3WKFA

Crystal structure of cellobiose 2-epimerase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
407
structure length
407
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
total genus 162
structure length 407
sequence length 407
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkfA00
1KS8A 1FBOA 4KTRA 1V7XA 1KRFA 5CZLA 2DRQA 1F9DA 1AYXA 1L1YA 3E6UA 1KSDA 1XWQA 3S4CA 1CEMA 3S4DA 3S4AA 2EADA 3A3VA 1GLMA 3AFJA 3EZ8A 1WU5A 2DROA 1GAIA 1FAEA 2FUZA 5DGRA 3QT9A 1RQ5A 4AYRA 4DODA 3H2WA 1KKTA 1KWFA 1NXCA 1UG9A 2FV0A 4CJ0A 4L6XA 2JJBA 4FUSA 3W7SA 3QWTA 4CE7A 2RI8A 3K11A 1IA6A 3H7LA 3RSYA 2RI9A 1XWTA 3E73A 1H13A 1WZZA 2B4FA 2AHGA 4ZG8A 3WKFA 1DL2A 1X9DA 1CLCA 2WYNA 1G6IA 1WU6A 4WU0A 2EAEA 3QXQA 3RX7A 1XW2A 4TF4A 4WVCA 2CQTA 5GW7A 4TXTA 3RX5A 3QXFA 2AFAA 1H14A 4Q88A 1FP3A 3D3IA 5GY3A 4DOEA 3ANIA 2OKXA 1H12A 1V7WA 1V5DA 1KFGA 3RX8A 3PMMA 3H3KA 3WKGA 3WIRA 1H54A 1JS4A 2JF4A 3P2CA 3QFZA 5E2JA 1K72A 2NVPA 1FCEA 2VN4A 3W5MA 2D8LA 1ULVA 1GAHA 1FO2A 2A8ZA 1DOGA 2AHFA 1WU4A 2FV1A 1FMIA 2JG0A 3QDEA 1UT9A 1G9GA 5KKBA 2DRSA 2ZBLA 2D5JA 4WVBA 1VD5A 4Z4LA 5M7YA 4CJ1A 1V5CA 1KSCA 3ON6A 4J5TA 4XUVA 1GA2A 3QPFA 4AYOA 1LF6A 3W7XA 2RGKA 3QT3A 1LF9A 3GLYA 5MEHA 3W7UA 3T33A 3VW5A 3W7TA 2QNOA 1IA7A 2XFGA 4EL8A 5M7IA 1FBWA 1G9JA 4L0GA 2DRRA 3CIHA 1KREA 3QFYA 3W5NA 1F9OA 3WKIA 4JJJA 1TF4A 2GZ6A 3EQAA 3QSPA 3WC3A 1AGMA 5CD2A 2P0VA 4WVAA 2GH4A 2FBAA 1HCUA 2EABA 1IS9A 4Z4JA 3ANKA 4AYPA 3WIQA 2YIKA 3QRYA 3WIWA 5CA3A 2Z07A 3VXDA 3S4BA 3GZKA 1L2AA 2ZZRA 1V7VA 3GT5A 2EACA 3ACSA 4AYQA 4KTPA 1FO3A 1G87A 3RRSA 5DGQA 2F6DA 4Q2BA 3WKHA 3W7WA 3QG0A 3X17A 3TF4A 2VN7A 3WUXA 1NC5A 2CQSA 3RENA 3ANJA 3ACTA 4ZH5A
chains in the Genus database with same CATH superfamily
1FBOA 3PYBA 3D5SA 1GXNA 3G6JB 1N1BA 1N7OA 1AYXA 1XWQA 3S4CA 1O6RA 3OEDA 3DSSB 1GAIA 1RWHA 2H6FB 5DGRA 3QT9A 5IKHA 3H2WA 5FO7B 1KWFA 2ONHA 3KSQB 3M7BA 2JJBA 3NFVA 4D4AA 1C82A 3RSYA 3E73A 1HM3A 1H13A 4LIXA 1X9DA 1CLCA 3AFLA 2EAEA 3QXQA 4TF4A 1H3BA 2BRWA 2IEJB 1HX9A 3N0FA 5GW7A 2V8KA 5GZKA 3RX5A 3KSLB 1FP3A 4DOEA 3PMMA 3H3KA 1X1HA 3QFZA 5E2JA 2B39A 1CB8A 2WDAA 1RW9A 2D8LA 3M7CA 1H37A 1TNYB 4V1RA 1FMIA 1LOHA 5ILIA 4Z4LA 4LNGB 1GA2A 1LF6A 2RGKA 4KKJA 1O5MB 4YCRA 2E24A 3VW5A 3OXUA 1N94B 3DSVB 4GTRB 5M7IA 3PYAA 1FBWA 4FXKB 2BRVX 1LTXB 3CIHA 1F9OA 1NL4B 2H6IB 5CD2A 3EU8A 2P0VA 1TNOB 2GH4A 2XWJB 4Z4JA 1N20A 3QRYA 3WIWA 2G0DA 4GTSB 4OZVA 3EUVB 4GL3A 5ILYA 1UMPA 3GZKA 2ZZRA 5IK6A 1V7VA 1MZCB 2NOJA 2EACA 2G02A 4AYQA 1NI1B 1FO3A 1G87A 1HN0A 3WKHA 4YDOB 3W7WA 3M75A 2VN7A 1JCRB 4ZH1A 1H35A 2CQSA 1W6KA 1H3CA 3ACTA 3M77A 4ZH5A 1V7XA 4M76A 3M02A 1SA4B 1F9DA 3E6UA 1KSDA 3S4DA 3S4AA 1GLMA 1D8EB 1HXAA 2BB6A 1LD8B 5IKAA 1O1SB 3Q78B 1GXMA 1NXCA 2FV0A 2WINB 3VSNA 3PZ4B 3W7SA 1N24A 4F13A 4GTMB 1TN8B 1WZZA 2AHGA 3KLSA 1TNZB 3SDRA 4ZG8A 1WU6A 2V3PA 3RX7A 1XW2A 4WVCA 3CU7A 5IM1A 2BEDB 3M74A 3Q7FB 3QXFA 1RWAA 4Q88A 2ONGA 5FO9B 2PN5A 3D3IA 3M00A 3ANIA 2OKXA 1H12A 3TF4A 3WKGA 1RWCA 3WIRA 1H54A 1JS4A 1S63B 3Q75B 1HMUA 1K72A 2ZISB 5IL8A 2NVPA 4FXGB 1HXCA 5ILKA 1FCEA 4GTQB 4BOJA 1X81B 2F0YB 1TN6B 1FO2A 2WY8A 2AHFA 3HXBB 2WCOA 3QDEA 1G9GA 2H6HB 1RWFA 2D5JA 3HXDB 1HXGA 3SFXB 4J5TA 3W7XA 3QPFA 5FOBB 3DSUB 3QT3A 1LF9A 3GLYA 1N7NA 4YDEB 3W7TA 2QNOA 1IA7A 1G9JA 5DHIA 3E32B 4MMHA 1N9AB 2H6GB 4JJJA 4D4DA 1FPPB 3EQAA 3DPYB 1O79A 1HCUA 2FBAA 3VXDA 4F10A 3DSXB 1L2AA 2SQCA 4MU9A 4LNBB 5DGQA 1EGUA 3WUXA 1HMWA 2BRPA 3RJ3A 4KTRA 2V8JA 1KRFA 4ZRPA 2DRQA 1GSZA 1L1YA 5ILZA 1CEMA 1OJMA 2EADA 3EZ8A 1WU5A 2DROA 4GTOB 1FAEA 1O1TB 3D5RA 2J5CA 1HM2A 3M73A 1C3DA 4DODA 3SAEA 5DHKA 1KKTA 1UG9A 4CJ0A 4L6XA 1KZPB 4FUSA 5AGDA 5IK0A 1IA6A 3SDQA 1F1SA 3H7LA 1SQCA 1N22A 3SQCA 2B4FA 4FNVA 3WKFA 4RNQA 2WYNA 4OK4A 1F9GA 3E30B 4WU0A 3PZ2B 2FUQA 1S64B 1O6QA 5EAUA 3DSWB 1GXOA 1QBQB 2V8IA 4TXTA 3NNBA 3SDVA 5ILHA 5IL3A 3M76A 1H14A 1FT1B 4ONTA 3E37B 4MMIA 2X03A 1OJNA 5ILJA 1N7PA 1V5DA 1KFGA 2JF4A 5JMDA 3E34B 1HV6A 2ZIRB 1TNBB 3DSTB 1O6HA 3G4FA 4LNVA 5C05A 1ULVA 2A8ZA 1WU4A 2WIIB 4GTVB 2FV1A 4D94A 2DRSA 2ZBLA 1VD5A 5M7YA 3HXEB 1V5CA 1KSCA 3ON6A 3SFYB 4AYOA 3C72B 4BOKA 2DRRA 1KREA 1N4SB 3M7EA 3W5NA 1TN7B 1J0MA 1J0NA 1TF4A 3PZ1B 1AGMA 3HXFB 4WVAA 1IS9A 1O1RB 3ANKA 5EASA 3WIQA 4AYPA 3M72A 3S4BA 3M78A 1H39A 2BB5A 1X1IA 3RRSA 2F6DA 4MBGB 3K7XA 1LXKA 3X17A 3PZ3B 1QAZA 1D8DB 1N4QB 1N1ZA 1N7RA 1KS8A 4DI5A 5CZLA 3M01A 1R76A 4ZRQA 4OJZA 3SDUA 2Q1FA 3A3VA 3AFJA 2FUZA 3S9VA 1RQ5A 4AYRA 1FT2B 4NEIA 4GTPB 3QWTA 2BBCA 4CE7A 2RI8A 1RWGA 3K11A 2RI9A 1XWTA 3A0OA 1DCEB 1N23A 1DL2A 1N95B 3E80A 1G6IA 1LD7B 4OZWA 4GAXA 2R2LB 3SDTA 2CQTA 1W6JA 2WY7A 1LXMA 2I07B 4FJQA 1H3AA 2AFAA 4L9PB 1GHQA 5JPMB 3VSMA 5GY3A 4GTTB 4OK2A 1V7WA 3RX8A 2PMVA 1JCSB 4V1SA 3P2CA 3HXCB 5JMFA 3G4DA 1OJPA 3Q7AB 1KZOB 3E33B 2GOXA 2XQWA 1SA5B 2VN4A 2XWBB 3W5MA 1GAHA 1DOGA 5IK9A 2JG0A 1UT9A 5KKBA 3P5PA 3LZ9A 4WVBA 3DRAB 4CJ1A 1W3YA 1H36A 4XUVA 4C1SA 2V3NA 3W7UA 5MEHA 5ILDA 3T33A 2FUTA 5FO8B 4E1YA 4D4BA 4EHMB 2XFGA 4EL8A 1JCQB 3N0GA 4L0GA 3QFYA 1X1JA 1I8QA 4D4CA 3WKIA 2GZ6A 1N21A 1HZFA 1OJOA 3Q79B 3QSPA 3WC3A 1N7QA 1TNUB 2EABA 5EATA 2YIKA 5CA3A 2Z07A 3KQ4A 3E7JA 4KKIA 3GT5A 3ACSA 4QT9A 1QQFA 4KTPA 3EU5B 1QSJA 3M7LA 2E22A 4Q2BA 3QG0A 2A73B 5JPNB 3P5RA 1N4RB 3M71A 3Q73B 1NC5A 3RENA 1N4PB 3ANJA
chains in the Genus database with same CATH topology
1FBOA 3PYBA 3D5SA 1GXNA 3G6JB 1AYXA 1XWQA 3S4CA 1O6RA 3OEDA 3DSSB 1GAIA 2H6FB 5DGRA 3QT9A 3H2WA 5FO7B 1KWFA 3KSQB 3M7BA 2JJBA 4D4AA 3RSYA 3E73A 1H13A 4LIXA 1X9DA 1CLCA 2EAEA 3QXQA 4TF4A 1H3BA 2IEJB 5GW7A 2V8KA 5GZKA 3RX5A 3KSLB 1FP3A 4DOEA 3PMMA 3H3KA 3QFZA 5E2JA 2B39A 2D8LA 3M7CA 1H37A 1TNYB 4V1RA 1FMIA 4Z4LA 4LNGB 1GA2A 1LF6A 2RGKA 4KKJA 1O5MB 4YCRA 3VW5A 3OXUA 1N94B 3DSVB 4GTRB 5M7IA 3PYAA 1FBWA 4FXKB 1LTXB 3CIHA 1F9OA 1NL4B 2H6IB 5CD2A 3EU8A 2P0VA 1TNOB 2GH4A 2XWJB 4Z4JA 3QRYA 3WIWA 2G0DA 4GTSB 3EUVB 4GL3A 1UMPA 3GZKA 2ZZRA 1V7VA 1MZCB 2NOJA 2EACA 2G02A 4AYQA 1NI1B 1FO3A 1G87A 3WKHA 4YDOB 3W7WA 3M75A 2VN7A 1JCRB 4ZH1A 1H35A 2CQSA 1W6KA 1H3CA 3M77A 3ACTA 4ZH5A 1V7XA 4M76A 1SA4B 1F9DA 3E6UA 1KSDA 3S4DA 3S4AA 1GLMA 1D8EB 2BB6A 1LD8B 1O1SB 3Q78B 1GXMA 1NXCA 2FV0A 2WINB 3PZ4B 3W7SA 4GTMB 1TN8B 1WZZA 2AHGA 3KLSA 1TNZB 3SDRA 4ZG8A 1WU6A 2V3PA 3RX7A 1XW2A 4WVCA 3CU7A 2BEDB 3M74A 3Q7FB 3QXFA 4Q88A 5FO9B 2PN5A 3D3IA 3ANIA 2OKXA 1H12A 3TF4A 3WKGA 3WIRA 1H54A 1JS4A 1S63B 3Q75B 1K72A 2ZISB 2NVPA 4FXGB 1FCEA 4GTQB 4BOJA 1X81B 2F0YB 1TN6B 1FO2A 2WY8A 2AHFA 3HXBB 3QDEA 1G9GA 2H6HB 2D5JA 3HXDB 3SFXB 4J5TA 3W7XA 3QPFA 5FOBB 3DSUB 3QT3A 1LF9A 3GLYA 4YDEB 3W7TA 2QNOA 1IA7A 1G9JA 3E32B 1N9AB 2H6GB 4JJJA 4D4DA 1FPPB 3EQAA 3DPYB 1O79A 1HCUA 2FBAA 3VXDA 3DSXB 1L2AA 2SQCA 4MU9A 4LNBB 5DGQA 3WUXA 3RJ3A 4KTRA 2V8JA 1KRFA 4ZRPA 2DRQA 1GSZA 1L1YA 1CEMA 2EADA 3EZ8A 1WU5A 2DROA 4GTOB 1FAEA 1O1TB 3D5RA 3M73A 1C3DA 4DODA 3SAEA 1KKTA 1UG9A 4CJ0A 4L6XA 1KZPB 4FUSA 5AGDA 1IA6A 3SDQA 3H7LA 1SQCA 3SQCA 2B4FA 3WKFA 2WYNA 3E30B 4WU0A 3PZ2B 1S64B 1O6QA 3DSWB 1GXOA 1QBQB 2V8IA 4TXTA 3SDVA 3M76A 1H14A 1FT1B 4ONTA 3E37B 1V5DA 1KFGA 2JF4A 3E34B 2ZIRB 1TNBB 3DSTB 1O6HA 4LNVA 1ULVA 2A8ZA 1WU4A 2WIIB 4GTVB 2FV1A 4D94A 2DRSA 2ZBLA 1VD5A 5M7YA 3HXEB 1V5CA 1KSCA 3ON6A 3SFYB 4AYOA 3C72B 4BOKA 2DRRA 1KREA 1N4SB 3M7EA 3W5NA 1TN7B 1TF4A 3PZ1B 1AGMA 3HXFB 4WVAA 1IS9A 1O1RB 3ANKA 4AYPA 3WIQA 3M72A 3S4BA 3M78A 1H39A 2BB5A 3RRSA 2F6DA 4MBGB 3K7XA 3X17A 3PZ3B 1D8DB 1N4QB 1KS8A 5CZLA 1R76A 4ZRQA 3SDUA 3A3VA 3AFJA 2FUZA 3S9VA 1RQ5A 4AYRA 1FT2B 4GTPB 3QWTA 2BBCA 4CE7A 2RI8A 3K11A 2RI9A 1XWTA 1DCEB 1DL2A 1N95B 1G6IA 1LD7B 2R2LB 3SDTA 2CQTA 1W6JA 2WY7A 2I07B 1H3AA 2AFAA 4L9PB 1GHQA 5JPMB 5GY3A 4GTTB 1V7WA 3RX8A 2PMVA 1JCSB 4V1SA 3P2CA 3HXCB 3Q7AB 1KZOB 3E33B 2GOXA 2XQWA 1SA5B 2VN4A 2XWBB 3W5MA 1GAHA 1DOGA 2JG0A 1UT9A 5KKBA 3P5PA 4WVBA 3DRAB 4CJ1A 1H36A 4XUVA 4C1SA 2V3NA 3W7UA 5MEHA 3T33A 5FO8B 4D4BA 4EHMB 2XFGA 4EL8A 1JCQB 4L0GA 3QFYA 4D4CA 3WKIA 2GZ6A 1HZFA 3QSPA 3Q79B 3WC3A 1TNUB 2EABA 2YIKA 5CA3A 2Z07A 3KQ4A 4KKIA 3GT5A 3ACSA 4QT9A 1QQFA 4KTPA 3EU5B 1QSJA 3M7LA 4Q2BA 3QG0A 2A73B 5JPNB 3P5RA 1N4RB 3M71A 3Q73B 1NC5A 3RENA 1N4PB 3ANJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KS8 A;  1FBO A;  4KTR A;  1V7X A;  1KRF A;  5CZL A;  2DRQ A;  1F9D A;  1AYX A;  1L1Y A;  3E6U A;  1KSD A;  1XWQ A;  3S4C A;  1CEM A;  3S4D A;  3S4A A;  2EAD A;  3A3V A;  1GLM A;  3AFJ A;  3EZ8 A;  1WU5 A;  2DRO A;  1GAI A;  1FAE A;  2FUZ A;  5DGR A;  3QT9 A;  1RQ5 A;  4AYR A;  4DOD A;  3H2W A;  1KKT A;  1KWF A;  1NXC A;  1UG9 A;  2FV0 A;  4CJ0 A;  4L6X A;  2JJB A;  4FUS A;  3W7S A;  3QWT A;  4CE7 A;  2RI8 A;  3K11 A;  1IA6 A;  3H7L A;  3RSY A;  2RI9 A;  1XWT A;  3E73 A;  1H13 A;  1WZZ A;  2B4F A;  2AHG A;  4ZG8 A;  3WKF A;  1DL2 A;  1X9D A;  1CLC A;  2WYN A;  1G6I A;  1WU6 A;  4WU0 A;  2EAE A;  3QXQ A;  3RX7 A;  1XW2 A;  4TF4 A;  4WVC A;  2CQT A;  5GW7 A;  4TXT A;  3RX5 A;  3QXF A;  2AFA A;  1H14 A;  4Q88 A;  1FP3 A;  3D3I A;  5GY3 A;  4DOE A;  3ANI A;  2OKX A;  1H12 A;  1V7W A;  1V5D A;  1KFG A;  3RX8 A;  3PMM A;  3H3K A;  3WKG A;  3WIR A;  1H54 A;  1JS4 A;  2JF4 A;  3P2C A;  3QFZ A;  5E2J A;  1K72 A;  2NVP A;  1FCE A;  2VN4 A;  3W5M A;  2D8L A;  1ULV A;  1GAH A;  1FO2 A;  2A8Z A;  1DOG A;  2AHF A;  1WU4 A;  2FV1 A;  1FMI A;  2JG0 A;  3QDE A;  1UT9 A;  1G9G A;  5KKB A;  2DRS A;  2ZBL A;  2D5J A;  4WVB A;  1VD5 A;  4Z4L A;  5M7Y A;  4CJ1 A;  1V5C A;  1KSC A;  3ON6 A;  4J5T A;  4XUV A;  1GA2 A;  3QPF A;  4AYO A;  1LF6 A;  3W7X A;  2RGK A;  3QT3 A;  1LF9 A;  3GLY A;  5MEH A;  3W7U A;  3T33 A;  3VW5 A;  3W7T A;  2QNO A;  1IA7 A;  2XFG A;  4EL8 A;  5M7I A;  1FBW A;  1G9J A;  4L0G A;  2DRR A;  3CIH A;  1KRE A;  3QFY A;  3W5N A;  1F9O A;  3WKI A;  4JJJ A;  1TF4 A;  2GZ6 A;  3EQA A;  3QSP A;  3WC3 A;  1AGM A;  5CD2 A;  2P0V A;  4WVA A;  2GH4 A;  2FBA A;  1HCU A;  2EAB A;  1IS9 A;  4Z4J A;  3ANK A;  4AYP A;  3WIQ A;  2YIK A;  3QRY A;  3WIW A;  5CA3 A;  2Z07 A;  3VXD A;  3S4B A;  3GZK A;  1L2A A;  2ZZR A;  1V7V A;  3GT5 A;  2EAC A;  3ACS A;  4AYQ A;  4KTP A;  1FO3 A;  1G87 A;  3RRS A;  5DGQ A;  2F6D A;  4Q2B A;  3WKH A;  3W7W A;  3QG0 A;  3X17 A;  3TF4 A;  2VN7 A;  3WUX A;  1NC5 A;  2CQS A;  3REN A;  3ANJ A;  3ACT A;  4ZH5 A; 
#chains in the Genus database with same CATH topology
 1FBO A;  3PYB A;  3D5S A;  1GXN A;  3G6J B;  1N1B A;  1N7O A;  1AYX A;  1XWQ A;  3S4C A;  1O6R A;  3OED A;  3DSS B;  1GAI A;  1RWH A;  2H6F B;  5DGR A;  3QT9 A;  5IKH A;  3H2W A;  5FO7 B;  1KWF A;  2ONH A;  3KSQ B;  3M7B A;  2JJB A;  3NFV A;  4D4A A;  1C82 A;  3RSY A;  3E73 A;  1HM3 A;  1H13 A;  4LIX A;  1X9D A;  1CLC A;  3AFL A;  2EAE A;  3QXQ A;  4TF4 A;  1H3B A;  2BRW A;  2IEJ B;  1HX9 A;  3N0F A;  5GW7 A;  2V8K A;  5GZK A;  3RX5 A;  3KSL B;  1FP3 A;  4DOE A;  3PMM A;  3H3K A;  1X1H A;  3QFZ A;  5E2J A;  2B39 A;  1CB8 A;  2WDA A;  1RW9 A;  2D8L A;  3M7C A;  1H37 A;  1TNY B;  4V1R A;  1FMI A;  1LOH A;  5ILI A;  4Z4L A;  4LNG B;  1GA2 A;  1LF6 A;  2RGK A;  4KKJ A;  1O5M B;  4YCR A;  2E24 A;  3VW5 A;  3OXU A;  1N94 B;  3DSV B;  4GTR B;  5M7I A;  3PYA A;  1FBW A;  4FXK B;  2BRV X;  1LTX B;  3CIH A;  1F9O A;  1NL4 B;  2H6I B;  5CD2 A;  3EU8 A;  2P0V A;  1TNO B;  2GH4 A;  2XWJ B;  4Z4J A;  1N20 A;  3QRY A;  3WIW A;  2G0D A;  4GTS B;  4OZV A;  3EUV B;  4GL3 A;  5ILY A;  1UMP A;  3GZK A;  2ZZR A;  5IK6 A;  1V7V A;  1MZC B;  2NOJ A;  2EAC A;  2G02 A;  4AYQ A;  1NI1 B;  1FO3 A;  1G87 A;  1HN0 A;  3WKH A;  4YDO B;  3W7W A;  3M75 A;  2VN7 A;  1JCR B;  4ZH1 A;  1H35 A;  2CQS A;  1W6K A;  1H3C A;  3ACT A;  3M77 A;  4ZH5 A;  1V7X A;  4M76 A;  3M02 A;  1SA4 B;  1F9D A;  3E6U A;  1KSD A;  3S4D A;  3S4A A;  1GLM A;  1D8E B;  1HXA A;  2BB6 A;  1LD8 B;  5IKA A;  1O1S B;  3Q78 B;  1GXM A;  1NXC A;  2FV0 A;  2WIN B;  3VSN A;  3PZ4 B;  3W7S A;  1N24 A;  4F13 A;  4GTM B;  1TN8 B;  1WZZ A;  2AHG A;  3KLS A;  1TNZ B;  3SDR A;  4ZG8 A;  1WU6 A;  2V3P A;  3RX7 A;  1XW2 A;  4WVC A;  3CU7 A;  5IM1 A;  2BED B;  3M74 A;  3Q7F B;  3QXF A;  1RWA A;  4Q88 A;  2ONG A;  5FO9 B;  2PN5 A;  3D3I A;  3M00 A;  3ANI A;  2OKX A;  1H12 A;  3TF4 A;  3WKG A;  1RWC A;  3WIR A;  1H54 A;  1JS4 A;  1S63 B;  3Q75 B;  1HMU A;  1K72 A;  2ZIS B;  5IL8 A;  2NVP A;  4FXG B;  1HXC A;  5ILK A;  1FCE A;  4GTQ B;  4BOJ A;  1X81 B;  2F0Y B;  1TN6 B;  1FO2 A;  2WY8 A;  2AHF A;  3HXB B;  2WCO A;  3QDE A;  1G9G A;  2H6H B;  1RWF A;  2D5J A;  3HXD B;  1HXG A;  3SFX B;  4J5T A;  3W7X A;  3QPF A;  5FOB B;  3DSU B;  3QT3 A;  1LF9 A;  3GLY A;  1N7N A;  4YDE B;  3W7T A;  2QNO A;  1IA7 A;  1G9J A;  5DHI A;  3E32 B;  4MMH A;  1N9A B;  2H6G B;  4JJJ A;  4D4D A;  1FPP B;  3EQA A;  3DPY B;  1O79 A;  1HCU A;  2FBA A;  3VXD A;  4F10 A;  3DSX B;  1L2A A;  2SQC A;  4MU9 A;  4LNB B;  5DGQ A;  1EGU A;  3WUX A;  1HMW A;  2BRP A;  3RJ3 A;  4KTR A;  2V8J A;  1KRF A;  4ZRP A;  2DRQ A;  1GSZ A;  1L1Y A;  5ILZ A;  1CEM A;  1OJM A;  2EAD A;  3EZ8 A;  1WU5 A;  2DRO A;  4GTO B;  1FAE A;  1O1T B;  3D5R A;  2J5C A;  1HM2 A;  3M73 A;  1C3D A;  4DOD A;  3SAE A;  5DHK A;  1KKT A;  1UG9 A;  4CJ0 A;  4L6X A;  1KZP B;  4FUS A;  5AGD A;  5IK0 A;  1IA6 A;  3SDQ A;  1F1S A;  3H7L A;  1SQC A;  1N22 A;  3SQC A;  2B4F A;  4FNV A;  3WKF A;  4RNQ A;  2WYN A;  4OK4 A;  1F9G A;  3E30 B;  4WU0 A;  3PZ2 B;  2FUQ A;  1S64 B;  1O6Q A;  5EAU A;  3DSW B;  1GXO A;  1QBQ B;  2V8I A;  4TXT A;  3NNB A;  3SDV A;  5ILH A;  5IL3 A;  3M76 A;  1H14 A;  1FT1 B;  4ONT A;  3E37 B;  4MMI A;  2X03 A;  1OJN A;  5ILJ A;  1N7P A;  1V5D A;  1KFG A;  2JF4 A;  5JMD A;  3E34 B;  1HV6 A;  2ZIR B;  1TNB B;  3DST B;  1O6H A;  3G4F A;  4LNV A;  5C05 A;  1ULV A;  2A8Z A;  1WU4 A;  2WII B;  4GTV B;  2FV1 A;  4D94 A;  2DRS A;  2ZBL A;  1VD5 A;  5M7Y A;  3HXE B;  1V5C A;  1KSC A;  3ON6 A;  3SFY B;  4AYO A;  3C72 B;  4BOK A;  2DRR A;  1KRE A;  1N4S B;  3M7E A;  3W5N A;  1TN7 B;  1J0M A;  1J0N A;  1TF4 A;  3PZ1 B;  1AGM A;  3HXF B;  4WVA A;  1IS9 A;  1O1R B;  3ANK A;  5EAS A;  3WIQ A;  4AYP A;  3M72 A;  3S4B A;  3M78 A;  1H39 A;  2BB5 A;  1X1I A;  3RRS A;  2F6D A;  4MBG B;  3K7X A;  1LXK A;  3X17 A;  3PZ3 B;  1QAZ A;  1D8D B;  1N4Q B;  1N1Z A;  1N7R A;  1KS8 A;  4DI5 A;  5CZL A;  3M01 A;  1R76 A;  4ZRQ A;  4OJZ A;  3SDU A;  2Q1F A;  3A3V A;  3AFJ A;  2FUZ A;  3S9V A;  1RQ5 A;  4AYR A;  1FT2 B;  4NEI A;  4GTP B;  3QWT A;  2BBC A;  4CE7 A;  2RI8 A;  1RWG A;  3K11 A;  2RI9 A;  1XWT A;  3A0O A;  1DCE B;  1N23 A;  1DL2 A;  1N95 B;  3E80 A;  1G6I A;  1LD7 B;  4OZW A;  4GAX A;  2R2L B;  3SDT A;  2CQT A;  1W6J A;  2WY7 A;  1LXM A;  2I07 B;  4FJQ A;  1H3A A;  2AFA A;  4L9P B;  1GHQ A;  5JPM B;  3VSM A;  5GY3 A;  4GTT B;  4OK2 A;  1V7W A;  3RX8 A;  2PMV A;  1JCS B;  4V1S A;  3P2C A;  3HXC B;  5JMF A;  3G4D A;  1OJP A;  3Q7A B;  1KZO B;  3E33 B;  2GOX A;  2XQW A;  1SA5 B;  2VN4 A;  2XWB B;  3W5M A;  1GAH A;  1DOG A;  5IK9 A;  2JG0 A;  1UT9 A;  5KKB A;  3P5P A;  3LZ9 A;  4WVB A;  3DRA B;  4CJ1 A;  1W3Y A;  1H36 A;  4XUV A;  4C1S A;  2V3N A;  3W7U A;  5MEH A;  5ILD A;  3T33 A;  2FUT A;  5FO8 B;  4E1Y A;  4D4B A;  4EHM B;  2XFG A;  4EL8 A;  1JCQ B;  3N0G A;  4L0G A;  3QFY A;  1X1J A;  1I8Q A;  4D4C A;  3WKI A;  2GZ6 A;  1N21 A;  1HZF A;  1OJO A;  3Q79 B;  3QSP A;  3WC3 A;  1N7Q A;  1TNU B;  2EAB A;  5EAT A;  2YIK A;  5CA3 A;  2Z07 A;  3KQ4 A;  3E7J A;  4KKI A;  3GT5 A;  3ACS A;  4QT9 A;  1QQF A;  4KTP A;  3EU5 B;  1QSJ A;  3M7L A;  2E22 A;  4Q2B A;  3QG0 A;  2A73 B;  5JPN B;  3P5R A;  1N4R B;  3M71 A;  3Q73 B;  1NC5 A;  3REN A;  1N4P B;  3ANJ A; 
#chains in the Genus database with same CATH homology
 1FBO A;  3PYB A;  3D5S A;  1GXN A;  3G6J B;  1AYX A;  1XWQ A;  3S4C A;  1O6R A;  3OED A;  3DSS B;  1GAI A;  2H6F B;  5DGR A;  3QT9 A;  3H2W A;  5FO7 B;  1KWF A;  3KSQ B;  3M7B A;  2JJB A;  4D4A A;  3RSY A;  3E73 A;  1H13 A;  4LIX A;  1X9D A;  1CLC A;  2EAE A;  3QXQ A;  4TF4 A;  1H3B A;  2IEJ B;  5GW7 A;  2V8K A;  5GZK A;  3RX5 A;  3KSL B;  1FP3 A;  4DOE A;  3PMM A;  3H3K A;  3QFZ A;  5E2J A;  2B39 A;  2D8L A;  3M7C A;  1H37 A;  1TNY B;  4V1R A;  1FMI A;  4Z4L A;  4LNG B;  1GA2 A;  1LF6 A;  2RGK A;  4KKJ A;  1O5M B;  4YCR A;  3VW5 A;  3OXU A;  1N94 B;  3DSV B;  4GTR B;  5M7I A;  3PYA A;  1FBW A;  4FXK B;  1LTX B;  3CIH A;  1F9O A;  1NL4 B;  2H6I B;  5CD2 A;  3EU8 A;  2P0V A;  1TNO B;  2GH4 A;  2XWJ B;  4Z4J A;  3QRY A;  3WIW A;  2G0D A;  4GTS B;  3EUV B;  4GL3 A;  1UMP A;  3GZK A;  2ZZR A;  1V7V A;  1MZC B;  2NOJ A;  2EAC A;  2G02 A;  4AYQ A;  1NI1 B;  1FO3 A;  1G87 A;  3WKH A;  4YDO B;  3W7W A;  3M75 A;  2VN7 A;  1JCR B;  4ZH1 A;  1H35 A;  2CQS A;  1W6K A;  1H3C A;  3M77 A;  3ACT A;  4ZH5 A;  1V7X A;  4M76 A;  1SA4 B;  1F9D A;  3E6U A;  1KSD A;  3S4D A;  3S4A A;  1GLM A;  1D8E B;  2BB6 A;  1LD8 B;  1O1S B;  3Q78 B;  1GXM A;  1NXC A;  2FV0 A;  2WIN B;  3PZ4 B;  3W7S A;  4GTM B;  1TN8 B;  1WZZ A;  2AHG A;  3KLS A;  1TNZ B;  3SDR A;  4ZG8 A;  1WU6 A;  2V3P A;  3RX7 A;  1XW2 A;  4WVC A;  3CU7 A;  2BED B;  3M74 A;  3Q7F B;  3QXF A;  4Q88 A;  5FO9 B;  2PN5 A;  3D3I A;  3ANI A;  2OKX A;  1H12 A;  3TF4 A;  3WKG A;  3WIR A;  1H54 A;  1JS4 A;  1S63 B;  3Q75 B;  1K72 A;  2ZIS B;  2NVP A;  4FXG B;  1FCE A;  4GTQ B;  4BOJ A;  1X81 B;  2F0Y B;  1TN6 B;  1FO2 A;  2WY8 A;  2AHF A;  3HXB B;  3QDE A;  1G9G A;  2H6H B;  2D5J A;  3HXD B;  3SFX B;  4J5T A;  3W7X A;  3QPF A;  5FOB B;  3DSU B;  3QT3 A;  1LF9 A;  3GLY A;  4YDE B;  3W7T A;  2QNO A;  1IA7 A;  1G9J A;  3E32 B;  1N9A B;  2H6G B;  4JJJ A;  4D4D A;  1FPP B;  3EQA A;  3DPY B;  1O79 A;  1HCU A;  2FBA A;  3VXD A;  3DSX B;  1L2A A;  2SQC A;  4MU9 A;  4LNB B;  5DGQ A;  3WUX A;  3RJ3 A;  4KTR A;  2V8J A;  1KRF A;  4ZRP A;  2DRQ A;  1GSZ A;  1L1Y A;  1CEM A;  2EAD A;  3EZ8 A;  1WU5 A;  2DRO A;  4GTO B;  1FAE A;  1O1T B;  3D5R A;  3M73 A;  1C3D A;  4DOD A;  3SAE A;  1KKT A;  1UG9 A;  4CJ0 A;  4L6X A;  1KZP B;  4FUS A;  5AGD A;  1IA6 A;  3SDQ A;  3H7L A;  1SQC A;  3SQC A;  2B4F A;  3WKF A;  2WYN A;  3E30 B;  4WU0 A;  3PZ2 B;  1S64 B;  1O6Q A;  3DSW B;  1GXO A;  1QBQ B;  2V8I A;  4TXT A;  3SDV A;  3M76 A;  1H14 A;  1FT1 B;  4ONT A;  3E37 B;  1V5D A;  1KFG A;  2JF4 A;  3E34 B;  2ZIR B;  1TNB B;  3DST B;  1O6H A;  4LNV A;  1ULV A;  2A8Z A;  1WU4 A;  2WII B;  4GTV B;  2FV1 A;  4D94 A;  2DRS A;  2ZBL A;  1VD5 A;  5M7Y A;  3HXE B;  1V5C A;  1KSC A;  3ON6 A;  3SFY B;  4AYO A;  3C72 B;  4BOK A;  2DRR A;  1KRE A;  1N4S B;  3M7E A;  3W5N A;  1TN7 B;  1TF4 A;  3PZ1 B;  1AGM A;  3HXF B;  4WVA A;  1IS9 A;  1O1R B;  3ANK A;  4AYP A;  3WIQ A;  3M72 A;  3S4B A;  3M78 A;  1H39 A;  2BB5 A;  3RRS A;  2F6D A;  4MBG B;  3K7X A;  3X17 A;  3PZ3 B;  1D8D B;  1N4Q B;  1KS8 A;  5CZL A;  1R76 A;  4ZRQ A;  3SDU A;  3A3V A;  3AFJ A;  2FUZ A;  3S9V A;  1RQ5 A;  4AYR A;  1FT2 B;  4GTP B;  3QWT A;  2BBC A;  4CE7 A;  2RI8 A;  3K11 A;  2RI9 A;  1XWT A;  1DCE B;  1DL2 A;  1N95 B;  1G6I A;  1LD7 B;  2R2L B;  3SDT A;  2CQT A;  1W6J A;  2WY7 A;  2I07 B;  1H3A A;  2AFA A;  4L9P B;  1GHQ A;  5JPM B;  5GY3 A;  4GTT B;  1V7W A;  3RX8 A;  2PMV A;  1JCS B;  4V1S A;  3P2C A;  3HXC B;  3Q7A B;  1KZO B;  3E33 B;  2GOX A;  2XQW A;  1SA5 B;  2VN4 A;  2XWB B;  3W5M A;  1GAH A;  1DOG A;  2JG0 A;  1UT9 A;  5KKB A;  3P5P A;  4WVB A;  3DRA B;  4CJ1 A;  1H36 A;  4XUV A;  4C1S A;  2V3N A;  3W7U A;  5MEH A;  3T33 A;  5FO8 B;  4D4B A;  4EHM B;  2XFG A;  4EL8 A;  1JCQ B;  4L0G A;  3QFY A;  4D4C A;  3WKI A;  2GZ6 A;  1HZF A;  3QSP A;  3Q79 B;  3WC3 A;  1TNU B;  2EAB A;  2YIK A;  5CA3 A;  2Z07 A;  3KQ4 A;  4KKI A;  3GT5 A;  3ACS A;  4QT9 A;  1QQF A;  4KTP A;  3EU5 B;  1QSJ A;  3M7L A;  4Q2B A;  3QG0 A;  2A73 B;  5JPN B;  3P5R A;  1N4R B;  3M71 A;  3Q73 B;  1NC5 A;  3REN A;  1N4P B;  3ANJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...