4BOJA

Crystal structure of bacillus circulans tn-31 aman6 in complex with mannobiose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
336
structure length
336
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDAWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHRNSDHIVDGNWAGQLLSGTYESWSSAAAVQALNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title The Structure of B. Circulans Aman6 Defines the Fold and Mechanism of the Gh-76 Mannoprotein Transglycosylases and Bacterial Mannosidases
rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 137
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4bojA00
1D8DB 4GTSB 3Q7FB 5FO9B 3PZ2B 2PMVA 1H3BA 3Q73B 2V8IA 1O6HA 1TNYB 3DSXB 4D4AA 1FPPB 2G0DA 1S64B 5JPMB 3C72B 4ZRPA 2BBCA 1GXOA 1GXNA 1O5MB 3KLSA 1LD7B 4V1SA 4V1RA 4L9PB 1SQCA 1N4RB 2V8KA 3K7XA 4D4DA 1N4QB 1H36A 2BB6A 5FOBB 4KKIA 3E34B 4YDOB 3EU5B 1UMPA 2NOJA 3DPYB 4D94A 4D4CA 2ZISB 4GTMB 1O1RB 3CU7A 3Q78B 5JPNB 2SQCA 3EUVB 3G6JB 3SFXB 3SFYB 3KSQB 1S63B 4GTRB 2B39A 4MBGB 1QBQB 1H35A 1KZOB 1N4SB 3DSWB 4ONTA 1TN8B 2H6GB 4ZH1A 1LD8B 3Q75B 4GTOB 1H39A 1O6QA 3DSSB 3OXUA 2WIIB 3DSUB 2A73B 2H6FB 1X81B 4M76A 4EHMB 1QSJA 2XWBB 4GTQB 1JCQB 1TNOB 1TNZB 3D5RA 4GTTB 4LNVA 1NL4B 5FO7B 1H3CA 1O1SB 2F0YB 4BOJA 1KZPB 4ZRQA 2H6HB 1DCEB 3PZ1B 5FO8B 1D8EB 1N4PB 1C3DA 3DRAB 3PZ3B 3HXFB 1R76A 4FXGB 1N94B 2IEJB 2R2LB 3OEDA 2BEDB 4FXKB 2G02A 4D4BA 2I07B 1GHQA 3KSLB 1NI1B 1TNUB 2BB5A 3KQ4A 1TN7B 4C1SA 5AGDA 1O79A 4GTVB 1H37A 3HXCB 1W6JA 4YDEB 2H6IB 1JCSB 3E37B 3SQCA 2WY8A 2ZIRB 3HXEB 2V3NA 3PZ4B 1O1TB 3E32B 4BOKA 4GTPB 3Q7AB 2XWJB 1MZCB 1TNBB 3E30B 1JCRB 2PN5A 1N95B 3DSTB 1TN6B 2WINB 2V8JA 1FT1B 1FT2B 3Q79B 3RJ3A 1GXMA 1O6RA 1W6KA 1LTXB 2GOXA 2V3PA 1GSZA 3HXBB 4MU9A 1SA5B 1QQFA 4KKJA 1N9AB 2WY7A 3D5SA 2XQWA 1HZFA 1SA4B 3HXDB 4LNBB 3DSVB 3E33B 1H3AA 4LNGB
chains in the Genus database with same CATH superfamily
4RNQA 2WYNA 4OK2A 2DRSA 1L1YA 1H54A 1TNYB 1KS8A 2P0VA 4ZRPA 1FP3A 1G9JA 1NC5A 1GXNA 3KLSA 2E22A 3ACSA 1WU6A 3K7XA 2V8KA 2J5CA 2EAEA 2JG0A 5DGQA 4J5TA 1FCEA 4YDOB 3WKFA 1UMPA 4MMIA 3GLYA 1IS9A 5JMDA 2RI8A 3S9VA 3CU7A 3Q78B 5JPNB 3W7TA 3KSQB 3EZ8A 5DHKA 2B39A 3VSNA 1W3YA 1V7VA 1KZOB 3DSWB 2WCOA 2GZ6A 1TN8B 2GH4A 3QT3A 3A3VA 1H39A 1O6QA 3OXUA 2WIIB 5JMFA 3DSUB 1LXMA 2H6FB 4OZWA 1X81B 1X9DA 3PYBA 4GL3A 3WIWA 2XWBB 3PMMA 1TNZB 3D5RA 4GTTB 1O1SB 3A0OA 5M7YA 5EAUA 1DCEB 2FV0A 3M72A 4OK4A 3PZ3B 3HXFB 2IEJB 2R2LB 1V5CA 3OEDA 4NEIA 4FXKB 3AFJA 2ZBLA 2ZZRA 1OJOA 5AGDA 1GA2A 3W7WA 3P2CA 1JCSB 3SQCA 3M7BA 2WY8A 4OZVA 3PZ4B 1N24A 2XFGA 3SDVA 2XWJB 3QFYA 5GW7A 2EACA 3E30B 1GLMA 3QDEA 1OJMA 5CZLA 1N95B 3M7EA 1TN6B 1KRFA 2WINB 1O6RA 3AFLA 2OKXA 1CB8A 5IL3A 1IA6A 1OJPA 2RGKA 4KKJA 1N9AB 5M7IA 1FAEA 1KKTA 4CE7A 4F10A 1SA4B 2Q1FA 3VW5A 2AHFA 2VN7A 1HMUA 2CQTA 1X1HA 1D8DB 3ANJA 1VD5A 4DOEA 1H3BA 3Q73B 1ULVA 3H7LA 1LXKA 3DSXB 3K11A 2DROA 4DODA 3C72B 2BRPA 4E1YA 2BBCA 1GXOA 2YIKA 4V1SA 4V1RA 1IA7A 3QXFA 1N4QB 4Z4LA 1N7OA 1FO2A 1K72A 1F1SA 4D4CA 4GTMB 4OJZA 2FUQA 1AGMA 3E7JA 2AHGA 1H13A 3EUVB 3G6JB 3SFYB 3E80A 1S63B 3ANIA 3EU8A 3G4DA 3M01A 3VSMA 2FBAA 5ILJA 4ONTA 4FJQA 2H6GB 5ILYA 3X17A 3EQAA 1LD8B 1RWFA 2FV1A 4GTOB 3RENA 4AYPA 4M76A 4TF4A 5DHIA 5ILZA 1QSJA 4GTQB 1TNOB 1N1ZA 3QRYA 5FO7B 3T33A 1UT9A 3W7SA 1KZPB 4CJ0A 5FO8B 1X1IA 5EASA 1C3DA 3DRAB 3WUXA 3SDQA 1XWTA 1XWQA 3H3KA 3TF4A 4WVCA 3ON6A 1N1BA 3KSLB 1TNUB 3KQ4A 2BB5A 1TN7B 5GZKA 2VN4A 3HXCB 2EABA 3P5PA 4JJJA 4YDEB 4L6XA 1N23A 4QT9A 1N7RA 5EATA 5E2JA 4TXTA 4GTPB 2ONHA 1RW9A 3M74A 3NNBA 3ANKA 2ONGA 1JCRB 3SDTA 2D8LA 1KSDA 1FT2B 3Q79B 5IK6A 1GXMA 1HXCA 2V3PA 4F13A 1GSZA 1QQFA 3M7LA 1QAZA 2WY7A 3D5SA 2XQWA 1C82A 3D3IA 4LNBB 3DSVB 4LNGB 3Q7FB 1HX9A 2PMVA 5CD2A 4AYOA 3RX5A 5IM1A 1HXGA 1O6HA 4LIXA 4D4AA 1GAHA 1FPPB 2G0DA 1S64B 5JPMB 1N7PA 3VXDA 1N7QA 1NXCA 1OJNA 1EGUA 5IKHA 3RX7A 1WZZA 4L9PB 1HM2A 4KTPA 4ZH5A 1SQCA 1N4RB 5FOBB 1DOGA 3SDUA 1H36A 3S4AA 4L0GA 1N22A 3E34B 1HXAA 3EU5B 5IK9A 2NOJA 1O1RB 1TF4A 1WU5A 2SQCA 3SFXB 3WKIA 4WVAA 5MEHA 4WVBA 4MBGB 3W5NA 1XW2A 1H35A 5KKBA 3PYAA 3RX8A 3P5RA 3WIQA 4GAXA 3M71A 1X1JA 3Q75B 1RWAA 3ACTA 1WU4A 3DSSB 5IK0A 1V7XA 2A73B 3M76A 1FMIA 1AYXA 2AFAA 1CEMA 3W7UA 4EHMB 4LNVA 1NL4B 1H3CA 4MMHA 3G4FA 1N7NA 2H6HB 3QFZA 3CIHA 3N0GA 1FBOA 1N21A 5CA3A 3M75A 1F9DA 1J0MA 1GHQA 5IKAA 4C1SA 1I8QA 3M77A 4GTVB 5IL8A 1H37A 3QPFA 2WDAA 2DRRA 2H6IB 4KTRA 3E37B 1HM3A 3QG0A 3WC3A 2ZIRB 3HXEB 2V3NA 3E32B 4BOKA 1G9GA 3QT9A 2JJBA 5ILDA 5ILKA 3S4BA 3M00A 1MZCB 2PN5A 4FNVA 3DSTB 1RQ5A 2V8JA 1FT1B 3QWTA 2A8ZA 3RJ3A 1LTXB 3HXBB 3RSYA 4MU9A 1SA5B 1UG9A 2BRVX 2EADA 3E33B 1H3AA 3GT5A 3M7CA 3M02A 4GTSB 1LF6A 5FO9B 3PZ2B 3QSPA 5GY3A 1CLCA 2V8IA 2FUZA 1H14A 1N20A 3SDRA 3N0FA 1O5MB 1KREA 1LD7B 3E73A 2DRQA 2X03A 1V7WA 3LZ9A 2FUTA 5DGRA 1HV6A 3GZKA 3WIRA 4D4DA 2BB6A 1FBWA 1GAIA 4KKIA 4Q2BA 1KFGA 4AYQA 1RWGA 1DL2A 3DPYB 4D94A 2CQSA 2ZISB 4AYRA 2D5JA 2BRWA 3S4CA 3RRSA 4GTRB 1HCUA 1QBQB 2E24A 1G6IA 4DI5A 1N4SB 1LF9A 1F9GA 3M73A 4ZH1A 3QXQA 1JS4A 1KWFA 1J0NA 4WU0A 4Z4JA 1G87A 4FUSA 1JCQB 3NFVA 3WKHA 2F0YB 1RWHA 4BOJA 1H12A 4ZRQA 2F6DA 3M78A 3PZ1B 1D8EB 1N4PB 4FXGB 1R76A 1N94B 2BEDB 2G02A 4D4BA 2I07B 1NI1B 4YCRA 2RI9A 1O79A 4Q88A 3W5MA 1FO3A 1LOHA 1V5DA 1W6JA 4CJ1A 2Z07A 2QNOA 1F9OA 1O1TB 1HN0A 3W7XA 1RWCA 3Q7AB 5C05A 2B4FA 1TNBB 1HMWA 3WKGA 4EL8A 4ZG8A 1L2AA 1W6KA 2JF4A 1KSCA 2GOXA 3H2WA 5ILIA 3E6UA 4XUVA 2NVPA 1HZFA 3HXDB 3SAEA 3S4DA 5ILHA
chains in the Genus database with same CATH topology
2WYNA 2DRSA 1L1YA 1H54A 1TNYB 1KS8A 2P0VA 4ZRPA 1FP3A 1G9JA 1NC5A 1GXNA 3KLSA 3ACSA 1WU6A 3K7XA 2V8KA 2EAEA 2JG0A 5DGQA 4J5TA 1FCEA 4YDOB 3WKFA 1UMPA 3GLYA 1IS9A 2RI8A 3S9VA 3CU7A 3Q78B 5JPNB 3W7TA 3KSQB 3EZ8A 2B39A 1V7VA 1KZOB 3DSWB 2GZ6A 1TN8B 2GH4A 3QT3A 3A3VA 1H39A 1O6QA 3OXUA 2WIIB 3DSUB 2H6FB 1X81B 1X9DA 3PYBA 4GL3A 3WIWA 2XWBB 3PMMA 1TNZB 3D5RA 4GTTB 1O1SB 5M7YA 1DCEB 2FV0A 3M72A 3PZ3B 3HXFB 2IEJB 2R2LB 1V5CA 3OEDA 4FXKB 3AFJA 2ZBLA 2ZZRA 5AGDA 1GA2A 3W7WA 3P2CA 1JCSB 3SQCA 3M7BA 2WY8A 3PZ4B 2XFGA 3SDVA 2XWJB 3QFYA 5GW7A 2EACA 3E30B 1GLMA 3QDEA 5CZLA 1N95B 3M7EA 1TN6B 1KRFA 2WINB 1O6RA 2OKXA 1IA6A 4KKJA 2RGKA 1N9AB 5M7IA 1FAEA 1KKTA 4CE7A 1SA4B 3VW5A 2AHFA 2VN7A 2CQTA 1D8DB 3ANJA 1VD5A 4DOEA 1H3BA 3Q73B 1ULVA 3H7LA 3DSXB 3K11A 2DROA 4DODA 3C72B 2BBCA 1GXOA 2YIKA 4V1SA 4V1RA 1IA7A 3QXFA 1N4QB 4Z4LA 1FO2A 1K72A 4D4CA 4GTMB 1AGMA 2AHGA 1H13A 3EUVB 3G6JB 3SFYB 1S63B 3ANIA 3EU8A 2FBAA 4ONTA 2H6GB 3X17A 3EQAA 1LD8B 2FV1A 4GTOB 3RENA 4AYPA 4M76A 4TF4A 1QSJA 4GTQB 1TNOB 3QRYA 5FO7B 3T33A 1UT9A 3W7SA 1KZPB 4CJ0A 5FO8B 1C3DA 3DRAB 3WUXA 3SDQA 1XWTA 1XWQA 3H3KA 3TF4A 4WVCA 3ON6A 3KSLB 1TNUB 3KQ4A 2BB5A 1TN7B 5GZKA 2VN4A 3HXCB 2EABA 3P5PA 4JJJA 4YDEB 4L6XA 4QT9A 5E2JA 4TXTA 4GTPB 3M74A 3ANKA 1JCRB 3SDTA 2D8LA 1KSDA 1FT2B 3Q79B 1GXMA 2V3PA 1GSZA 1QQFA 3M7LA 2WY7A 3D5SA 2XQWA 3D3IA 4LNBB 3DSVB 4LNGB 3Q7FB 2PMVA 5CD2A 4AYOA 3RX5A 1O6HA 4LIXA 4D4AA 1GAHA 1FPPB 2G0DA 1S64B 5JPMB 3VXDA 1NXCA 3RX7A 1WZZA 4L9PB 4KTPA 4ZH5A 1SQCA 1N4RB 5FOBB 1DOGA 3SDUA 1H36A 3S4AA 4L0GA 3E34B 3EU5B 2NOJA 1O1RB 1TF4A 1WU5A 2SQCA 3SFXB 3WKIA 4WVAA 5MEHA 4WVBA 4MBGB 3W5NA 1XW2A 1H35A 5KKBA 3PYAA 3RX8A 3P5RA 3WIQA 3M71A 3Q75B 3ACTA 1WU4A 3DSSB 1V7XA 2A73B 3M76A 1FMIA 1AYXA 2AFAA 1CEMA 3W7UA 4EHMB 4LNVA 1NL4B 1H3CA 2H6HB 3QFZA 3CIHA 1FBOA 5CA3A 3M75A 1F9DA 1GHQA 4C1SA 3M77A 4GTVB 1H37A 3QPFA 2DRRA 2H6IB 4KTRA 3E37B 3QG0A 3WC3A 2ZIRB 3HXEB 2V3NA 3E32B 4BOKA 1G9GA 3QT9A 2JJBA 3S4BA 1MZCB 2PN5A 3DSTB 1RQ5A 2V8JA 1FT1B 3QWTA 2A8ZA 3RJ3A 1LTXB 3HXBB 3RSYA 4MU9A 1SA5B 1UG9A 2EADA 3E33B 1H3AA 3GT5A 3M7CA 4GTSB 1LF6A 5FO9B 3PZ2B 3QSPA 5GY3A 1CLCA 2V8IA 2FUZA 1H14A 3SDRA 1O5MB 1KREA 1LD7B 3E73A 2DRQA 1V7WA 5DGRA 3GZKA 3WIRA 4D4DA 2BB6A 1FBWA 1GAIA 4KKIA 4Q2BA 1KFGA 4AYQA 1DL2A 3DPYB 4D94A 2CQSA 2ZISB 4AYRA 2D5JA 3S4CA 3RRSA 4GTRB 1HCUA 1QBQB 1G6IA 1N4SB 1LF9A 3M73A 4ZH1A 3QXQA 1JS4A 1KWFA 4WU0A 4Z4JA 1G87A 4FUSA 1JCQB 3WKHA 2F0YB 4BOJA 1H12A 4ZRQA 2F6DA 3M78A 3PZ1B 1D8EB 1N4PB 4FXGB 1R76A 1N94B 2BEDB 2G02A 4D4BA 2I07B 1NI1B 4YCRA 2RI9A 1O79A 4Q88A 3W5MA 1FO3A 1V5DA 1W6JA 4CJ1A 2Z07A 2QNOA 1F9OA 1O1TB 3W7XA 3Q7AB 2B4FA 1TNBB 3WKGA 4EL8A 4ZG8A 1L2AA 1W6KA 2JF4A 1KSCA 2GOXA 3H2WA 3E6UA 4XUVA 2NVPA 1HZFA 3HXDB 3SAEA 3S4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8D B;  4GTS B;  3Q7F B;  5FO9 B;  3PZ2 B;  2PMV A;  1H3B A;  3Q73 B;  2V8I A;  1O6H A;  1TNY B;  3DSX B;  4D4A A;  1FPP B;  2G0D A;  1S64 B;  5JPM B;  3C72 B;  4ZRP A;  2BBC A;  1GXO A;  1GXN A;  1O5M B;  3KLS A;  1LD7 B;  4V1S A;  4V1R A;  4L9P B;  1SQC A;  1N4R B;  2V8K A;  3K7X A;  4D4D A;  1N4Q B;  1H36 A;  2BB6 A;  5FOB B;  4KKI A;  3E34 B;  4YDO B;  3EU5 B;  1UMP A;  2NOJ A;  3DPY B;  4D94 A;  4D4C A;  2ZIS B;  4GTM B;  1O1R B;  3CU7 A;  3Q78 B;  5JPN B;  2SQC A;  3EUV B;  3G6J B;  3SFX B;  3SFY B;  3KSQ B;  1S63 B;  4GTR B;  2B39 A;  4MBG B;  1QBQ B;  1H35 A;  1KZO B;  1N4S B;  3DSW B;  4ONT A;  1TN8 B;  2H6G B;  4ZH1 A;  1LD8 B;  3Q75 B;  4GTO B;  1H39 A;  1O6Q A;  3DSS B;  3OXU A;  2WII B;  3DSU B;  2A73 B;  2H6F B;  1X81 B;  4M76 A;  4EHM B;  1QSJ A;  2XWB B;  4GTQ B;  1JCQ B;  1TNO B;  1TNZ B;  3D5R A;  4GTT B;  4LNV A;  1NL4 B;  5FO7 B;  1H3C A;  1O1S B;  2F0Y B;  4BOJ A;  1KZP B;  4ZRQ A;  2H6H B;  1DCE B;  3PZ1 B;  5FO8 B;  1D8E B;  1N4P B;  1C3D A;  3DRA B;  3PZ3 B;  3HXF B;  1R76 A;  4FXG B;  1N94 B;  2IEJ B;  2R2L B;  3OED A;  2BED B;  4FXK B;  2G02 A;  4D4B A;  2I07 B;  1GHQ A;  3KSL B;  1NI1 B;  1TNU B;  2BB5 A;  3KQ4 A;  1TN7 B;  4C1S A;  5AGD A;  1O79 A;  4GTV B;  1H37 A;  3HXC B;  1W6J A;  4YDE B;  2H6I B;  1JCS B;  3E37 B;  3SQC A;  2WY8 A;  2ZIR B;  3HXE B;  2V3N A;  3PZ4 B;  1O1T B;  3E32 B;  4BOK A;  4GTP B;  3Q7A B;  2XWJ B;  1MZC B;  1TNB B;  3E30 B;  1JCR B;  2PN5 A;  1N95 B;  3DST B;  1TN6 B;  2WIN B;  2V8J A;  1FT1 B;  1FT2 B;  3Q79 B;  3RJ3 A;  1GXM A;  1O6R A;  1W6K A;  1LTX B;  2GOX A;  2V3P A;  1GSZ A;  3HXB B;  4MU9 A;  1SA5 B;  1QQF A;  4KKJ A;  1N9A B;  2WY7 A;  3D5S A;  2XQW A;  1HZF A;  1SA4 B;  3HXD B;  4LNB B;  3DSV B;  3E33 B;  1H3A A;  4LNG B; 
#chains in the Genus database with same CATH topology
 4RNQ A;  2WYN A;  4OK2 A;  2DRS A;  1L1Y A;  1H54 A;  1TNY B;  1KS8 A;  2P0V A;  4ZRP A;  1FP3 A;  1G9J A;  1NC5 A;  1GXN A;  3KLS A;  2E22 A;  3ACS A;  1WU6 A;  3K7X A;  2V8K A;  2J5C A;  2EAE A;  2JG0 A;  5DGQ A;  4J5T A;  1FCE A;  4YDO B;  3WKF A;  1UMP A;  4MMI A;  3GLY A;  1IS9 A;  5JMD A;  2RI8 A;  3S9V A;  3CU7 A;  3Q78 B;  5JPN B;  3W7T A;  3KSQ B;  3EZ8 A;  5DHK A;  2B39 A;  3VSN A;  1W3Y A;  1V7V A;  1KZO B;  3DSW B;  2WCO A;  2GZ6 A;  1TN8 B;  2GH4 A;  3QT3 A;  3A3V A;  1H39 A;  1O6Q A;  3OXU A;  2WII B;  5JMF A;  3DSU B;  1LXM A;  2H6F B;  4OZW A;  1X81 B;  1X9D A;  3PYB A;  4GL3 A;  3WIW A;  2XWB B;  3PMM A;  1TNZ B;  3D5R A;  4GTT B;  1O1S B;  3A0O A;  5M7Y A;  5EAU A;  1DCE B;  2FV0 A;  3M72 A;  4OK4 A;  3PZ3 B;  3HXF B;  2IEJ B;  2R2L B;  1V5C A;  3OED A;  4NEI A;  4FXK B;  3AFJ A;  2ZBL A;  2ZZR A;  1OJO A;  5AGD A;  1GA2 A;  3W7W A;  3P2C A;  1JCS B;  3SQC A;  3M7B A;  2WY8 A;  4OZV A;  3PZ4 B;  1N24 A;  2XFG A;  3SDV A;  2XWJ B;  3QFY A;  5GW7 A;  2EAC A;  3E30 B;  1GLM A;  3QDE A;  1OJM A;  5CZL A;  1N95 B;  3M7E A;  1TN6 B;  1KRF A;  2WIN B;  1O6R A;  3AFL A;  2OKX A;  1CB8 A;  5IL3 A;  1IA6 A;  1OJP A;  2RGK A;  4KKJ A;  1N9A B;  5M7I A;  1FAE A;  1KKT A;  4CE7 A;  4F10 A;  1SA4 B;  2Q1F A;  3VW5 A;  2AHF A;  2VN7 A;  1HMU A;  2CQT A;  1X1H A;  1D8D B;  3ANJ A;  1VD5 A;  4DOE A;  1H3B A;  3Q73 B;  1ULV A;  3H7L A;  1LXK A;  3DSX B;  3K11 A;  2DRO A;  4DOD A;  3C72 B;  2BRP A;  4E1Y A;  2BBC A;  1GXO A;  2YIK A;  4V1S A;  4V1R A;  1IA7 A;  3QXF A;  1N4Q B;  4Z4L A;  1N7O A;  1FO2 A;  1K72 A;  1F1S A;  4D4C A;  4GTM B;  4OJZ A;  2FUQ A;  1AGM A;  3E7J A;  2AHG A;  1H13 A;  3EUV B;  3G6J B;  3SFY B;  3E80 A;  1S63 B;  3ANI A;  3EU8 A;  3G4D A;  3M01 A;  3VSM A;  2FBA A;  5ILJ A;  4ONT A;  4FJQ A;  2H6G B;  5ILY A;  3X17 A;  3EQA A;  1LD8 B;  1RWF A;  2FV1 A;  4GTO B;  3REN A;  4AYP A;  4M76 A;  4TF4 A;  5DHI A;  5ILZ A;  1QSJ A;  4GTQ B;  1TNO B;  1N1Z A;  3QRY A;  5FO7 B;  3T33 A;  1UT9 A;  3W7S A;  1KZP B;  4CJ0 A;  5FO8 B;  1X1I A;  5EAS A;  1C3D A;  3DRA B;  3WUX A;  3SDQ A;  1XWT A;  1XWQ A;  3H3K A;  3TF4 A;  4WVC A;  3ON6 A;  1N1B A;  3KSL B;  1TNU B;  3KQ4 A;  2BB5 A;  1TN7 B;  5GZK A;  2VN4 A;  3HXC B;  2EAB A;  3P5P A;  4JJJ A;  4YDE B;  4L6X A;  1N23 A;  4QT9 A;  1N7R A;  5EAT A;  5E2J A;  4TXT A;  4GTP B;  2ONH A;  1RW9 A;  3M74 A;  3NNB A;  3ANK A;  2ONG A;  1JCR B;  3SDT A;  2D8L A;  1KSD A;  1FT2 B;  3Q79 B;  5IK6 A;  1GXM A;  1HXC A;  2V3P A;  4F13 A;  1GSZ A;  1QQF A;  3M7L A;  1QAZ A;  2WY7 A;  3D5S A;  2XQW A;  1C82 A;  3D3I A;  4LNB B;  3DSV B;  4LNG B;  3Q7F B;  1HX9 A;  2PMV A;  5CD2 A;  4AYO A;  3RX5 A;  5IM1 A;  1HXG A;  1O6H A;  4LIX A;  4D4A A;  1GAH A;  1FPP B;  2G0D A;  1S64 B;  5JPM B;  1N7P A;  3VXD A;  1N7Q A;  1NXC A;  1OJN A;  1EGU A;  5IKH A;  3RX7 A;  1WZZ A;  4L9P B;  1HM2 A;  4KTP A;  4ZH5 A;  1SQC A;  1N4R B;  5FOB B;  1DOG A;  3SDU A;  1H36 A;  3S4A A;  4L0G A;  1N22 A;  3E34 B;  1HXA A;  3EU5 B;  5IK9 A;  2NOJ A;  1O1R B;  1TF4 A;  1WU5 A;  2SQC A;  3SFX B;  3WKI A;  4WVA A;  5MEH A;  4WVB A;  4MBG B;  3W5N A;  1XW2 A;  1H35 A;  5KKB A;  3PYA A;  3RX8 A;  3P5R A;  3WIQ A;  4GAX A;  3M71 A;  1X1J A;  3Q75 B;  1RWA A;  3ACT A;  1WU4 A;  3DSS B;  5IK0 A;  1V7X A;  2A73 B;  3M76 A;  1FMI A;  1AYX A;  2AFA A;  1CEM A;  3W7U A;  4EHM B;  4LNV A;  1NL4 B;  1H3C A;  4MMH A;  3G4F A;  1N7N A;  2H6H B;  3QFZ A;  3CIH A;  3N0G A;  1FBO A;  1N21 A;  5CA3 A;  3M75 A;  1F9D A;  1J0M A;  1GHQ A;  5IKA A;  4C1S A;  1I8Q A;  3M77 A;  4GTV B;  5IL8 A;  1H37 A;  3QPF A;  2WDA A;  2DRR A;  2H6I B;  4KTR A;  3E37 B;  1HM3 A;  3QG0 A;  3WC3 A;  2ZIR B;  3HXE B;  2V3N A;  3E32 B;  4BOK A;  1G9G A;  3QT9 A;  2JJB A;  5ILD A;  5ILK A;  3S4B A;  3M00 A;  1MZC B;  2PN5 A;  4FNV A;  3DST B;  1RQ5 A;  2V8J A;  1FT1 B;  3QWT A;  2A8Z A;  3RJ3 A;  1LTX B;  3HXB B;  3RSY A;  4MU9 A;  1SA5 B;  1UG9 A;  2BRV X;  2EAD A;  3E33 B;  1H3A A;  3GT5 A;  3M7C A;  3M02 A;  4GTS B;  1LF6 A;  5FO9 B;  3PZ2 B;  3QSP A;  5GY3 A;  1CLC A;  2V8I A;  2FUZ A;  1H14 A;  1N20 A;  3SDR A;  3N0F A;  1O5M B;  1KRE A;  1LD7 B;  3E73 A;  2DRQ A;  2X03 A;  1V7W A;  3LZ9 A;  2FUT A;  5DGR A;  1HV6 A;  3GZK A;  3WIR A;  4D4D A;  2BB6 A;  1FBW A;  1GAI A;  4KKI A;  4Q2B A;  1KFG A;  4AYQ A;  1RWG A;  1DL2 A;  3DPY B;  4D94 A;  2CQS A;  2ZIS B;  4AYR A;  2D5J A;  2BRW A;  3S4C A;  3RRS A;  4GTR B;  1HCU A;  1QBQ B;  2E24 A;  1G6I A;  4DI5 A;  1N4S B;  1LF9 A;  1F9G A;  3M73 A;  4ZH1 A;  3QXQ A;  1JS4 A;  1KWF A;  1J0N A;  4WU0 A;  4Z4J A;  1G87 A;  4FUS A;  1JCQ B;  3NFV A;  3WKH A;  2F0Y B;  1RWH A;  4BOJ A;  1H12 A;  4ZRQ A;  2F6D A;  3M78 A;  3PZ1 B;  1D8E B;  1N4P B;  4FXG B;  1R76 A;  1N94 B;  2BED B;  2G02 A;  4D4B A;  2I07 B;  1NI1 B;  4YCR A;  2RI9 A;  1O79 A;  4Q88 A;  3W5M A;  1FO3 A;  1LOH A;  1V5D A;  1W6J A;  4CJ1 A;  2Z07 A;  2QNO A;  1F9O A;  1O1T B;  1HN0 A;  3W7X A;  1RWC A;  3Q7A B;  5C05 A;  2B4F A;  1TNB B;  1HMW A;  3WKG A;  4EL8 A;  4ZG8 A;  1L2A A;  1W6K A;  2JF4 A;  1KSC A;  2GOX A;  3H2W A;  5ILI A;  3E6U A;  4XUV A;  2NVP A;  1HZF A;  3HXD B;  3SAE A;  3S4D A;  5ILH A; 
#chains in the Genus database with same CATH homology
 2WYN A;  2DRS A;  1L1Y A;  1H54 A;  1TNY B;  1KS8 A;  2P0V A;  4ZRP A;  1FP3 A;  1G9J A;  1NC5 A;  1GXN A;  3KLS A;  3ACS A;  1WU6 A;  3K7X A;  2V8K A;  2EAE A;  2JG0 A;  5DGQ A;  4J5T A;  1FCE A;  4YDO B;  3WKF A;  1UMP A;  3GLY A;  1IS9 A;  2RI8 A;  3S9V A;  3CU7 A;  3Q78 B;  5JPN B;  3W7T A;  3KSQ B;  3EZ8 A;  2B39 A;  1V7V A;  1KZO B;  3DSW B;  2GZ6 A;  1TN8 B;  2GH4 A;  3QT3 A;  3A3V A;  1H39 A;  1O6Q A;  3OXU A;  2WII B;  3DSU B;  2H6F B;  1X81 B;  1X9D A;  3PYB A;  4GL3 A;  3WIW A;  2XWB B;  3PMM A;  1TNZ B;  3D5R A;  4GTT B;  1O1S B;  5M7Y A;  1DCE B;  2FV0 A;  3M72 A;  3PZ3 B;  3HXF B;  2IEJ B;  2R2L B;  1V5C A;  3OED A;  4FXK B;  3AFJ A;  2ZBL A;  2ZZR A;  5AGD A;  1GA2 A;  3W7W A;  3P2C A;  1JCS B;  3SQC A;  3M7B A;  2WY8 A;  3PZ4 B;  2XFG A;  3SDV A;  2XWJ B;  3QFY A;  5GW7 A;  2EAC A;  3E30 B;  1GLM A;  3QDE A;  5CZL A;  1N95 B;  3M7E A;  1TN6 B;  1KRF A;  2WIN B;  1O6R A;  2OKX A;  1IA6 A;  4KKJ A;  2RGK A;  1N9A B;  5M7I A;  1FAE A;  1KKT A;  4CE7 A;  1SA4 B;  3VW5 A;  2AHF A;  2VN7 A;  2CQT A;  1D8D B;  3ANJ A;  1VD5 A;  4DOE A;  1H3B A;  3Q73 B;  1ULV A;  3H7L A;  3DSX B;  3K11 A;  2DRO A;  4DOD A;  3C72 B;  2BBC A;  1GXO A;  2YIK A;  4V1S A;  4V1R A;  1IA7 A;  3QXF A;  1N4Q B;  4Z4L A;  1FO2 A;  1K72 A;  4D4C A;  4GTM B;  1AGM A;  2AHG A;  1H13 A;  3EUV B;  3G6J B;  3SFY B;  1S63 B;  3ANI A;  3EU8 A;  2FBA A;  4ONT A;  2H6G B;  3X17 A;  3EQA A;  1LD8 B;  2FV1 A;  4GTO B;  3REN A;  4AYP A;  4M76 A;  4TF4 A;  1QSJ A;  4GTQ B;  1TNO B;  3QRY A;  5FO7 B;  3T33 A;  1UT9 A;  3W7S A;  1KZP B;  4CJ0 A;  5FO8 B;  1C3D A;  3DRA B;  3WUX A;  3SDQ A;  1XWT A;  1XWQ A;  3H3K A;  3TF4 A;  4WVC A;  3ON6 A;  3KSL B;  1TNU B;  3KQ4 A;  2BB5 A;  1TN7 B;  5GZK A;  2VN4 A;  3HXC B;  2EAB A;  3P5P A;  4JJJ A;  4YDE B;  4L6X A;  4QT9 A;  5E2J A;  4TXT A;  4GTP B;  3M74 A;  3ANK A;  1JCR B;  3SDT A;  2D8L A;  1KSD A;  1FT2 B;  3Q79 B;  1GXM A;  2V3P A;  1GSZ A;  1QQF A;  3M7L A;  2WY7 A;  3D5S A;  2XQW A;  3D3I A;  4LNB B;  3DSV B;  4LNG B;  3Q7F B;  2PMV A;  5CD2 A;  4AYO A;  3RX5 A;  1O6H A;  4LIX A;  4D4A A;  1GAH A;  1FPP B;  2G0D A;  1S64 B;  5JPM B;  3VXD A;  1NXC A;  3RX7 A;  1WZZ A;  4L9P B;  4KTP A;  4ZH5 A;  1SQC A;  1N4R B;  5FOB B;  1DOG A;  3SDU A;  1H36 A;  3S4A A;  4L0G A;  3E34 B;  3EU5 B;  2NOJ A;  1O1R B;  1TF4 A;  1WU5 A;  2SQC A;  3SFX B;  3WKI A;  4WVA A;  5MEH A;  4WVB A;  4MBG B;  3W5N A;  1XW2 A;  1H35 A;  5KKB A;  3PYA A;  3RX8 A;  3P5R A;  3WIQ A;  3M71 A;  3Q75 B;  3ACT A;  1WU4 A;  3DSS B;  1V7X A;  2A73 B;  3M76 A;  1FMI A;  1AYX A;  2AFA A;  1CEM A;  3W7U A;  4EHM B;  4LNV A;  1NL4 B;  1H3C A;  2H6H B;  3QFZ A;  3CIH A;  1FBO A;  5CA3 A;  3M75 A;  1F9D A;  1GHQ A;  4C1S A;  3M77 A;  4GTV B;  1H37 A;  3QPF A;  2DRR A;  2H6I B;  4KTR A;  3E37 B;  3QG0 A;  3WC3 A;  2ZIR B;  3HXE B;  2V3N A;  3E32 B;  4BOK A;  1G9G A;  3QT9 A;  2JJB A;  3S4B A;  1MZC B;  2PN5 A;  3DST B;  1RQ5 A;  2V8J A;  1FT1 B;  3QWT A;  2A8Z A;  3RJ3 A;  1LTX B;  3HXB B;  3RSY A;  4MU9 A;  1SA5 B;  1UG9 A;  2EAD A;  3E33 B;  1H3A A;  3GT5 A;  3M7C A;  4GTS B;  1LF6 A;  5FO9 B;  3PZ2 B;  3QSP A;  5GY3 A;  1CLC A;  2V8I A;  2FUZ A;  1H14 A;  3SDR A;  1O5M B;  1KRE A;  1LD7 B;  3E73 A;  2DRQ A;  1V7W A;  5DGR A;  3GZK A;  3WIR A;  4D4D A;  2BB6 A;  1FBW A;  1GAI A;  4KKI A;  4Q2B A;  1KFG A;  4AYQ A;  1DL2 A;  3DPY B;  4D94 A;  2CQS A;  2ZIS B;  4AYR A;  2D5J A;  3S4C A;  3RRS A;  4GTR B;  1HCU A;  1QBQ B;  1G6I A;  1N4S B;  1LF9 A;  3M73 A;  4ZH1 A;  3QXQ A;  1JS4 A;  1KWF A;  4WU0 A;  4Z4J A;  1G87 A;  4FUS A;  1JCQ B;  3WKH A;  2F0Y B;  4BOJ A;  1H12 A;  4ZRQ A;  2F6D A;  3M78 A;  3PZ1 B;  1D8E B;  1N4P B;  4FXG B;  1R76 A;  1N94 B;  2BED B;  2G02 A;  4D4B A;  2I07 B;  1NI1 B;  4YCR A;  2RI9 A;  1O79 A;  4Q88 A;  3W5M A;  1FO3 A;  1V5D A;  1W6J A;  4CJ1 A;  2Z07 A;  2QNO A;  1F9O A;  1O1T B;  3W7X A;  3Q7A B;  2B4F A;  1TNB B;  3WKG A;  4EL8 A;  4ZG8 A;  1L2A A;  1W6K A;  2JF4 A;  1KSC A;  2GOX A;  3H2W A;  3E6U A;  4XUV A;  2NVP A;  1HZF A;  3HXD B;  3SAE A;  3S4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...