3WKFA

Crystal structure of cellobiose 2-epimerase
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
407
structure length
407
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Isomerase
total genus 162
structure length 407
sequence length 407
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkfA00
3H7LA 3QWTA 1IA6A 2NVPA 4AYOA 1KKTA 3A3VA 2Z07A 3ANJA 3K11A 2XFGA 1KRFA 3AFJA 1UG9A 1V5CA 3QT9A 1GA2A 3QFZA 1FP3A 1KREA 3T33A 3TF4A 1FO3A 2JG0A 3H2WA 1WZZA 3VW5A 1KSCA 3EQAA 5GW7A 1GLMA 1AYXA 2DRRA 3W7TA 3QXQA 2VN7A 1G87A 1KFGA 4KTPA 3QSPA 2ZZRA 1H12A 1WU5A 3WC3A 3RX5A 4CE7A 2B4FA 1HCUA 2AHFA 3RX8A 2FV0A 3QG0A 2RGKA 2D8LA 2AHGA 1XWTA 3QXFA 1CEMA 1GAIA 3D3IA 4AYPA 3WIQA 4DODA 1TF4A 1KS8A 3ANIA 3GZKA 2EADA 1H14A 3WKHA 3QT3A 2DRSA 3WIWA 4J5TA 3QFYA 3RSYA 4WVBA 1AGMA 1V7WA 4EL8A 1FAEA 1LF6A 1KSDA 3S4AA 1H13A 2VN4A 3S4DA 1NC5A 1V7VA 2RI8A 4WU0A 4Q2BA 1FMIA 3ON6A 1GAHA 1IS9A 5M7YA 3QRYA 4ZG8A 4DOEA 4CJ1A 3ACTA 3S4BA 3W7SA 2EAEA 4KTRA 2CQTA 5GY3A 3GT5A 1F9DA 4FUSA 3PMMA 3RENA 4AYRA 3ACSA 2FBAA 2ZBLA 1FBOA 2YIKA 1CLCA 3E6UA 3E73A 1IA7A 1RQ5A 3QPFA 4WVAA 1V7XA 2JF4A 2D5JA 4L0GA 3WKIA 1K72A 5M7IA 3WKFA 2FV1A 2DROA 3ANKA 1H54A 4XUVA 1XWQA 1FO2A 5E2JA 2WYNA 2GZ6A 2QNOA 3H3KA 3W5NA 2CQSA 1UT9A 5CZLA 4L6XA 2DRQA 5CD2A 2GH4A 3RX7A 4WVCA 5DGQA 1G9JA 2EACA 3WIRA 3VXDA 2JJBA 3EZ8A 3W5MA 5DGRA 1XW2A 2AFAA 3CIHA 1FCEA 5MEHA 4TF4A 1DOGA 1G9GA 3WUXA 3W7XA 4Z4LA 1WU4A 1L2AA 3GLYA 3RRSA 1X9DA 1FBWA 1JS4A 1LF9A 4TXTA 1KWFA 1VD5A 1WU6A 2RI9A 3W7UA 1DL2A 2A8ZA 2OKXA 4Q88A 5KKBA 3QDEA 1ULVA 2FUZA 4CJ0A 3WKGA 5CA3A 2P0VA 2EABA 2F6DA 4ZH5A 1L1YA 4AYQA 4JJJA 1V5DA 3X17A 3W7WA 1F9OA 1G6IA 3S4CA 4Z4JA 1NXCA 3P2CA
chains in the Genus database with same CATH superfamily
1GXNA 3E80A 3QWTA 1IA6A 1TNZB 3KSLB 1TN8B 5ILDA 2Z07A 3NNBA 1SA5B 4GTRB 4V1RA 1UG9A 3TF4A 3QFZA 4GTPB 2JG0A 3RJ3A 3M02A 3EQAA 1AYXA 1LXMA 2WCOA 2BB6A 2SQCA 2WIIB 2ZZRA 1H12A 3PYBA 1OJNA 1J0NA 2B4FA 4DI5A 3M78A 2RGKA 2AHGA 1CEMA 1TF4A 2EADA 3Q78B 4EL8A 1LF6A 1KSDA 1HMWA 1X1HA 2VN4A 1NC5A 2BB5A 3ON6A 3PZ2B 4ZG8A 2XWBB 4DOEA 3DSTB 4Z4JA 1X81B 3HXCB 5JPMB 3C72B 3K7XA 1FT2B 3M7BA 3VSMA 3ACSA 2FBAA 1HZFA 2YIKA 2H6IB 4LIXA 1N22A 1N4SB 1V7XA 3PZ1B 2FV1A 4XUVA 1XWQA 5IL8A 2ZISB 3G4DA 2QNOA 3W5NA 1UT9A 3SQCA 3E7JA 2R2LB 3PYAA 1D8DB 4WVCA 5ILJA 1H35A 5DGQA 1N21A 5DHKA 1HXCA 2H6GB 3CU7A 1W6KA 4TF4A 3WUXA 4YCRA 1F1SA 3LZ9A 1SQCA 5DHIA 3Q7AB 1JS4A 1RWFA 3W7UA 1DL2A 4ZRQA 2FUZA 4CJ0A 3WKGA 5JPNB 4OJZA 2V3NA 3SFYB 3N0FA 2P0VA 4ZH5A 3M73A 4AYQA 1V5DA 1HM3A 3SDUA 1G6IA 3EUVB 1H39A 4KKIA 3WKFA 1O1SB 3M72A 2NVPA 1R76A 3DPYB 4MU9A 2PMVA 4OZVA 2B39A 3OEDA 3QT9A 1KREA 2BRPA 1WZZA 2H6FB 1GLMA 4YDEB 1LD7B 3W7TA 1G87A 3HXBB 1KFGA 3KQ4A 4KTPA 2XQWA 4GTQB 5IK6A 4CE7A 3SAEA 3D3IA 3WIQA 3ANIA 2V8IA 2ONHA 2DRSA 3WIWA 4J5TA 1S63B 4WVBA 1FAEA 2XWJB 4MBGB 5ILHA 4WU0A 1N4PB 1IS9A 1H36A 2I07B 3QRYA 4NEIA 1X1JA 4CJ1A 3PZ3B 5EATA 4LNGB 2J5CA 3E32B 4RNQA 3RENA 4AYRA 3M00A 1H3AA 1HMUA 1FBOA 3E6UA 5ILKA 1RQ5A 1TN7B 2V8JA 2BRVX 2D5JA 1GHQA 4L0GA 4GTOB 3WKIA 1K72A 1QAZA 5M7IA 5JMFA 4GTTB 1N95B 2H6HB 2WYNA 2GZ6A 4GL3A 2WY8A 4D4DA 5IK9A 3HXDB 5CD2A 1QBQB 4D4BA 1G9JA 3VXDA 4D4CA 4L9PB 1W3YA 2AFAA 3W7XA 1DOGA 4Z4LA 1L2AA 2WY7A 4LNBB 2F0YB 1KZOB 3GLYA 1FBWA 3EU8A 1LF9A 1RWCA 1O6HA 1VD5A 3A0OA 1HXAA 4GTVB 4GTSB 2OKXA 4Q88A 3QDEA 1LTXB 4OZWA 1ULVA 4LNVA 1H37A 4ZH1A 1SA4B 5FOBB 4FNVA 4JJJA 1N23A 3W7WA 1H3BA 1F9OA 4ZRPA 1HXGA 1LOHA 2V3PA 1RWGA 3Q75B 1QSJA 1FT1B 4AYOA 1KKTA 3A3VA 3ANJA 3K11A 2PN5A 1OJMA 3AFJA 1V5CA 1O1TB 1GA2A 3M74A 4GTMB 4KKJA 1FO3A 3H2WA 1N94B 1KSCA 1KZPB 5GW7A 2DRRA 1X1IA 4ONTA 1H3CA 2VN7A 1C3DA 3QSPA 1JCSB 3SFXB 1WU5A 1F9GA 1CB8A 1O79A 3WC3A 3RX5A 1O6RA 1HCUA 3RX8A 3QG0A 3M75A 1OJPA 1JCQB 4AYPA 4DODA 3GZKA 1H14A 3WKHA 5IL3A 3QT3A 1HV6A 2A73B 3RSYA 1AGMA 1I8QA 3E30B 1H13A 3E34B 3SDTA 1V7VA 2RI8A 1JCRB 4D4AA 1N1ZA 5ILZA 3M76A 4KTRA 2CQTA 3Q79B 1F9DA 4FUSA 1O5MB 3M01A 2ZBLA 1DCEB 3M71A 3E73A 1HM2A 5FO8B 1IA7A 3QPFA 1OJOA 1N20A 1TN6B 3HXFB 1NL4B 4F13A 4D94A 2DROA 3VSNA 5E2JA 3DSUB 5EASA 1N7NA 2FUTA 5CZLA 4L6XA 2DRQA 1GXOA 2GH4A 3RX7A 3KSQB 1O6QA 3KLSA 2EACA 3WIRA 4C1SA 2JJBA 3D5RA 3EZ8A 4BOJA 1N9AB 1HX9A 3CIHA 1G9GA 2FUQA 3N0GA 2BEDB 1WU4A 1N24A 4QT9A 3P5PA 5IKAA 1KWFA 1N7QA 2E22A 1GXMA 5CA3A 1N7PA 5ILYA 3M7EA 3SDQA 5IM1A 3G4FA 1QQFA 3Q73B 3Q7FB 5FO7B 3S4CA 2NOJA 1NXCA 3H7LA 1NI1B 2GOXA 2XFGA 1KRFA 2ZIRB 5JMDA 1N1BA 1FP3A 3T33A 3DRAB 3VW5A 1RW9A 1LXKA 1LD8B 3QXQA 4FXGB 4FXKB 1TNBB 3PZ4B 1N7OA 3SDRA 3M77A 2AHFA 5GZKA 2FV0A 5IK0A 1RWAA 2D8LA 3E33B 1XWTA 3QXFA 1GAIA 2X03A 1KS8A 5C05A 3G6JB 4MMHA 3QFYA 4FJQA 3NFVA 1V7WA 3SDVA 1N7RA 2BBCA 3S4AA 3S4DA 4M76A 3S9VA 5EAUA 4Q2BA 1FMIA 1UMPA 1FPPB 1GAHA 3D5SA 3DSVB 5M7YA 3ACTA 3S4BA 3W7SA 2EAEA 1C82A 1TNOB 5GY3A 3GT5A 1D8EB 3PMMA 1MZCB 1CLCA 2IEJB 4WVAA 2JF4A 1J0MA 4MMIA 5ILIA 1W6JA 5IKHA 3ANKA 1GSZA 1H54A 3HXEB 1FO2A 4F10A 3H3KA 4YDOB 2CQSA 1N4QB 4V1SA 5FO9B 1TNUB 1RWHA 3DSSB 2ONGA 2G0DA 2G02A 3W5MA 4GAXA 5DGRA 2WINB 3EU5B 2V8KA 1XW2A 1FCEA 5MEHA 4E1YA 3DSWB 3AFLA 4BOKA 3P5RA 4OK2A 1X9DA 2Q1FA 3RRSA 2WDAA 4TXTA 2RI9A 1WU6A 3OXUA 2A8ZA 3DSXB 5KKBA 4OK4A 1O1RB 2E24A 5AGDA 2BRWA 3E37B 2EABA 1S64B 2F6DA 3M7LA 1HN0A 1L1YA 1N4RB 1TNYB 3X17A 1EGUA 3P2CA 4EHMB 3M7CA
chains in the Genus database with same CATH topology
1GXNA 3QWTA 1IA6A 1TNZB 3KSLB 1TN8B 2Z07A 1SA5B 4GTRB 4V1RA 1UG9A 3TF4A 3QFZA 4GTPB 2JG0A 3RJ3A 3EQAA 1AYXA 2BB6A 2SQCA 2WIIB 2ZZRA 1H12A 3PYBA 2B4FA 2RGKA 2AHGA 1CEMA 1TF4A 2EADA 3Q78B 4EL8A 1LF6A 1KSDA 2VN4A 1NC5A 2BB5A 3ON6A 3PZ2B 4ZG8A 2XWBB 4DOEA 3DSTB 1X81B 3HXCB 5JPMB 3C72B 3K7XA 1FT2B 3M7BA 3ACSA 2FBAA 1HZFA 2YIKA 2H6IB 4LIXA 1N4SB 1V7XA 3PZ1B 2FV1A 4XUVA 1XWQA 2ZISB 2QNOA 3W5NA 1UT9A 3SQCA 2R2LB 3PYAA 1D8DB 4WVCA 1H35A 5DGQA 2H6GB 3CU7A 1W6KA 4TF4A 3WUXA 4YCRA 1SQCA 3Q7AB 1JS4A 3W7UA 1DL2A 4ZRQA 2FUZA 4CJ0A 3WKGA 5JPNB 2V3NA 3SFYB 2P0VA 4ZH5A 3M73A 4AYQA 1V5DA 3SDUA 1G6IA 3EUVB 1H39A 4KKIA 3WKFA 1O1SB 3M72A 2NVPA 1R76A 3DPYB 4MU9A 2PMVA 2B39A 3OEDA 3QT9A 1KREA 2H6FB 1WZZA 1GLMA 4YDEB 1LD7B 3W7TA 1G87A 3HXBB 1KFGA 3KQ4A 4KTPA 2XQWA 4GTQB 4CE7A 3SAEA 3D3IA 3WIQA 3ANIA 2V8IA 2DRSA 3WIWA 4J5TA 1S63B 4WVBA 1FAEA 2XWJB 4MBGB 4WU0A 1N4PB 1IS9A 1H36A 2I07B 3QRYA 4CJ1A 3PZ3B 4LNGB 3E32B 3RENA 4AYRA 1H3AA 1FBOA 3E6UA 1RQ5A 1TN7B 2V8JA 2D5JA 1GHQA 4L0GA 4GTOB 3WKIA 1K72A 5M7IA 4GTTB 1N95B 2H6HB 2WYNA 2GZ6A 4GL3A 2WY8A 4D4DA 3HXDB 5CD2A 1QBQB 4D4BA 1G9JA 3VXDA 4D4CA 4L9PB 2AFAA 3W7XA 1DOGA 4Z4LA 1L2AA 2WY7A 4LNBB 2F0YB 1KZOB 3GLYA 1FBWA 3EU8A 1LF9A 1O6HA 1VD5A 4GTVB 4GTSB 2OKXA 4Q88A 3QDEA 1LTXB 1ULVA 4LNVA 1H37A 4ZH1A 1SA4B 5FOBB 4JJJA 3W7WA 1H3BA 1F9OA 4ZRPA 2V3PA 3Q75B 1QSJA 1FT1B 4AYOA 1KKTA 3A3VA 3ANJA 3K11A 2PN5A 3AFJA 1V5CA 1O1TB 1GA2A 3M74A 4GTMB 4KKJA 1FO3A 3H2WA 1N94B 1KSCA 1KZPB 5GW7A 2DRRA 4ONTA 1H3CA 2VN7A 1C3DA 3QSPA 1JCSB 3SFXB 1WU5A 1O79A 3WC3A 3RX5A 1O6RA 1HCUA 3RX8A 3QG0A 3M75A 4AYPA 1JCQB 4DODA 3GZKA 1H14A 3WKHA 3QT3A 2A73B 3RSYA 1AGMA 3E30B 1H13A 3E34B 3SDTA 1V7VA 2RI8A 1JCRB 4D4AA 3M76A 4KTRA 2CQTA 3Q79B 1F9DA 4FUSA 1O5MB 2ZBLA 1DCEB 3M71A 3E73A 5FO8B 1IA7A 3QPFA 1TN6B 3HXFB 1NL4B 4D94A 2DROA 5E2JA 3DSUB 5CZLA 4L6XA 2DRQA 1GXOA 2GH4A 3RX7A 3KSQB 1O6QA 3KLSA 2EACA 3WIRA 4C1SA 2JJBA 3D5RA 3EZ8A 3M7CA 4BOJA 1N9AB 3CIHA 1G9GA 2BEDB 1WU4A 4QT9A 3P5PA 1KWFA 1GXMA 5CA3A 3M7EA 3SDQA 1QQFA 3Q73B 3Q7FB 5FO7B 3S4CA 2NOJA 1NXCA 3H7LA 1NI1B 2GOXA 2XFGA 1KRFA 2ZIRB 1FP3A 3T33A 3DRAB 3VW5A 1LD8B 3QXQA 4FXGB 4FXKB 1TNBB 3PZ4B 3SDRA 3M77A 2AHFA 5GZKA 2FV0A 3E33B 2D8LA 1XWTA 3QXFA 1GAIA 1KS8A 3G6JB 3QFYA 1V7WA 3SDVA 3S4AA 2BBCA 3S4DA 4M76A 3S9VA 4Q2BA 1FMIA 1UMPA 1FPPB 1GAHA 3D5SA 3DSVB 5M7YA 3ACTA 3S4BA 3W7SA 2EAEA 1TNOB 5GY3A 3GT5A 1D8EB 3PMMA 1MZCB 1CLCA 2IEJB 4WVAA 2JF4A 1W6JA 3ANKA 1GSZA 1H54A 3HXEB 1FO2A 3H3KA 4YDOB 2CQSA 1N4QB 4V1SA 5FO9B 1TNUB 3DSSB 2G0DA 2G02A 3W5MA 5DGRA 2WINB 2V8KA 1XW2A 3EU5B 1FCEA 5MEHA 3DSWB 4BOKA 3P5RA 3RRSA 1X9DA 4TXTA 2RI9A 1WU6A 3OXUA 2A8ZA 3DSXB 5KKBA 1O1RB 5AGDA 3E37B 2EABA 1S64B 2F6DA 3M7LA 1L1YA 1N4RB 1TNYB 3X17A 4Z4JA 3P2CA 4EHMB 3M78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7L A;  3QWT A;  1IA6 A;  2NVP A;  4AYO A;  1KKT A;  3A3V A;  2Z07 A;  3ANJ A;  3K11 A;  2XFG A;  1KRF A;  3AFJ A;  1UG9 A;  1V5C A;  3QT9 A;  1GA2 A;  3QFZ A;  1FP3 A;  1KRE A;  3T33 A;  3TF4 A;  1FO3 A;  2JG0 A;  3H2W A;  1WZZ A;  3VW5 A;  1KSC A;  3EQA A;  5GW7 A;  1GLM A;  1AYX A;  2DRR A;  3W7T A;  3QXQ A;  2VN7 A;  1G87 A;  1KFG A;  4KTP A;  3QSP A;  2ZZR A;  1H12 A;  1WU5 A;  3WC3 A;  3RX5 A;  4CE7 A;  2B4F A;  1HCU A;  2AHF A;  3RX8 A;  2FV0 A;  3QG0 A;  2RGK A;  2D8L A;  2AHG A;  1XWT A;  3QXF A;  1CEM A;  1GAI A;  3D3I A;  4AYP A;  3WIQ A;  4DOD A;  1TF4 A;  1KS8 A;  3ANI A;  3GZK A;  2EAD A;  1H14 A;  3WKH A;  3QT3 A;  2DRS A;  3WIW A;  4J5T A;  3QFY A;  3RSY A;  4WVB A;  1AGM A;  1V7W A;  4EL8 A;  1FAE A;  1LF6 A;  1KSD A;  3S4A A;  1H13 A;  2VN4 A;  3S4D A;  1NC5 A;  1V7V A;  2RI8 A;  4WU0 A;  4Q2B A;  1FMI A;  3ON6 A;  1GAH A;  1IS9 A;  5M7Y A;  3QRY A;  4ZG8 A;  4DOE A;  4CJ1 A;  3ACT A;  3S4B A;  3W7S A;  2EAE A;  4KTR A;  2CQT A;  5GY3 A;  3GT5 A;  1F9D A;  4FUS A;  3PMM A;  3REN A;  4AYR A;  3ACS A;  2FBA A;  2ZBL A;  1FBO A;  2YIK A;  1CLC A;  3E6U A;  3E73 A;  1IA7 A;  1RQ5 A;  3QPF A;  4WVA A;  1V7X A;  2JF4 A;  2D5J A;  4L0G A;  3WKI A;  1K72 A;  5M7I A;  3WKF A;  2FV1 A;  2DRO A;  3ANK A;  1H54 A;  4XUV A;  1XWQ A;  1FO2 A;  5E2J A;  2WYN A;  2GZ6 A;  2QNO A;  3H3K A;  3W5N A;  2CQS A;  1UT9 A;  5CZL A;  4L6X A;  2DRQ A;  5CD2 A;  2GH4 A;  3RX7 A;  4WVC A;  5DGQ A;  1G9J A;  2EAC A;  3WIR A;  3VXD A;  2JJB A;  3EZ8 A;  3W5M A;  5DGR A;  1XW2 A;  2AFA A;  3CIH A;  1FCE A;  5MEH A;  4TF4 A;  1DOG A;  1G9G A;  3WUX A;  3W7X A;  4Z4L A;  1WU4 A;  1L2A A;  3GLY A;  3RRS A;  1X9D A;  1FBW A;  1JS4 A;  1LF9 A;  4TXT A;  1KWF A;  1VD5 A;  1WU6 A;  2RI9 A;  3W7U A;  1DL2 A;  2A8Z A;  2OKX A;  4Q88 A;  5KKB A;  3QDE A;  1ULV A;  2FUZ A;  4CJ0 A;  3WKG A;  5CA3 A;  2P0V A;  2EAB A;  2F6D A;  4ZH5 A;  1L1Y A;  4AYQ A;  4JJJ A;  1V5D A;  3X17 A;  3W7W A;  1F9O A;  1G6I A;  3S4C A;  4Z4J A;  1NXC A;  3P2C A; 
#chains in the Genus database with same CATH topology
 1GXN A;  3E80 A;  3QWT A;  1IA6 A;  1TNZ B;  3KSL B;  1TN8 B;  5ILD A;  2Z07 A;  3NNB A;  1SA5 B;  4GTR B;  4V1R A;  1UG9 A;  3TF4 A;  3QFZ A;  4GTP B;  2JG0 A;  3RJ3 A;  3M02 A;  3EQA A;  1AYX A;  1LXM A;  2WCO A;  2BB6 A;  2SQC A;  2WII B;  2ZZR A;  1H12 A;  3PYB A;  1OJN A;  1J0N A;  2B4F A;  4DI5 A;  3M78 A;  2RGK A;  2AHG A;  1CEM A;  1TF4 A;  2EAD A;  3Q78 B;  4EL8 A;  1LF6 A;  1KSD A;  1HMW A;  1X1H A;  2VN4 A;  1NC5 A;  2BB5 A;  3ON6 A;  3PZ2 B;  4ZG8 A;  2XWB B;  4DOE A;  3DST B;  4Z4J A;  1X81 B;  3HXC B;  5JPM B;  3C72 B;  3K7X A;  1FT2 B;  3M7B A;  3VSM A;  3ACS A;  2FBA A;  1HZF A;  2YIK A;  2H6I B;  4LIX A;  1N22 A;  1N4S B;  1V7X A;  3PZ1 B;  2FV1 A;  4XUV A;  1XWQ A;  5IL8 A;  2ZIS B;  3G4D A;  2QNO A;  3W5N A;  1UT9 A;  3SQC A;  3E7J A;  2R2L B;  3PYA A;  1D8D B;  4WVC A;  5ILJ A;  1H35 A;  5DGQ A;  1N21 A;  5DHK A;  1HXC A;  2H6G B;  3CU7 A;  1W6K A;  4TF4 A;  3WUX A;  4YCR A;  1F1S A;  3LZ9 A;  1SQC A;  5DHI A;  3Q7A B;  1JS4 A;  1RWF A;  3W7U A;  1DL2 A;  4ZRQ A;  2FUZ A;  4CJ0 A;  3WKG A;  5JPN B;  4OJZ A;  2V3N A;  3SFY B;  3N0F A;  2P0V A;  4ZH5 A;  3M73 A;  4AYQ A;  1V5D A;  1HM3 A;  3SDU A;  1G6I A;  3EUV B;  1H39 A;  4KKI A;  3WKF A;  1O1S B;  3M72 A;  2NVP A;  1R76 A;  3DPY B;  4MU9 A;  2PMV A;  4OZV A;  2B39 A;  3OED A;  3QT9 A;  1KRE A;  2BRP A;  1WZZ A;  2H6F B;  1GLM A;  4YDE B;  1LD7 B;  3W7T A;  1G87 A;  3HXB B;  1KFG A;  3KQ4 A;  4KTP A;  2XQW A;  4GTQ B;  5IK6 A;  4CE7 A;  3SAE A;  3D3I A;  3WIQ A;  3ANI A;  2V8I A;  2ONH A;  2DRS A;  3WIW A;  4J5T A;  1S63 B;  4WVB A;  1FAE A;  2XWJ B;  4MBG B;  5ILH A;  4WU0 A;  1N4P B;  1IS9 A;  1H36 A;  2I07 B;  3QRY A;  4NEI A;  1X1J A;  4CJ1 A;  3PZ3 B;  5EAT A;  4LNG B;  2J5C A;  3E32 B;  4RNQ A;  3REN A;  4AYR A;  3M00 A;  1H3A A;  1HMU A;  1FBO A;  3E6U A;  5ILK A;  1RQ5 A;  1TN7 B;  2V8J A;  2BRV X;  2D5J A;  1GHQ A;  4L0G A;  4GTO B;  3WKI A;  1K72 A;  1QAZ A;  5M7I A;  5JMF A;  4GTT B;  1N95 B;  2H6H B;  2WYN A;  2GZ6 A;  4GL3 A;  2WY8 A;  4D4D A;  5IK9 A;  3HXD B;  5CD2 A;  1QBQ B;  4D4B A;  1G9J A;  3VXD A;  4D4C A;  4L9P B;  1W3Y A;  2AFA A;  3W7X A;  1DOG A;  4Z4L A;  1L2A A;  2WY7 A;  4LNB B;  2F0Y B;  1KZO B;  3GLY A;  1FBW A;  3EU8 A;  1LF9 A;  1RWC A;  1O6H A;  1VD5 A;  3A0O A;  1HXA A;  4GTV B;  4GTS B;  2OKX A;  4Q88 A;  3QDE A;  1LTX B;  4OZW A;  1ULV A;  4LNV A;  1H37 A;  4ZH1 A;  1SA4 B;  5FOB B;  4FNV A;  4JJJ A;  1N23 A;  3W7W A;  1H3B A;  1F9O A;  4ZRP A;  1HXG A;  1LOH A;  2V3P A;  1RWG A;  3Q75 B;  1QSJ A;  1FT1 B;  4AYO A;  1KKT A;  3A3V A;  3ANJ A;  3K11 A;  2PN5 A;  1OJM A;  3AFJ A;  1V5C A;  1O1T B;  1GA2 A;  3M74 A;  4GTM B;  4KKJ A;  1FO3 A;  3H2W A;  1N94 B;  1KSC A;  1KZP B;  5GW7 A;  2DRR A;  1X1I A;  4ONT A;  1H3C A;  2VN7 A;  1C3D A;  3QSP A;  1JCS B;  3SFX B;  1WU5 A;  1F9G A;  1CB8 A;  1O79 A;  3WC3 A;  3RX5 A;  1O6R A;  1HCU A;  3RX8 A;  3QG0 A;  3M75 A;  1OJP A;  1JCQ B;  4AYP A;  4DOD A;  3GZK A;  1H14 A;  3WKH A;  5IL3 A;  3QT3 A;  1HV6 A;  2A73 B;  3RSY A;  1AGM A;  1I8Q A;  3E30 B;  1H13 A;  3E34 B;  3SDT A;  1V7V A;  2RI8 A;  1JCR B;  4D4A A;  1N1Z A;  5ILZ A;  3M76 A;  4KTR A;  2CQT A;  3Q79 B;  1F9D A;  4FUS A;  1O5M B;  3M01 A;  2ZBL A;  1DCE B;  3M71 A;  3E73 A;  1HM2 A;  5FO8 B;  1IA7 A;  3QPF A;  1OJO A;  1N20 A;  1TN6 B;  3HXF B;  1NL4 B;  4F13 A;  4D94 A;  2DRO A;  3VSN A;  5E2J A;  3DSU B;  5EAS A;  1N7N A;  2FUT A;  5CZL A;  4L6X A;  2DRQ A;  1GXO A;  2GH4 A;  3RX7 A;  3KSQ B;  1O6Q A;  3KLS A;  2EAC A;  3WIR A;  4C1S A;  2JJB A;  3D5R A;  3EZ8 A;  4BOJ A;  1N9A B;  1HX9 A;  3CIH A;  1G9G A;  2FUQ A;  3N0G A;  2BED B;  1WU4 A;  1N24 A;  4QT9 A;  3P5P A;  5IKA A;  1KWF A;  1N7Q A;  2E22 A;  1GXM A;  5CA3 A;  1N7P A;  5ILY A;  3M7E A;  3SDQ A;  5IM1 A;  3G4F A;  1QQF A;  3Q73 B;  3Q7F B;  5FO7 B;  3S4C A;  2NOJ A;  1NXC A;  3H7L A;  1NI1 B;  2GOX A;  2XFG A;  1KRF A;  2ZIR B;  5JMD A;  1N1B A;  1FP3 A;  3T33 A;  3DRA B;  3VW5 A;  1RW9 A;  1LXK A;  1LD8 B;  3QXQ A;  4FXG B;  4FXK B;  1TNB B;  3PZ4 B;  1N7O A;  3SDR A;  3M77 A;  2AHF A;  5GZK A;  2FV0 A;  5IK0 A;  1RWA A;  2D8L A;  3E33 B;  1XWT A;  3QXF A;  1GAI A;  2X03 A;  1KS8 A;  5C05 A;  3G6J B;  4MMH A;  3QFY A;  4FJQ A;  3NFV A;  1V7W A;  3SDV A;  1N7R A;  2BBC A;  3S4A A;  3S4D A;  4M76 A;  3S9V A;  5EAU A;  4Q2B A;  1FMI A;  1UMP A;  1FPP B;  1GAH A;  3D5S A;  3DSV B;  5M7Y A;  3ACT A;  3S4B A;  3W7S A;  2EAE A;  1C82 A;  1TNO B;  5GY3 A;  3GT5 A;  1D8E B;  3PMM A;  1MZC B;  1CLC A;  2IEJ B;  4WVA A;  2JF4 A;  1J0M A;  4MMI A;  5ILI A;  1W6J A;  5IKH A;  3ANK A;  1GSZ A;  1H54 A;  3HXE B;  1FO2 A;  4F10 A;  3H3K A;  4YDO B;  2CQS A;  1N4Q B;  4V1S A;  5FO9 B;  1TNU B;  1RWH A;  3DSS B;  2ONG A;  2G0D A;  2G02 A;  3W5M A;  4GAX A;  5DGR A;  2WIN B;  3EU5 B;  2V8K A;  1XW2 A;  1FCE A;  5MEH A;  4E1Y A;  3DSW B;  3AFL A;  4BOK A;  3P5R A;  4OK2 A;  1X9D A;  2Q1F A;  3RRS A;  2WDA A;  4TXT A;  2RI9 A;  1WU6 A;  3OXU A;  2A8Z A;  3DSX B;  5KKB A;  4OK4 A;  1O1R B;  2E24 A;  5AGD A;  2BRW A;  3E37 B;  2EAB A;  1S64 B;  2F6D A;  3M7L A;  1HN0 A;  1L1Y A;  1N4R B;  1TNY B;  3X17 A;  1EGU A;  3P2C A;  4EHM B;  3M7C A; 
#chains in the Genus database with same CATH homology
 1GXN A;  3QWT A;  1IA6 A;  1TNZ B;  3KSL B;  1TN8 B;  2Z07 A;  1SA5 B;  4GTR B;  4V1R A;  1UG9 A;  3TF4 A;  3QFZ A;  4GTP B;  2JG0 A;  3RJ3 A;  3EQA A;  1AYX A;  2BB6 A;  2SQC A;  2WII B;  2ZZR A;  1H12 A;  3PYB A;  2B4F A;  2RGK A;  2AHG A;  1CEM A;  1TF4 A;  2EAD A;  3Q78 B;  4EL8 A;  1LF6 A;  1KSD A;  2VN4 A;  1NC5 A;  2BB5 A;  3ON6 A;  3PZ2 B;  4ZG8 A;  2XWB B;  4DOE A;  3DST B;  1X81 B;  3HXC B;  5JPM B;  3C72 B;  3K7X A;  1FT2 B;  3M7B A;  3ACS A;  2FBA A;  1HZF A;  2YIK A;  2H6I B;  4LIX A;  1N4S B;  1V7X A;  3PZ1 B;  2FV1 A;  4XUV A;  1XWQ A;  2ZIS B;  2QNO A;  3W5N A;  1UT9 A;  3SQC A;  2R2L B;  3PYA A;  1D8D B;  4WVC A;  1H35 A;  5DGQ A;  2H6G B;  3CU7 A;  1W6K A;  4TF4 A;  3WUX A;  4YCR A;  1SQC A;  3Q7A B;  1JS4 A;  3W7U A;  1DL2 A;  4ZRQ A;  2FUZ A;  4CJ0 A;  3WKG A;  5JPN B;  2V3N A;  3SFY B;  2P0V A;  4ZH5 A;  3M73 A;  4AYQ A;  1V5D A;  3SDU A;  1G6I A;  3EUV B;  1H39 A;  4KKI A;  3WKF A;  1O1S B;  3M72 A;  2NVP A;  1R76 A;  3DPY B;  4MU9 A;  2PMV A;  2B39 A;  3OED A;  3QT9 A;  1KRE A;  2H6F B;  1WZZ A;  1GLM A;  4YDE B;  1LD7 B;  3W7T A;  1G87 A;  3HXB B;  1KFG A;  3KQ4 A;  4KTP A;  2XQW A;  4GTQ B;  4CE7 A;  3SAE A;  3D3I A;  3WIQ A;  3ANI A;  2V8I A;  2DRS A;  3WIW A;  4J5T A;  1S63 B;  4WVB A;  1FAE A;  2XWJ B;  4MBG B;  4WU0 A;  1N4P B;  1IS9 A;  1H36 A;  2I07 B;  3QRY A;  4CJ1 A;  3PZ3 B;  4LNG B;  3E32 B;  3REN A;  4AYR A;  1H3A A;  1FBO A;  3E6U A;  1RQ5 A;  1TN7 B;  2V8J A;  2D5J A;  1GHQ A;  4L0G A;  4GTO B;  3WKI A;  1K72 A;  5M7I A;  4GTT B;  1N95 B;  2H6H B;  2WYN A;  2GZ6 A;  4GL3 A;  2WY8 A;  4D4D A;  3HXD B;  5CD2 A;  1QBQ B;  4D4B A;  1G9J A;  3VXD A;  4D4C A;  4L9P B;  2AFA A;  3W7X A;  1DOG A;  4Z4L A;  1L2A A;  2WY7 A;  4LNB B;  2F0Y B;  1KZO B;  3GLY A;  1FBW A;  3EU8 A;  1LF9 A;  1O6H A;  1VD5 A;  4GTV B;  4GTS B;  2OKX A;  4Q88 A;  3QDE A;  1LTX B;  1ULV A;  4LNV A;  1H37 A;  4ZH1 A;  1SA4 B;  5FOB B;  4JJJ A;  3W7W A;  1H3B A;  1F9O A;  4ZRP A;  2V3P A;  3Q75 B;  1QSJ A;  1FT1 B;  4AYO A;  1KKT A;  3A3V A;  3ANJ A;  3K11 A;  2PN5 A;  3AFJ A;  1V5C A;  1O1T B;  1GA2 A;  3M74 A;  4GTM B;  4KKJ A;  1FO3 A;  3H2W A;  1N94 B;  1KSC A;  1KZP B;  5GW7 A;  2DRR A;  4ONT A;  1H3C A;  2VN7 A;  1C3D A;  3QSP A;  1JCS B;  3SFX B;  1WU5 A;  1O79 A;  3WC3 A;  3RX5 A;  1O6R A;  1HCU A;  3RX8 A;  3QG0 A;  3M75 A;  4AYP A;  1JCQ B;  4DOD A;  3GZK A;  1H14 A;  3WKH A;  3QT3 A;  2A73 B;  3RSY A;  1AGM A;  3E30 B;  1H13 A;  3E34 B;  3SDT A;  1V7V A;  2RI8 A;  1JCR B;  4D4A A;  3M76 A;  4KTR A;  2CQT A;  3Q79 B;  1F9D A;  4FUS A;  1O5M B;  2ZBL A;  1DCE B;  3M71 A;  3E73 A;  5FO8 B;  1IA7 A;  3QPF A;  1TN6 B;  3HXF B;  1NL4 B;  4D94 A;  2DRO A;  5E2J A;  3DSU B;  5CZL A;  4L6X A;  2DRQ A;  1GXO A;  2GH4 A;  3RX7 A;  3KSQ B;  1O6Q A;  3KLS A;  2EAC A;  3WIR A;  4C1S A;  2JJB A;  3D5R A;  3EZ8 A;  3M7C A;  4BOJ A;  1N9A B;  3CIH A;  1G9G A;  2BED B;  1WU4 A;  4QT9 A;  3P5P A;  1KWF A;  1GXM A;  5CA3 A;  3M7E A;  3SDQ A;  1QQF A;  3Q73 B;  3Q7F B;  5FO7 B;  3S4C A;  2NOJ A;  1NXC A;  3H7L A;  1NI1 B;  2GOX A;  2XFG A;  1KRF A;  2ZIR B;  1FP3 A;  3T33 A;  3DRA B;  3VW5 A;  1LD8 B;  3QXQ A;  4FXG B;  4FXK B;  1TNB B;  3PZ4 B;  3SDR A;  3M77 A;  2AHF A;  5GZK A;  2FV0 A;  3E33 B;  2D8L A;  1XWT A;  3QXF A;  1GAI A;  1KS8 A;  3G6J B;  3QFY A;  1V7W A;  3SDV A;  3S4A A;  2BBC A;  3S4D A;  4M76 A;  3S9V A;  4Q2B A;  1FMI A;  1UMP A;  1FPP B;  1GAH A;  3D5S A;  3DSV B;  5M7Y A;  3ACT A;  3S4B A;  3W7S A;  2EAE A;  1TNO B;  5GY3 A;  3GT5 A;  1D8E B;  3PMM A;  1MZC B;  1CLC A;  2IEJ B;  4WVA A;  2JF4 A;  1W6J A;  3ANK A;  1GSZ A;  1H54 A;  3HXE B;  1FO2 A;  3H3K A;  4YDO B;  2CQS A;  1N4Q B;  4V1S A;  5FO9 B;  1TNU B;  3DSS B;  2G0D A;  2G02 A;  3W5M A;  5DGR A;  2WIN B;  2V8K A;  1XW2 A;  3EU5 B;  1FCE A;  5MEH A;  3DSW B;  4BOK A;  3P5R A;  3RRS A;  1X9D A;  4TXT A;  2RI9 A;  1WU6 A;  3OXU A;  2A8Z A;  3DSX B;  5KKB A;  1O1R B;  5AGD A;  3E37 B;  2EAB A;  1S64 B;  2F6D A;  3M7L A;  1L1Y A;  1N4R B;  1TNY B;  3X17 A;  4Z4J A;  3P2C A;  4EHM B;  3M78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...