4KTPA 3W7SA 2FUZA 3M74A 2BB5A 3HXEB 3E37B 1TNUB 4V1SA 2FBAA 2EAEA 2OKXA 3P2CA 3QT3A 1C3DA 2QNOA 3Q79B 3M7EA 3PZ4B 1LD7B 4EHMB 1FO3A 3QRYA 2WY8A 1D8EB 2JF4A 5KKBA 2WYNA 1GHQA 2A8ZA 4GTRB 2GH4A 2DROA 1H39A 1N4SB 3QT9A 2SQCA 1O6QA 3S4DA 4J5TA 3SFXB 3M77A 4BOJA 1CLCA 1V7XA 4WVCA 1V7WA 2PN5A 1V5CA 2DRSA 3GT5A 4GTVB 3WC3A 1QSJA 4KTRA 4GTMB 3D5SA 4YDEB 1IA6A 2GOXA 3H7LA 4ZRPA 3DSXB 1GXMA 1HZFA 3WIQA 2V8JA 3WKFA 3TF4A 3DSSB 1JCQB 1KZPB 1IA7A 2WIIB 2ZIRB 3QPFA 1LTXB 1H54A 2G02A 2F0YB 1FP3A 5JPNB 2FV0A 1VD5A 2WY7A 3WUXA 3S4CA 1FBOA 3HXDB 4ZH5A 3KLSA 2FV1A 3KSLB 1GA2A 1UMPA 4ZG8A 3RX7A 3C72B 3M7CA 3PZ2B 3RENA 3KQ4A 3DPYB 1HCUA 3CU7A 3S4BA 3SDTA 1KFGA 1H36A 1FAEA 3KSQB 3M76A 3M73A 3ANKA 1SQCA 2AHGA 3OXUA 1KSDA 1N4QB 1N9AB 3W7TA 2JJBA 4YCRA 3VW5A 5DGRA 1NC5A 3CIHA 1JCRB 2D8LA 1FMIA 1DCEB 1FT2B 4KKJA 3GLYA 4L0GA 4DODA 1LF6A 1H3AA 3S4AA 3EU8A 2H6FB 2V8IA 4XUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WIN B;  3SFX B;  1O1T B;  1TN7 B;  4GTS B;  4BOJ A;  4V1R A;  4C1S A;  1O6H A;  2H6I B;  1FT1 B;  1NL4 B;  1O5M B;  2PN5 A;  4GTT B;  1N95 B;  2XWB B;  4M76 A;  1N4R B;  1SA5 B;  3G6J B;  3PZ1 B;  1TN6 B;  4GTV B;  4ZRQ A;  1N94 B;  1QSJ A;  1N4P B;  1H35 A;  4GTM B;  3D5S A;  1O79 A;  3SFY B;  4D4B A;  2R2L B;  4YDE B;  4ZH1 A;  4GTO B;  1KZO B;  1FPP B;  1W6J A;  3EUV B;  2GOX A;  3RJ3 A;  4ZRP A;  2V3N A;  2I07 B;  2V8K A;  3DSW B;  4FXK B;  3DSX B;  1H3C A;  4D4A A;  1O1R B;  1GXM A;  2H6H B;  3E32 B;  1HZF A;  2V8J A;  3DSV B;  3HXB B;  4BOK A;  3DSS B;  1JCQ B;  1KZP B;  1NI1 B;  1TNY B;  1TNZ B;  5FOB B;  2XWJ B;  3SQC A;  1GSZ A;  1GXN A;  1TN8 B;  2WII B;  1R76 A;  3Q7A B;  1D8D B;  2ZIR B;  3OED A;  2V3P A;  2BED B;  5FO7 B;  2XQW A;  1LTX B;  4MBG B;  2H6G B;  2G02 A;  5JPN B;  2F0Y B;  2A73 B;  4LNB B;  1H3B A;  5JPM B;  1O1S B;  1JCS B;  2WY7 A;  3Q7F B;  5FO9 B;  1W6K A;  2B39 A;  3D5R A;  4LNV A;  4GTQ B;  4D4D A;  3DSU B;  1MZC B;  4KKI A;  5AGD A;  3HXF B;  3HXD B;  3KLS A;  3KSL B;  1UMP A;  2G0D A;  3Q75 B;  1LD8 B;  2V8I A;  2BB5 A;  2SQC A;  3C72 B;  3DRA B;  3HXE B;  3PZ3 B;  3Q73 B;  3E37 B;  3PZ2 B;  3KQ4 A;  1TNU B;  3HXC B;  3DPY B;  3CU7 A;  4V1S A;  3E33 B;  5FO8 B;  1H36 A;  3KSQ B;  3DST B;  4MU9 A;  1C3D A;  1H37 A;  1S63 B;  3Q79 B;  2IEJ B;  3PZ4 B;  1LD7 B;  4EHM B;  3EU5 B;  1SQC A;  2ZIS B;  1O6R A;  2BB6 A;  2WY8 A;  1TNO B;  1S64 B;  3OXU A;  1D8E B;  1N4Q B;  1N9A B;  4D4C A;  1QBQ B;  1TNB B;  4D94 A;  1SA4 B;  1X81 B;  4GTP B;  1GHQ A;  2PMV A;  1GXO A;  4YDO B;  1JCR B;  1DCE B;  1FT2 B;  4KKJ A;  3E30 B;  4FXG B;  4ONT A;  3K7X A;  2NOJ A;  1H3A A;  4LNG B;  4GTR B;  2H6F B;  3E34 B;  4L9P B;  1QQF A;  1H39 A;  1N4S B;  2BBC A;  1O6Q A;  3Q78 B; 
#chains in the Genus database with same CATH topology
 1O1T B;  1KRE A;  4FJQ A;  3SDR A;  1RWA A;  3N0G A;  4V1R A;  4C1S A;  5EAS A;  1NL4 B;  4GTT B;  3SDU A;  4CJ0 A;  1ULV A;  1GLM A;  1N4R B;  3PZ1 B;  1G6I A;  1N4P B;  2D5J A;  1O79 A;  2R2L B;  1G9G A;  1FPP B;  1W6J A;  3RJ3 A;  1RQ5 A;  3SDV A;  2BRW A;  1F1S A;  1N7Q A;  3QFZ A;  2E24 A;  5MEH A;  1O1R B;  3E32 B;  3SAE A;  3P5R A;  4CE7 A;  4F13 A;  3DSV B;  4BOK A;  2NVP A;  4OK4 A;  1C82 A;  2YIK A;  1LF9 A;  3E7J A;  1XW2 A;  1L1Y A;  3H3K A;  4WU0 A;  4OZW A;  1WU4 A;  1TN8 B;  1R76 A;  3Q7A B;  3QFY A;  4GL3 A;  3M72 A;  1OJP A;  2V3P A;  2GZ6 A;  1DL2 A;  2BED B;  1N7P A;  1QAZ A;  1N7O A;  3M7B A;  1H12 A;  4LNB B;  3RX5 A;  3WKH A;  5E2J A;  3Q7F B;  3E73 A;  1HN0 A;  5FO9 B;  4GAX A;  1J0M A;  4JJJ A;  5ILI A;  3D5R A;  1MZC B;  2RI8 A;  1G87 A;  1W3Y A;  3Q75 B;  1HXG A;  2F6D A;  3LZ9 A;  3RSY A;  3QXQ A;  3PZ3 B;  1GAH A;  3EZ8 A;  3HXC B;  3E33 B;  1K72 A;  4WVB A;  3G4F A;  4MU9 A;  1RWG A;  3M01 A;  1S63 B;  2IEJ B;  2EAB A;  3EU5 B;  2B4F A;  2J5C A;  2ZIS B;  2BB6 A;  1TNO B;  1S64 B;  4D4C A;  1QBQ B;  4MMH A;  1H14 A;  1SA4 B;  3QSP A;  1N7N A;  1HMU A;  1IS9 A;  5IL8 A;  1DOG A;  3M75 A;  1GXO A;  1RWH A;  3PYB A;  4ONT A;  3K7X A;  3M78 A;  4Z4L A;  3WIW A;  1J0N A;  1KSC A;  4L9P B;  3E34 B;  1H13 A;  3EUV B;  1KS8 A;  2BBC A;  3Q78 B;  2WIN B;  3W7U A;  1HM3 A;  1HV6 A;  1EGU A;  1LXM A;  1UT9 A;  5IK6 A;  2H6I B;  1O5M B;  1FCE A;  4Q2B A;  5ILK A;  3ANI A;  2XWB B;  4M76 A;  3G6J B;  2FUT A;  1F9O A;  3ON6 A;  1TF4 A;  1N94 B;  1WU5 A;  5M7I A;  3RRS A;  1G9J A;  1UG9 A;  3SFY B;  4D4B A;  5CA3 A;  4LIX A;  4TF4 A;  1KZO B;  5CZL A;  3AFJ A;  2CQS A;  5IK9 A;  2I07 B;  2V8K A;  4FNV A;  2XFG A;  3M71 A;  3ACS A;  1AYX A;  3AFL A;  5ILZ A;  5ILY A;  4Z4J A;  3NNB A;  3HXB B;  2AFA A;  2Z07 A;  3H2W A;  3ANJ A;  5IKA A;  3P5P A;  3SQC A;  1GXN A;  1LXK A;  1GAI A;  3T33 A;  5ILJ A;  3OED A;  1N1B A;  3QXF A;  2BRP A;  3S9V A;  5FO7 B;  4DI5 A;  4MBG B;  3A3V A;  2H6G B;  2A73 B;  5JPM B;  4CJ1 A;  1O1S B;  1JCS B;  3QG0 A;  1KRF A;  2RI9 A;  2JG0 A;  5DGQ A;  4GTQ B;  2ZBL A;  4FUS A;  3DSU B;  2FUQ A;  4KKI A;  4AYO A;  3A0O A;  3VXD A;  2EAD A;  3K11 A;  1JS4 A;  2G0D A;  3M7L A;  2DRR A;  1LD8 B;  3DRA B;  2VN4 A;  3Q73 B;  3WKG A;  4RNQ A;  5GW7 A;  1V7V A;  1OJM A;  3QWT A;  5FO8 B;  1WZZ A;  4L6X A;  1N24 A;  3W5M A;  2EAC A;  3E80 A;  3DST B;  3PYA A;  1H37 A;  1AGM A;  3WIR A;  1O6R A;  3EQA A;  3NFV A;  2RGK A;  4OJZ A;  4D94 A;  2P0V A;  1TNB B;  1LOH A;  4QT9 A;  1X81 B;  4GTP B;  1HMW A;  2AHF A;  3M00 A;  5GZK A;  2PMV A;  4YDO B;  1OJO A;  3E30 B;  4FXG B;  5IKH A;  1XWQ A;  2NOJ A;  4LNG B;  1QQF A;  4AYQ A;  5ILD A;  1KWF A;  1TN7 B;  1L2A A;  1NXC A;  4GTS B;  1O6H A;  1V5D A;  1KKT A;  1FT1 B;  3VSN A;  4Q88 A;  1N22 A;  1N95 B;  1RW9 A;  4NEI A;  1SA5 B;  1TN6 B;  4ZRQ A;  1OJN A;  3GZK A;  1H35 A;  1XWT A;  1FBW A;  1HXC A;  4ZH1 A;  2VN7 A;  2ONG A;  4GTO B;  3SDQ A;  2V3N A;  1F9D A;  3DSW B;  4FXK B;  3E6U A;  1H3C A;  3PMM A;  4D4A A;  2H6H B;  2WDA A;  5GY3 A;  3RX8 A;  4DOE A;  2DRQ A;  4TXT A;  3WKI A;  3QDE A;  1NI1 B;  1TNY B;  1TNZ B;  5FOB B;  2X03 A;  2XWJ B;  1GSZ A;  3M02 A;  3X17 A;  5ILH A;  1D8D B;  1CEM A;  1I8Q A;  4WVA A;  3ACT A;  5M7Y A;  2XQW A;  2CQT A;  1N20 A;  3W5N A;  3D3I A;  1H3B A;  1X9D A;  3N0F A;  1W6K A;  2B39 A;  4LNV A;  4EL8 A;  2ZZR A;  4AYR A;  4D4D A;  3W7X A;  5CD2 A;  4AYP A;  5AGD A;  1WU6 A;  3HXF B;  1FO2 A;  3W7W A;  4KTP A;  3W7S A;  2FUZ A;  5JMD A;  3M74 A;  2BB5 A;  3HXE B;  3E37 B;  1TNU B;  4V1S A;  2FBA A;  2EAE A;  2OKX A;  3P2C A;  3QT3 A;  1C3D A;  2QNO A;  1N7R A;  3Q79 B;  3M7E A;  3PZ4 B;  1LD7 B;  4EHM B;  1FO3 A;  3QRY A;  2WY8 A;  1D8E B;  2JF4 A;  1N21 A;  1HM2 A;  5KKB A;  1CB8 A;  2WYN A;  1GHQ A;  2A8Z A;  4GTR B;  2GH4 A;  2DRO A;  1H39 A;  1N4S B;  3QT9 A;  2SQC A;  1O6Q A;  3S4D A;  5JMF A;  4J5T A;  3SFX B;  3M77 A;  4BOJ A;  1CLC A;  1V7X A;  4WVC A;  1V7W A;  2PN5 A;  1V5C A;  2DRS A;  3GT5 A;  1HXA A;  5IK0 A;  4GTV B;  3WC3 A;  1QSJ A;  4KTR A;  4GTM B;  5EAU A;  3D5S A;  4YDE B;  1X1J A;  1IA6 A;  2GOX A;  3H7L A;  4ZRP A;  5C05 A;  3VSM A;  3DSX B;  1N1Z A;  2Q1F A;  1GXM A;  5DHK A;  1X1H A;  1HZF A;  3WIQ A;  2V8J A;  3WKF A;  3TF4 A;  5DHI A;  3DSS B;  1JCQ B;  1KZP B;  1HX9 A;  4OK2 A;  5EAT A;  2ONH A;  1IA7 A;  2WII B;  2ZIR B;  3QPF A;  1LTX B;  1H54 A;  2G02 A;  2F0Y B;  1FP3 A;  5JPN B;  2FV0 A;  3G4D A;  1RWF A;  1VD5 A;  2WY7 A;  3WUX A;  3S4C A;  5IL3 A;  1FBO A;  3HXD B;  1RWC A;  3KLS A;  4ZH5 A;  2FV1 A;  3KSL B;  4MMI A;  1GA2 A;  2WCO A;  5IM1 A;  1UMP A;  4ZG8 A;  4F10 A;  1F9G A;  3RX7 A;  3C72 B;  3M7C A;  3PZ2 B;  4OZV A;  3REN A;  3KQ4 A;  3DPY B;  1HCU A;  3CU7 A;  3S4B A;  3SDT A;  1KFG A;  1H36 A;  1N23 A;  1FAE A;  2BRV X;  3KSQ B;  3M76 A;  3M73 A;  3ANK A;  1SQC A;  1X1I A;  2AHG A;  3OXU A;  1KSD A;  1N4Q B;  1N9A B;  3W7T A;  2JJB A;  4YCR A;  3VW5 A;  2E22 A;  5DGR A;  4E1Y A;  1NC5 A;  3CIH A;  1JCR B;  2D8L A;  1FMI A;  1DCE B;  1FT2 B;  4KKJ A;  3GLY A;  4L0G A;  4DOD A;  1LF6 A;  1H3A A;  3S4A A;  3EU8 A;  2H6F B;  2V8I A;  4XUV A; 
#chains in the Genus database with same CATH homology
 1O1T B;  1KRE A;  3SDR A;  4V1R A;  4C1S A;  1NL4 B;  4GTT B;  3SDU A;  4CJ0 A;  1ULV A;  1GLM A;  1N4R B;  3PZ1 B;  1G6I A;  1N4P B;  2D5J A;  1O79 A;  2R2L B;  1G9G A;  1FPP B;  1W6J A;  3RJ3 A;  1RQ5 A;  3SDV A;  3QFZ A;  5MEH A;  1O1R B;  3E32 B;  3SAE A;  3P5R A;  4CE7 A;  3DSV B;  4BOK A;  2NVP A;  2YIK A;  1LF9 A;  1XW2 A;  1L1Y A;  3H3K A;  4WU0 A;  1WU4 A;  1TN8 B;  1R76 A;  3Q7A B;  3QFY A;  4GL3 A;  3M72 A;  2V3P A;  2GZ6 A;  1DL2 A;  2BED B;  3M7B A;  1H12 A;  4LNB B;  3RX5 A;  3WKH A;  5E2J A;  3Q7F B;  3E73 A;  5FO9 B;  4JJJ A;  3D5R A;  1MZC B;  2RI8 A;  1G87 A;  3Q75 B;  2F6D A;  3RSY A;  3QXQ A;  3PZ3 B;  1GAH A;  3EZ8 A;  3HXC B;  3E33 B;  1K72 A;  4WVB A;  4MU9 A;  1S63 B;  2IEJ B;  2EAB A;  2B4F A;  3EU5 B;  2ZIS B;  2BB6 A;  1TNO B;  1S64 B;  4D4C A;  1QBQ B;  1H14 A;  1SA4 B;  3QSP A;  1IS9 A;  1DOG A;  3M75 A;  1GXO A;  3PYB A;  4ONT A;  3K7X A;  3M78 A;  4Z4L A;  3WIW A;  1KSC A;  4L9P B;  3E34 B;  1H13 A;  1KS8 A;  3EUV B;  2BBC A;  3Q78 B;  2WIN B;  3W7U A;  1UT9 A;  2H6I B;  1O5M B;  1FCE A;  4Q2B A;  3ANI A;  2XWB B;  4M76 A;  3G6J B;  1F9O A;  3ON6 A;  1TF4 A;  1N94 B;  1WU5 A;  5M7I A;  3RRS A;  1G9J A;  1UG9 A;  3SFY B;  4D4B A;  5CA3 A;  4LIX A;  4TF4 A;  1KZO B;  5CZL A;  3AFJ A;  2CQS A;  2I07 B;  2V8K A;  2XFG A;  3M71 A;  3ACS A;  1AYX A;  4Z4J A;  3HXB B;  2AFA A;  2Z07 A;  3H2W A;  3ANJ A;  3P5P A;  3SQC A;  1GXN A;  1GAI A;  3T33 A;  3OED A;  3QXF A;  3S9V A;  5FO7 B;  4MBG B;  3A3V A;  2H6G B;  2A73 B;  5JPM B;  4CJ1 A;  1O1S B;  1JCS B;  3QG0 A;  1KRF A;  2RI9 A;  2JG0 A;  5DGQ A;  4GTQ B;  2ZBL A;  4FUS A;  3DSU B;  4KKI A;  4AYO A;  3VXD A;  2EAD A;  3K11 A;  1JS4 A;  2G0D A;  3M7L A;  2DRR A;  1LD8 B;  3DRA B;  2VN4 A;  3Q73 B;  3WKG A;  5GW7 A;  1V7V A;  3QWT A;  5FO8 B;  1WZZ A;  4L6X A;  3W5M A;  2EAC A;  3DST B;  3PYA A;  1H37 A;  1AGM A;  3WIR A;  1O6R A;  3EQA A;  2RGK A;  4D94 A;  2P0V A;  1TNB B;  4QT9 A;  1X81 B;  4GTP B;  2AHF A;  5GZK A;  2PMV A;  4YDO B;  3E30 B;  4FXG B;  1XWQ A;  2NOJ A;  4LNG B;  1QQF A;  4AYQ A;  1KWF A;  1TN7 B;  1L2A A;  1NXC A;  4GTS B;  1O6H A;  1V5D A;  1KKT A;  1FT1 B;  4Q88 A;  1N95 B;  1SA5 B;  1TN6 B;  4ZRQ A;  3GZK A;  1H35 A;  1XWT A;  1FBW A;  4ZH1 A;  2VN7 A;  4GTO B;  3SDQ A;  2V3N A;  1F9D A;  3DSW B;  4FXK B;  3E6U A;  1H3C A;  3PMM A;  4D4A A;  2H6H B;  5GY3 A;  3RX8 A;  4DOE A;  2DRQ A;  4TXT A;  3WKI A;  3QDE A;  1NI1 B;  1TNY B;  1TNZ B;  5FOB B;  2XWJ B;  1GSZ A;  3X17 A;  1D8D B;  1CEM A;  4WVA A;  3ACT A;  5M7Y A;  2XQW A;  2CQT A;  3W5N A;  3D3I A;  1H3B A;  1X9D A;  1W6K A;  2B39 A;  4LNV A;  4EL8 A;  2ZZR A;  4AYR A;  4D4D A;  3W7X A;  5CD2 A;  4AYP A;  5AGD A;  1WU6 A;  3HXF B;  1FO2 A;  3W7W A;  4KTP A;  3W7S A;  2FUZ A;  3M74 A;  2BB5 A;  3HXE B;  3E37 B;  1TNU B;  4V1S A;  2FBA A;  2EAE A;  2OKX A;  3P2C A;  3QT3 A;  1C3D A;  2QNO A;  3Q79 B;  3M7E A;  3PZ4 B;  1LD7 B;  4EHM B;  1FO3 A;  3QRY A;  2WY8 A;  1D8E B;  2JF4 A;  5KKB A;  2WYN A;  1GHQ A;  2A8Z A;  4GTR B;  2GH4 A;  2DRO A;  1H39 A;  1N4S B;  3QT9 A;  2SQC A;  1O6Q A;  3S4D A;  4J5T A;  3SFX B;  3M77 A;  4BOJ A;  1CLC A;  1V7X A;  4WVC A;  1V7W A;  2PN5 A;  1V5C A;  2DRS A;  3GT5 A;  4GTV B;  3WC3 A;  1QSJ A;  4KTR A;  4GTM B;  3D5S A;  4YDE B;  1IA6 A;  2GOX A;  3H7L A;  4ZRP A;  3DSX B;  1GXM A;  1HZF A;  3WIQ A;  2V8J A;  3WKF A;  3TF4 A;  3DSS B;  1JCQ B;  1KZP B;  1IA7 A;  2WII B;  2ZIR B;  3QPF A;  1LTX B;  1H54 A;  2G02 A;  2F0Y B;  1FP3 A;  5JPN B;  2FV0 A;  1VD5 A;  2WY7 A;  3WUX A;  3S4C A;  1FBO A;  3HXD B;  4ZH5 A;  3KLS A;  2FV1 A;  3KSL B;  1GA2 A;  1UMP A;  4ZG8 A;  3RX7 A;  3C72 B;  3M7C A;  3PZ2 B;  3REN A;  3KQ4 A;  3DPY B;  1HCU A;  3CU7 A;  3S4B A;  3SDT A;  1KFG A;  1H36 A;  1FAE A;  3KSQ B;  3M76 A;  3M73 A;  3ANK A;  1SQC A;  2AHG A;  3OXU A;  1KSD A;  1N4Q B;  1N9A B;  3W7T A;  2JJB A;  4YCR A;  3VW5 A;  5DGR A;  1NC5 A;  3CIH A;  1JCR B;  2D8L A;  1FMI A;  1DCE B;  1FT2 B;  4KKJ A;  3GLY A;  4L0G A;  4DOD A;  1LF6 A;  1H3A A;  3S4A A;  3EU8 A;  2H6F B;  2V8I A;  4XUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...