3D5SA

Crystal structure of efb-c (r131a) / c3d complex
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
297
structure length
297
Chain Sequence
GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/toxin
molecule keywords Complement C3
publication title Electrostatic contributions drive the interaction between Staphylococcus aureus protein Efb-C and its complement target C3d.
pubmed doi rcsb
source organism Homo sapiens
total genus 117
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3d5sA00
3DSTB 4D4BA 1N4PB 4BOKA 1JCSB 2V8KA 4GTTB 1D8DB 1H3AA 4V1RA 4ZH1A 4M76A 5FO7B 1UMPA 3D5SA 1KZPB 3E32B 4YDEB 3G6JB 1N4QB 4GTVB 2F0YB 1TNYB 1TNZB 2H6GB 4ONTA 1N9AB 4LNVA 5FO9B 3OEDA 3DPYB 3KSLB 4GTRB 1O6RA 1TN8B 3DSUB 4FXGB 2NOJA 3DSSB 1GSZA 1MZCB 4MBGB 1TN6B 2R2LB 2V8IA 1JCRB 1H3BA 2V3NA 3PZ4B 1SA5B 3C72B 2H6HB 2PN5A 3KSQB 1H3CA 2A73B 3Q7FB 3KLSA 1N4RB 4EHMB 1JCQB 3Q7AB 4KKJA 1FT1B 1W6KA 3KQ4A 1S63B 1O1SB 1O5MB 1LD7B 1D8EB 2XQWA 1O6HA 3D5RA 4LNGB 3Q78B 5JPNB 3E33B 2SQCA 1QQFA 1TNUB 2H6IB 3SQCA 3OXUA 4ZRQA 1NL4B 1S64B 1N94B 5AGDA 1O1TB 2G0DA 1O6QA 2WY7A 2XWJB 1HZFA 3DSVB 3DSWB 4BOJA 2PMVA 5FOBB 2WY8A 2BBCA 2ZISB 3Q73B 1H36A 1QBQB 1NI1B 4MU9A 1FPPB 1R76A 3E30B 2WINB 3K7XA 1H37A 1C3DA 2WIIB 1QSJA 3DSXB 3E37B 1DCEB 4FXKB 4D4AA 1X81B 1H39A 2IEJB 3HXFB 1H35A 3Q79B 1N4SB 2V8JA 1W6JA 3CU7A 4GTPB 1N95B 1O1RB 1TN7B 3HXDB 4GTQB 3HXCB 3RJ3A 3E34B 4GTOB 3HXEB 4D94A 4LNBB 4KKIA 1GXOA 1O79A 2BB6A 2B39A 5FO8B 2GOXA 5JPMB 2XWBB 2BB5A 1GXNA 2V3PA 4D4CA 4V1SA 3SFYB 2H6FB 1GHQA 1TNBB 3EU5B 4YDOB 4GTSB 3SFXB 4GTMB 2G02A 1TNOB 1LTXB 1FT2B 3PZ3B 4C1SA 3HXBB 2ZIRB 4L9PB 2I07B 3DRAB 1KZOB 4D4DA 1SQCA 3PZ2B 4ZRPA 1LD8B 3EUVB 1GXMA 3PZ1B 1SA4B 2BEDB 3Q75B
chains in the Genus database with same CATH superfamily
4BOKA 2V8KA 3M7BA 1D8DB 4V1RA 4M76A 3D5SA 1HM2A 1N4QB 4GTVB 5ILIA 3W7XA 3S9VA 2H6GB 2RI9A 1RWCA 4AYRA 3QSPA 3WC3A 3M71A 1NC5A 4CE7A 3W7SA 4GTRB 2J5CA 1N7PA 3S4BA 5M7IA 5CA3A 4TXTA 1MZCB 1KWFA 1FCEA 1X9DA 1V7VA 5C05A 3N0FA 2VN4A 1H14A 3H3KA 1FBOA 3QRYA 2EADA 2PN5A 3RENA 3PMMA 1H12A 2A73B 2F6DA 3M74A 5IL8A 2AHGA 1LF6A 3M7LA 1FT1B 1S63B 1EGUA 3SDTA 1D8EB 3WIRA 3D5RA 2VN7A 3SQCA 1HM3A 1S64B 2OKXA 1HXCA 1O1TB 1H54A 2G0DA 1HZFA 2WCOA 3GZKA 3RSYA 3A0OA 2WY8A 2BBCA 1UT9A 1HXGA 1QBQB 1KREA 2ONGA 4L0GA 3M7EA 3RRSA 3E30B 4FUSA 4AYPA 2FUQA 3E37B 2FUZA 3QPFA 1N4SB 2V8JA 1W6JA 3CU7A 1N95B 2EACA 3HXDB 5ILKA 5E2JA 3RJ3A 2BB6A 5JPMB 2BB5A 1CEMA 2V3PA 4D4CA 4V1SA 1N7QA 3SFYB 2ZBLA 4FNVA 1TNBB 4AYQA 1KSDA 3RX7A 2G02A 1TNOB 1LOHA 4CJ0A 1HMWA 3PZ3B 1RWHA 4L9PB 3PZ2B 3SDQA 3H7LA 1NXCA 3ANJA 2FBAA 3Q75B 5IKAA 1FO2A 4MMIA 3DSTB 1N7NA 1F1SA 1J0NA 1JCSB 3M72A 4OJZA 1N22A 3VW5A 3S4DA 4F10A 1IS9A 1UMPA 4YDEB 2DROA 3G4DA 1TNYB 5EATA 2Z07A 1N9AB 4KTPA 1F9DA 5GY3A 3KSLB 1FP3A 2NOJA 1FO3A 4KTRA 1GSZA 3M76A 4DOEA 4MBGB 1C82A 1KS8A 2B4FA 1V7WA 5IK0A 1SA5B 2FV0A 3C72B 1HV6A 1X1IA 3KLSA 3QDEA 4Z4JA 3W7UA 2P0VA 1JCQB 3Q7AB 5KKBA 1W6KA 5EAUA 1N23A 1O1SB 1O5MB 1WU6A 2XQWA 3QFYA 4ZH5A 1O6HA 4RNQA 4LNGB 4E1YA 1LF9A 1QQFA 3WUXA 2H6IB 3QT3A 1RW9A 3W7TA 2QNOA 1L2AA 2WY7A 2XWJB 3WKIA 3ACTA 2RI8A 1GLMA 5FOBB 3G4FA 2ZISB 2FV1A 3E7JA 3SDRA 1IA6A 3EQAA 2BRPA 5ILJA 1H37A 4FXKB 4D4AA 5ILHA 2IEJB 3W7WA 1H35A 1V5CA 4WVCA 1KFGA 1TN7B 1H13A 3PYBA 3A3VA 1N24A 3E34B 1G6IA 4GL3A 1O79A 4ZG8A 2XWBB 3ACSA 2JJBA 2H6FB 1GHQA 3EU5B 4YDOB 4GTSB 4LIXA 5ILDA 1JS4A 1F9OA 1VD5A 3P5RA 1TF4A 1W3YA 4CJ1A 2EAEA 2X03A 1FT2B 3HXBB 2GZ6A 2ZIRB 3DRAB 4D4DA 4Z4LA 1LXKA 1KSCA 3EUVB 1CB8A 5IK6A 1SA4B 2BEDB 4JJJA 3W5NA 4F13A 1N7RA 1N4PB 1LXMA 4L6XA 4GTTB 5ILYA 1OJPA 1OJNA 4ZH1A 1HCUA 3E32B 2F0YB 3ANKA 3T33A 4LNVA 2ONHA 4J5TA 3SDUA 5FO9B 1G9JA 3DPYB 1HN0A 4FXGB 4DODA 4OZVA 5EASA 1KKTA 1XWQA 5GZKA 2R2LB 4XUVA 1WU5A 2V3NA 3PZ4B 3SAEA 3EZ8A 3P2CA 2Q1FA 1ULVA 4MMHA 2BRWA 4FJQA 3K11A 3KSQB 1GA2A 1H3CA 4EHMB 1HX9A 3KQ4A 1RWAA 1LD7B 1WU4A 2WDAA 3Q78B 5JPNB 3RX5A 3E73A 1XW2A 5IL3A 1HXAA 3OXUA 1NL4B 4ZRQA 5GW7A 3H2WA 1N94B 5AGDA 1XWTA 1O6QA 5DGQA 1N7OA 3E6UA 3DSWB 1RWGA 3Q73B 1N1ZA 3VSNA 3M00A 3M02A 1FPPB 1R76A 2WINB 1OJOA 1C3DA 2WIIB 1CLCA 2ZZRA 1DCEB 1V7XA 1G9GA 3NFVA 1X81B 1H39A 3WKFA 3WKHA 3HXFB 3Q79B 4GTPB 3ANIA 3E80A 1F9GA 2WYNA 4GTQB 3WKGA 3HXCB 1DL2A 4GTOB 3HXEB 2AHFA 3ON6A 4KKIA 1GXOA 2FUTA 1GXNA 2E22A 3S4CA 3SFXB 1K72A 3SDVA 3M78A 1FMIA 4GTMB 2AFAA 1WZZA 1N21A 1IA7A 1LTXB 2A8ZA 4WVBA 4C1SA 3PYAA 4OK4A 3S4AA 2I07B 5IK9A 4EL8A 1SQCA 4ZRPA 1GAHA 2RGKA 1LD8B 1GXMA 2JG0A 4D4BA 4QT9A 2JF4A 1GAIA 3NNBA 1UG9A 1AYXA 1H3AA 5FO7B 1KZPB 3G6JB 3QG0A 1KRFA 1TNZB 4ONTA 1DOGA 3P5PA 1L1YA 3OEDA 1O6RA 1TN8B 3DSUB 3DSSB 3M77A 4WVAA 1TN6B 5MEHA 2V8IA 2YIKA 1JCRB 1H3BA 4DI5A 1QAZA 2H6HB 4GAXA 1I8QA 4OZWA 3M75A 3QXQA 4NEIA 2DRRA 3EU8A 2BRVX 3Q7FB 4WU0A 1N4RB 4KKJA 2E24A 1V5DA 3VXDA 5IM1A 4YCRA 3M73A 3E33B 2SQCA 1TNUB 5DHKA 1FAEA 5IKHA 5ILZA 2D5JA 2NVPA 2EABA 1X1JA 3DSVB 3W5MA 4BOJA 3D3IA 3N0GA 2PMVA 4TF4A 3QT9A 3LZ9A 1G87A 1AGMA 5CZLA 1H36A 1NI1B 4MU9A 2DRSA 3VSMA 3K7XA 5JMFA 1N20A 1X1HA 1QSJA 3DSXB 2D8LA 3CIHA 4Q2BA 3M01A 1O1RB 4Q88A 3QXFA 3QFZA 4D94A 4LNBB 3RX8A 2B39A 5DGRA 3X17A 2GOXA 2XFGA 3GLYA 5FO8B 5CD2A 1RQ5A 2DRQA 2CQTA 3AFLA 3TF4A 1J0MA 2CQSA 5M7YA 3WIWA 3M7CA 3AFJA 4OK2A 1OJMA 1KZOB 5DHIA 3GT5A 1FBWA 1HMUA 1N1BA 2GH4A 4AYOA 5JMDA 3WIQA 3QWTA 3PZ1B 1RWFA
chains in the Genus database with same CATH topology
4BOKA 2V8KA 3M7BA 1D8DB 4V1RA 4M76A 3D5SA 1N4QB 4GTVB 3W7XA 3S9VA 2H6GB 2RI9A 4AYRA 3QSPA 3WC3A 3M71A 1NC5A 4CE7A 3W7SA 4GTRB 3S4BA 5M7IA 5CA3A 4TXTA 1MZCB 1KWFA 1FCEA 1X9DA 1V7VA 2VN4A 1H14A 3H3KA 1FBOA 3QRYA 2EADA 2PN5A 3RENA 3PMMA 1H12A 2A73B 2F6DA 3M74A 2AHGA 1LF6A 3M7LA 1FT1B 1S63B 3SDTA 1D8EB 3WIRA 3D5RA 2VN7A 3SQCA 1S64B 2OKXA 1O1TB 1H54A 2G0DA 1HZFA 3GZKA 3RSYA 2WY8A 2BBCA 1UT9A 1QBQB 1KREA 4L0GA 3M7EA 3RRSA 3E30B 4FUSA 4AYPA 3E37B 2FUZA 3QPFA 1N4SB 2V8JA 1W6JA 3CU7A 1N95B 2EACA 3HXDB 5E2JA 3RJ3A 2BB6A 5JPMB 2BB5A 1CEMA 2V3PA 4D4CA 4V1SA 3SFYB 4AYQA 2ZBLA 1TNBB 1KSDA 3RX7A 2G02A 1TNOB 4CJ0A 3PZ3B 4L9PB 3PZ2B 3SDQA 3H7LA 1NXCA 3ANJA 2FBAA 3Q75B 1FO2A 3DSTB 1JCSB 3M72A 3VW5A 3S4DA 1IS9A 1UMPA 4YDEB 2DROA 1TNYB 2Z07A 1N9AB 4KTPA 1F9DA 5GY3A 3KSLB 1FP3A 2NOJA 1FO3A 4KTRA 1GSZA 3M76A 4DOEA 4MBGB 1KS8A 2B4FA 1V7WA 1SA5B 2FV0A 3C72B 3KLSA 3QDEA 4Z4JA 3W7UA 2P0VA 1JCQB 3Q7AB 5KKBA 1W6KA 1O1SB 1O5MB 1WU6A 2XQWA 3QFYA 4ZH5A 1O6HA 4LNGB 1LF9A 1QQFA 3WUXA 2H6IB 3QT3A 3W7TA 2QNOA 1L2AA 2WY7A 2XWJB 3WKIA 3ACTA 2RI8A 1GLMA 5FOBB 2ZISB 2FV1A 3SDRA 1IA6A 3EQAA 1H37A 4FXKB 4D4AA 2IEJB 3W7WA 1H35A 1V5CA 4WVCA 1KFGA 1TN7B 1H13A 3PYBA 3A3VA 3E34B 1G6IA 4GL3A 1O79A 4ZG8A 2XWBB 3ACSA 2JJBA 2H6FB 1GHQA 3EU5B 4YDOB 4GTSB 4LIXA 1JS4A 1F9OA 1VD5A 3P5RA 1TF4A 4CJ1A 2EAEA 1FT2B 3HXBB 2GZ6A 2ZIRB 3DRAB 4D4DA 4Z4LA 1KSCA 3EUVB 1SA4B 2BEDB 4JJJA 3W5NA 1N4PB 4L6XA 4GTTB 4ZH1A 1HCUA 3E32B 2F0YB 3ANKA 3T33A 4LNVA 4J5TA 3SDUA 5FO9B 1G9JA 3DPYB 4FXGB 4DODA 1KKTA 1XWQA 5GZKA 2R2LB 4XUVA 1WU5A 2V3NA 3PZ4B 3SAEA 3EZ8A 3P2CA 1ULVA 3K11A 3KSQB 1GA2A 1H3CA 4EHMB 3KQ4A 1LD7B 1WU4A 3Q78B 5JPNB 3RX5A 3E73A 1XW2A 3OXUA 4ZRQA 1NL4B 5GW7A 3H2WA 1N94B 5AGDA 1XWTA 1O6QA 5DGQA 3E6UA 3DSWB 3Q73B 1FPPB 1R76A 2WINB 1C3DA 2WIIB 1CLCA 2ZZRA 1DCEB 1V7XA 1G9GA 1X81B 1H39A 3WKFA 3WKHA 3HXFB 3Q79B 4GTPB 3ANIA 2WYNA 4GTQB 3WKGA 3HXCB 1DL2A 4GTOB 3HXEB 2AHFA 3ON6A 4KKIA 1GXOA 1GXNA 3S4CA 3SFXB 1K72A 3SDVA 3M78A 1FMIA 4GTMB 2AFAA 1WZZA 1IA7A 1LTXB 2A8ZA 4WVBA 4C1SA 3PYAA 3S4AA 2I07B 4EL8A 1SQCA 4ZRPA 1GAHA 2RGKA 1LD8B 1GXMA 2JG0A 4D4BA 4QT9A 2JF4A 1GAIA 1UG9A 1AYXA 1H3AA 5FO7B 1KZPB 3G6JB 3QG0A 1KRFA 1TNZB 4ONTA 1DOGA 3P5PA 1L1YA 3OEDA 1O6RA 1TN8B 3DSUB 3DSSB 3M77A 4WVAA 1TN6B 5MEHA 2V8IA 2YIKA 1JCRB 1H3BA 2H6HB 3M75A 3QXQA 2DRRA 3EU8A 3Q7FB 4WU0A 1N4RB 4KKJA 1V5DA 3VXDA 4YCRA 3M73A 3E33B 2SQCA 1TNUB 1FAEA 2D5JA 2NVPA 2EABA 3DSVB 3W5MA 4BOJA 3D3IA 2PMVA 4TF4A 3QT9A 1G87A 1AGMA 5CZLA 1H36A 1NI1B 4MU9A 2DRSA 3K7XA 1QSJA 3DSXB 2D8LA 3CIHA 4Q2BA 1O1RB 4Q88A 3QXFA 3QFZA 4D94A 4LNBB 3RX8A 2B39A 5DGRA 3X17A 2GOXA 3GLYA 2XFGA 5FO8B 5CD2A 1RQ5A 2DRQA 2CQTA 3TF4A 2CQSA 5M7YA 3WIWA 3M7CA 3AFJA 1KZOB 3GT5A 1FBWA 2GH4A 4AYOA 3WIQA 3QWTA 3PZ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DST B;  4D4B A;  1N4P B;  4BOK A;  1JCS B;  2V8K A;  4GTT B;  1D8D B;  1H3A A;  4V1R A;  4ZH1 A;  4M76 A;  5FO7 B;  1UMP A;  3D5S A;  1KZP B;  3E32 B;  4YDE B;  3G6J B;  1N4Q B;  4GTV B;  2F0Y B;  1TNY B;  1TNZ B;  2H6G B;  4ONT A;  1N9A B;  4LNV A;  5FO9 B;  3OED A;  3DPY B;  3KSL B;  4GTR B;  1O6R A;  1TN8 B;  3DSU B;  4FXG B;  2NOJ A;  3DSS B;  1GSZ A;  1MZC B;  4MBG B;  1TN6 B;  2R2L B;  2V8I A;  1JCR B;  1H3B A;  2V3N A;  3PZ4 B;  1SA5 B;  3C72 B;  2H6H B;  2PN5 A;  3KSQ B;  1H3C A;  2A73 B;  3Q7F B;  3KLS A;  1N4R B;  4EHM B;  1JCQ B;  3Q7A B;  4KKJ A;  1FT1 B;  1W6K A;  3KQ4 A;  1S63 B;  1O1S B;  1O5M B;  1LD7 B;  1D8E B;  2XQW A;  1O6H A;  3D5R A;  4LNG B;  3Q78 B;  5JPN B;  3E33 B;  2SQC A;  1QQF A;  1TNU B;  2H6I B;  3SQC A;  3OXU A;  4ZRQ A;  1NL4 B;  1S64 B;  1N94 B;  5AGD A;  1O1T B;  2G0D A;  1O6Q A;  2WY7 A;  2XWJ B;  1HZF A;  3DSV B;  3DSW B;  4BOJ A;  2PMV A;  5FOB B;  2WY8 A;  2BBC A;  2ZIS B;  3Q73 B;  1H36 A;  1QBQ B;  1NI1 B;  4MU9 A;  1FPP B;  1R76 A;  3E30 B;  2WIN B;  3K7X A;  1H37 A;  1C3D A;  2WII B;  1QSJ A;  3DSX B;  3E37 B;  1DCE B;  4FXK B;  4D4A A;  1X81 B;  1H39 A;  2IEJ B;  3HXF B;  1H35 A;  3Q79 B;  1N4S B;  2V8J A;  1W6J A;  3CU7 A;  4GTP B;  1N95 B;  1O1R B;  1TN7 B;  3HXD B;  4GTQ B;  3HXC B;  3RJ3 A;  3E34 B;  4GTO B;  3HXE B;  4D94 A;  4LNB B;  4KKI A;  1GXO A;  1O79 A;  2BB6 A;  2B39 A;  5FO8 B;  2GOX A;  5JPM B;  2XWB B;  2BB5 A;  1GXN A;  2V3P A;  4D4C A;  4V1S A;  3SFY B;  2H6F B;  1GHQ A;  1TNB B;  3EU5 B;  4YDO B;  4GTS B;  3SFX B;  4GTM B;  2G02 A;  1TNO B;  1LTX B;  1FT2 B;  3PZ3 B;  4C1S A;  3HXB B;  2ZIR B;  4L9P B;  2I07 B;  3DRA B;  1KZO B;  4D4D A;  1SQC A;  3PZ2 B;  4ZRP A;  1LD8 B;  3EUV B;  1GXM A;  3PZ1 B;  1SA4 B;  2BED B;  3Q75 B; 
#chains in the Genus database with same CATH topology
 4BOK A;  2V8K A;  3M7B A;  1D8D B;  4V1R A;  4M76 A;  3D5S A;  1HM2 A;  1N4Q B;  4GTV B;  5ILI A;  3W7X A;  3S9V A;  2H6G B;  2RI9 A;  1RWC A;  4AYR A;  3QSP A;  3WC3 A;  3M71 A;  1NC5 A;  4CE7 A;  3W7S A;  4GTR B;  2J5C A;  1N7P A;  3S4B A;  5M7I A;  5CA3 A;  4TXT A;  1MZC B;  1KWF A;  1FCE A;  1X9D A;  1V7V A;  5C05 A;  3N0F A;  2VN4 A;  1H14 A;  3H3K A;  1FBO A;  3QRY A;  2EAD A;  2PN5 A;  3REN A;  3PMM A;  1H12 A;  2A73 B;  2F6D A;  3M74 A;  5IL8 A;  2AHG A;  1LF6 A;  3M7L A;  1FT1 B;  1S63 B;  1EGU A;  3SDT A;  1D8E B;  3WIR A;  3D5R A;  2VN7 A;  3SQC A;  1HM3 A;  1S64 B;  2OKX A;  1HXC A;  1O1T B;  1H54 A;  2G0D A;  1HZF A;  2WCO A;  3GZK A;  3RSY A;  3A0O A;  2WY8 A;  2BBC A;  1UT9 A;  1HXG A;  1QBQ B;  1KRE A;  2ONG A;  4L0G A;  3M7E A;  3RRS A;  3E30 B;  4FUS A;  4AYP A;  2FUQ A;  3E37 B;  2FUZ A;  3QPF A;  1N4S B;  2V8J A;  1W6J A;  3CU7 A;  1N95 B;  2EAC A;  3HXD B;  5ILK A;  5E2J A;  3RJ3 A;  2BB6 A;  5JPM B;  2BB5 A;  1CEM A;  2V3P A;  4D4C A;  4V1S A;  1N7Q A;  3SFY B;  2ZBL A;  4FNV A;  1TNB B;  4AYQ A;  1KSD A;  3RX7 A;  2G02 A;  1TNO B;  1LOH A;  4CJ0 A;  1HMW A;  3PZ3 B;  1RWH A;  4L9P B;  3PZ2 B;  3SDQ A;  3H7L A;  1NXC A;  3ANJ A;  2FBA A;  3Q75 B;  5IKA A;  1FO2 A;  4MMI A;  3DST B;  1N7N A;  1F1S A;  1J0N A;  1JCS B;  3M72 A;  4OJZ A;  1N22 A;  3VW5 A;  3S4D A;  4F10 A;  1IS9 A;  1UMP A;  4YDE B;  2DRO A;  3G4D A;  1TNY B;  5EAT A;  2Z07 A;  1N9A B;  4KTP A;  1F9D A;  5GY3 A;  3KSL B;  1FP3 A;  2NOJ A;  1FO3 A;  4KTR A;  1GSZ A;  3M76 A;  4DOE A;  4MBG B;  1C82 A;  1KS8 A;  2B4F A;  1V7W A;  5IK0 A;  1SA5 B;  2FV0 A;  3C72 B;  1HV6 A;  1X1I A;  3KLS A;  3QDE A;  4Z4J A;  3W7U A;  2P0V A;  1JCQ B;  3Q7A B;  5KKB A;  1W6K A;  5EAU A;  1N23 A;  1O1S B;  1O5M B;  1WU6 A;  2XQW A;  3QFY A;  4ZH5 A;  1O6H A;  4RNQ A;  4LNG B;  4E1Y A;  1LF9 A;  1QQF A;  3WUX A;  2H6I B;  3QT3 A;  1RW9 A;  3W7T A;  2QNO A;  1L2A A;  2WY7 A;  2XWJ B;  3WKI A;  3ACT A;  2RI8 A;  1GLM A;  5FOB B;  3G4F A;  2ZIS B;  2FV1 A;  3E7J A;  3SDR A;  1IA6 A;  3EQA A;  2BRP A;  5ILJ A;  1H37 A;  4FXK B;  4D4A A;  5ILH A;  2IEJ B;  3W7W A;  1H35 A;  1V5C A;  4WVC A;  1KFG A;  1TN7 B;  1H13 A;  3PYB A;  3A3V A;  1N24 A;  3E34 B;  1G6I A;  4GL3 A;  1O79 A;  4ZG8 A;  2XWB B;  3ACS A;  2JJB A;  2H6F B;  1GHQ A;  3EU5 B;  4YDO B;  4GTS B;  4LIX A;  5ILD A;  1JS4 A;  1F9O A;  1VD5 A;  3P5R A;  1TF4 A;  1W3Y A;  4CJ1 A;  2EAE A;  2X03 A;  1FT2 B;  3HXB B;  2GZ6 A;  2ZIR B;  3DRA B;  4D4D A;  4Z4L A;  1LXK A;  1KSC A;  3EUV B;  1CB8 A;  5IK6 A;  1SA4 B;  2BED B;  4JJJ A;  3W5N A;  4F13 A;  1N7R A;  1N4P B;  1LXM A;  4L6X A;  4GTT B;  5ILY A;  1OJP A;  1OJN A;  4ZH1 A;  1HCU A;  3E32 B;  2F0Y B;  3ANK A;  3T33 A;  4LNV A;  2ONH A;  4J5T A;  3SDU A;  5FO9 B;  1G9J A;  3DPY B;  1HN0 A;  4FXG B;  4DOD A;  4OZV A;  5EAS A;  1KKT A;  1XWQ A;  5GZK A;  2R2L B;  4XUV A;  1WU5 A;  2V3N A;  3PZ4 B;  3SAE A;  3EZ8 A;  3P2C A;  2Q1F A;  1ULV A;  4MMH A;  2BRW A;  4FJQ A;  3K11 A;  3KSQ B;  1GA2 A;  1H3C A;  4EHM B;  1HX9 A;  3KQ4 A;  1RWA A;  1LD7 B;  1WU4 A;  2WDA A;  3Q78 B;  5JPN B;  3RX5 A;  3E73 A;  1XW2 A;  5IL3 A;  1HXA A;  3OXU A;  1NL4 B;  4ZRQ A;  5GW7 A;  3H2W A;  1N94 B;  5AGD A;  1XWT A;  1O6Q A;  5DGQ A;  1N7O A;  3E6U A;  3DSW B;  1RWG A;  3Q73 B;  1N1Z A;  3VSN A;  3M00 A;  3M02 A;  1FPP B;  1R76 A;  2WIN B;  1OJO A;  1C3D A;  2WII B;  1CLC A;  2ZZR A;  1DCE B;  1V7X A;  1G9G A;  3NFV A;  1X81 B;  1H39 A;  3WKF A;  3WKH A;  3HXF B;  3Q79 B;  4GTP B;  3ANI A;  3E80 A;  1F9G A;  2WYN A;  4GTQ B;  3WKG A;  3HXC B;  1DL2 A;  4GTO B;  3HXE B;  2AHF A;  3ON6 A;  4KKI A;  1GXO A;  2FUT A;  1GXN A;  2E22 A;  3S4C A;  3SFX B;  1K72 A;  3SDV A;  3M78 A;  1FMI A;  4GTM B;  2AFA A;  1WZZ A;  1N21 A;  1IA7 A;  1LTX B;  2A8Z A;  4WVB A;  4C1S A;  3PYA A;  4OK4 A;  3S4A A;  2I07 B;  5IK9 A;  4EL8 A;  1SQC A;  4ZRP A;  1GAH A;  2RGK A;  1LD8 B;  1GXM A;  2JG0 A;  4D4B A;  4QT9 A;  2JF4 A;  1GAI A;  3NNB A;  1UG9 A;  1AYX A;  1H3A A;  5FO7 B;  1KZP B;  3G6J B;  3QG0 A;  1KRF A;  1TNZ B;  4ONT A;  1DOG A;  3P5P A;  1L1Y A;  3OED A;  1O6R A;  1TN8 B;  3DSU B;  3DSS B;  3M77 A;  4WVA A;  1TN6 B;  5MEH A;  2V8I A;  2YIK A;  1JCR B;  1H3B A;  4DI5 A;  1QAZ A;  2H6H B;  4GAX A;  1I8Q A;  4OZW A;  3M75 A;  3QXQ A;  4NEI A;  2DRR A;  3EU8 A;  2BRV X;  3Q7F B;  4WU0 A;  1N4R B;  4KKJ A;  2E24 A;  1V5D A;  3VXD A;  5IM1 A;  4YCR A;  3M73 A;  3E33 B;  2SQC A;  1TNU B;  5DHK A;  1FAE A;  5IKH A;  5ILZ A;  2D5J A;  2NVP A;  2EAB A;  1X1J A;  3DSV B;  3W5M A;  4BOJ A;  3D3I A;  3N0G A;  2PMV A;  4TF4 A;  3QT9 A;  3LZ9 A;  1G87 A;  1AGM A;  5CZL A;  1H36 A;  1NI1 B;  4MU9 A;  2DRS A;  3VSM A;  3K7X A;  5JMF A;  1N20 A;  1X1H A;  1QSJ A;  3DSX B;  2D8L A;  3CIH A;  4Q2B A;  3M01 A;  1O1R B;  4Q88 A;  3QXF A;  3QFZ A;  4D94 A;  4LNB B;  3RX8 A;  2B39 A;  5DGR A;  3X17 A;  2GOX A;  2XFG A;  3GLY A;  5FO8 B;  5CD2 A;  1RQ5 A;  2DRQ A;  2CQT A;  3AFL A;  3TF4 A;  1J0M A;  2CQS A;  5M7Y A;  3WIW A;  3M7C A;  3AFJ A;  4OK2 A;  1OJM A;  1KZO B;  5DHI A;  3GT5 A;  1FBW A;  1HMU A;  1N1B A;  2GH4 A;  4AYO A;  5JMD A;  3WIQ A;  3QWT A;  3PZ1 B;  1RWF A; 
#chains in the Genus database with same CATH homology
 4BOK A;  2V8K A;  3M7B A;  1D8D B;  4V1R A;  4M76 A;  3D5S A;  1N4Q B;  4GTV B;  3W7X A;  3S9V A;  2H6G B;  2RI9 A;  4AYR A;  3QSP A;  3WC3 A;  3M71 A;  1NC5 A;  4CE7 A;  3W7S A;  4GTR B;  3S4B A;  5M7I A;  5CA3 A;  4TXT A;  1MZC B;  1KWF A;  1FCE A;  1X9D A;  1V7V A;  2VN4 A;  1H14 A;  3H3K A;  1FBO A;  3QRY A;  2EAD A;  2PN5 A;  3REN A;  3PMM A;  1H12 A;  2A73 B;  2F6D A;  3M74 A;  2AHG A;  1LF6 A;  3M7L A;  1FT1 B;  1S63 B;  3SDT A;  1D8E B;  3WIR A;  3D5R A;  2VN7 A;  3SQC A;  1S64 B;  2OKX A;  1O1T B;  1H54 A;  2G0D A;  1HZF A;  3GZK A;  3RSY A;  2WY8 A;  2BBC A;  1UT9 A;  1QBQ B;  1KRE A;  4L0G A;  3M7E A;  3RRS A;  3E30 B;  4FUS A;  4AYP A;  3E37 B;  2FUZ A;  3QPF A;  1N4S B;  2V8J A;  1W6J A;  3CU7 A;  1N95 B;  2EAC A;  3HXD B;  5E2J A;  3RJ3 A;  2BB6 A;  5JPM B;  2BB5 A;  1CEM A;  2V3P A;  4D4C A;  4V1S A;  3SFY B;  4AYQ A;  2ZBL A;  1TNB B;  1KSD A;  3RX7 A;  2G02 A;  1TNO B;  4CJ0 A;  3PZ3 B;  4L9P B;  3PZ2 B;  3SDQ A;  3H7L A;  1NXC A;  3ANJ A;  2FBA A;  3Q75 B;  1FO2 A;  3DST B;  1JCS B;  3M72 A;  3VW5 A;  3S4D A;  1IS9 A;  1UMP A;  4YDE B;  2DRO A;  1TNY B;  2Z07 A;  1N9A B;  4KTP A;  1F9D A;  5GY3 A;  3KSL B;  1FP3 A;  2NOJ A;  1FO3 A;  4KTR A;  1GSZ A;  3M76 A;  4DOE A;  4MBG B;  1KS8 A;  2B4F A;  1V7W A;  1SA5 B;  2FV0 A;  3C72 B;  3KLS A;  3QDE A;  4Z4J A;  3W7U A;  2P0V A;  1JCQ B;  3Q7A B;  5KKB A;  1W6K A;  1O1S B;  1O5M B;  1WU6 A;  2XQW A;  3QFY A;  4ZH5 A;  1O6H A;  4LNG B;  1LF9 A;  1QQF A;  3WUX A;  2H6I B;  3QT3 A;  3W7T A;  2QNO A;  1L2A A;  2WY7 A;  2XWJ B;  3WKI A;  3ACT A;  2RI8 A;  1GLM A;  5FOB B;  2ZIS B;  2FV1 A;  3SDR A;  1IA6 A;  3EQA A;  1H37 A;  4FXK B;  4D4A A;  2IEJ B;  3W7W A;  1H35 A;  1V5C A;  4WVC A;  1KFG A;  1TN7 B;  1H13 A;  3PYB A;  3A3V A;  3E34 B;  1G6I A;  4GL3 A;  1O79 A;  4ZG8 A;  2XWB B;  3ACS A;  2JJB A;  2H6F B;  1GHQ A;  3EU5 B;  4YDO B;  4GTS B;  4LIX A;  1JS4 A;  1F9O A;  1VD5 A;  3P5R A;  1TF4 A;  4CJ1 A;  2EAE A;  1FT2 B;  3HXB B;  2GZ6 A;  2ZIR B;  3DRA B;  4D4D A;  4Z4L A;  1KSC A;  3EUV B;  1SA4 B;  2BED B;  4JJJ A;  3W5N A;  1N4P B;  4L6X A;  4GTT B;  4ZH1 A;  1HCU A;  3E32 B;  2F0Y B;  3ANK A;  3T33 A;  4LNV A;  4J5T A;  3SDU A;  5FO9 B;  1G9J A;  3DPY B;  4FXG B;  4DOD A;  1KKT A;  1XWQ A;  5GZK A;  2R2L B;  4XUV A;  1WU5 A;  2V3N A;  3PZ4 B;  3SAE A;  3EZ8 A;  3P2C A;  1ULV A;  3K11 A;  3KSQ B;  1GA2 A;  1H3C A;  4EHM B;  3KQ4 A;  1LD7 B;  1WU4 A;  3Q78 B;  5JPN B;  3RX5 A;  3E73 A;  1XW2 A;  3OXU A;  4ZRQ A;  1NL4 B;  5GW7 A;  3H2W A;  1N94 B;  5AGD A;  1XWT A;  1O6Q A;  5DGQ A;  3E6U A;  3DSW B;  3Q73 B;  1FPP B;  1R76 A;  2WIN B;  1C3D A;  2WII B;  1CLC A;  2ZZR A;  1DCE B;  1V7X A;  1G9G A;  1X81 B;  1H39 A;  3WKF A;  3WKH A;  3HXF B;  3Q79 B;  4GTP B;  3ANI A;  2WYN A;  4GTQ B;  3WKG A;  3HXC B;  1DL2 A;  4GTO B;  3HXE B;  2AHF A;  3ON6 A;  4KKI A;  1GXO A;  1GXN A;  3S4C A;  3SFX B;  1K72 A;  3SDV A;  3M78 A;  1FMI A;  4GTM B;  2AFA A;  1WZZ A;  1IA7 A;  1LTX B;  2A8Z A;  4WVB A;  4C1S A;  3PYA A;  3S4A A;  2I07 B;  4EL8 A;  1SQC A;  4ZRP A;  1GAH A;  2RGK A;  1LD8 B;  1GXM A;  2JG0 A;  4D4B A;  4QT9 A;  2JF4 A;  1GAI A;  1UG9 A;  1AYX A;  1H3A A;  5FO7 B;  1KZP B;  3G6J B;  3QG0 A;  1KRF A;  1TNZ B;  4ONT A;  1DOG A;  3P5P A;  1L1Y A;  3OED A;  1O6R A;  1TN8 B;  3DSU B;  3DSS B;  3M77 A;  4WVA A;  1TN6 B;  5MEH A;  2V8I A;  2YIK A;  1JCR B;  1H3B A;  2H6H B;  3M75 A;  3QXQ A;  2DRR A;  3EU8 A;  3Q7F B;  4WU0 A;  1N4R B;  4KKJ A;  1V5D A;  3VXD A;  4YCR A;  3M73 A;  3E33 B;  2SQC A;  1TNU B;  1FAE A;  2D5J A;  2NVP A;  2EAB A;  3DSV B;  3W5M A;  4BOJ A;  3D3I A;  2PMV A;  4TF4 A;  3QT9 A;  1G87 A;  1AGM A;  5CZL A;  1H36 A;  1NI1 B;  4MU9 A;  2DRS A;  3K7X A;  1QSJ A;  3DSX B;  2D8L A;  3CIH A;  4Q2B A;  1O1R B;  4Q88 A;  3QXF A;  3QFZ A;  4D94 A;  4LNB B;  3RX8 A;  2B39 A;  5DGR A;  3X17 A;  2GOX A;  3GLY A;  2XFG A;  5FO8 B;  5CD2 A;  1RQ5 A;  2DRQ A;  2CQT A;  3TF4 A;  2CQS A;  5M7Y A;  3WIW A;  3M7C A;  3AFJ A;  1KZO B;  3GT5 A;  1FBW A;  2GH4 A;  4AYO A;  3WIQ A;  3QWT A;  3PZ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...