4BOJA

Crystal structure of bacillus circulans tn-31 aman6 in complex with mannobiose
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
336
structure length
336
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDAWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHRNSDHIVDGNWAGQLLSGTYESWSSAAAVQALNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-1,6-MANNANASE
publication title The Structure of B. Circulans Aman6 Defines the Fold and Mechanism of the Gh-76 Mannoprotein Transglycosylases and Bacterial Mannosidases
rcsb
source organism Bacillus circulans
total genus 137
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4bojA00
2V8IA 3OEDA 1H37A 4L9PB 1GHQA 1W6KA 2B39A 1TNBB 2V8KA 5FO8B 1O5MB 4D4AA 3E30B 1X81B 4GTMB 4V1RA 4GTTB 5JPMB 3DRAB 2NOJA 4GTVB 3Q73B 4GTOB 3Q7FB 3EU5B 1GXMA 5FOBB 1O6RA 1HZFA 1NL4B 1FT1B 1LD8B 2R2LB 4MBGB 4MU9A 4ZRQA 1LTXB 2BEDB 3DSSB 2BB6A 1N95B 4EHMB 1SA4B 3D5SA 3Q79B 3PZ4B 1UMPA 2IEJB 1GXNA 2G02A 1GXOA 2I07B 1TNOB 1N94B 3HXFB 1DCEB 3HXBB 4BOJA 3RJ3A 3E33B 4YDEB 1D8EB 1N4RB 2WINB 4KKJA 3HXEB 3Q7AB 1N4QB 1TNYB 3SFYB 4C1SA 1MZCB 4GTRB 2ZIRB 3E37B 3PZ1B 3G6JB 1FPPB 1GSZA 2H6FB 3DSWB 1LD7B 4ONTA 2BB5A 3KSLB 1H3CA 3DSTB 3SQCA 4LNVA 1C3DA 2XWJB 1H35A 1QSJA 2ZISB 1H3BA 3HXCB 1JCRB 5FO7B 4FXGB 3PZ2B 4ZH1A 1TNUB 2PMVA 3DSXB 1SQCA 2SQCA 4D4DA 2WY8A 4GTSB 4M76A 1QBQB 2WIIB 2H6IB 3PZ3B 4BOKA 1TN6B 1TNZB 1O1TB 1O1SB 1TN8B 2XWBB 4LNBB 1NI1B 1QQFA 3DSUB 1R76A 1KZOB 3KLSA 1S64B 2H6HB 4D4CA 5JPNB 1SA5B 2G0DA 1N4PB 1TN7B 1N9AB 1W6JA 1JCQB 5FO9B 3DSVB 4D94A 3CU7A 1JCSB 3OXUA 4GTPB 1O1RB 3Q75B 2A73B 1O79A 4GTQB 1H3AA 2V3PA 4LNGB 3E34B 2F0YB 2H6GB 3KSQB 4YDOB 2XQWA 3DPYB 2V8JA 1O6QA 1H39A 1D8DB 1O6HA 1KZPB 4KKIA 4V1SA 1N4SB 2PN5A 5AGDA 1H36A 3D5RA 2V3NA 3EUVB 3SFXB 3HXDB 2GOXA 3E32B 3C72B 3Q78B 2BBCA 3K7XA 4FXKB 3KQ4A 4D4BA 1FT2B 4ZRPA 2WY7A 1S63B
chains in the Genus database with same CATH superfamily
1H37A 3GLYA 1GHQA 2AFAA 5DGQA 1H14A 2F6DA 3WIQA 1UG9A 5FO8B 4D4AA 2VN4A 4J5TA 5M7IA 4V1RA 4GTTB 4WVAA 3Q73B 2AHGA 3EU5B 1O6RA 1HZFA 1FT1B 2R2LB 3M02A 4AYRA 1WU4A 1H54A 3VSNA 4E1YA 1OJNA 1SA4B 3D5SA 3Q79B 3QWTA 2QNOA 3WC3A 1N7OA 5EASA 1GXOA 1H12A 2I07B 1N7PA 3M01A 5IKAA 5IM1A 1D8EB 1N1BA 2WINB 3A0OA 2WCOA 2WYNA 3E37B 3PZ1B 3EQAA 3G6JB 5IKHA 5IK9A 2H6FB 1N22A 3QG0A 3P2CA 1V5DA 4LNVA 3QPFA 1H35A 2ZISB 1XWTA 1JCRB 5IK6A 3QXQA 1SQCA 1AYXA 5JMDA 4TF4A 1QBQB 1EGUA 2BRVX 1TN8B 3ACTA 4L6XA 3QDEA 1G9GA 3DSUB 2JF4A 1DOGA 2FV0A 3SDVA 5ILYA 2ONGA 3D3IA 4F10A 1JCQB 3DSVB 2Z07A 1XWQA 3M00A 1CLCA 1OJPA 2YIKA 5GZKA 2FUQA 1DL2A 5ILJA 4GTPB 3Q75B 1RWCA 2V3PA 3PMMA 1N7RA 2H6GB 1N1ZA 1O6HA 1KZPB 4KKIA 5AGDA 3E32B 3C72B 3Q78B 1N20A 4Q2BA 4ZRPA 3NFVA 3G4FA 1HN0A 2RGKA 2WDAA 5EAUA 4L9PB 1J0NA 3QT3A 3X17A 1KSDA 4GAXA 1TNBB 3QFYA 1KRFA 3RX5A 1O5MB 4GL3A 3E30B 4GTMB 1IS9A 1FBOA 5JPMB 1GA2A 1HMUA 3Q7FB 5FOBB 3SAEA 1LD8B 3M74A 3M7CA 2BB6A 3WKIA 1N95B 1V7VA 3S4AA 5JMFA 2G02A 3N0GA 1FP3A 2E24A 3H7LA 3P5PA 3W7TA 1HX9A 1TNOB 3HXFB 4CE7A 1KFGA 2D8LA 3E33B 3VSMA 1V5CA 3HXEB 3Q7AB 1N4QB 3AFLA 1TNYB 1HM3A 3SFYB 2ZIRB 2DRSA 2EAEA 1RWHA 3W5NA 3DSWB 1LD7B 1N7QA 1FCEA 1H3CA 3DSTB 4ZH5A 1LF6A 1C3DA 4DOEA 4AYQA 4KTPA 4OZWA 4OJZA 5FO7B 4FXGB 1RW9A 1LXKA 2PMVA 3DSXB 4XUVA 5CD2A 4FNVA 2SQCA 1KS8A 1LXMA 2WY8A 2WIIB 3W7UA 1IA6A 2H6IB 1TNZB 5IL3A 1O1TB 2EACA 2OKXA 2XWBB 1NI1B 1KWFA 1QQFA 3RX8A 2ONHA 5ILHA 3S4BA 1N21A 3ANKA 4D4CA 5JPNB 1WU6A 2G0DA 4Z4JA 2GH4A 5IL8A 5FO9B 5DHIA 1GAIA 2BRPA 1V7XA 3CU7A 3OXUA 3ON6A 1O1RB 2FV1A 1XW2A 1N7NA 2F0YB 5MEHA 1G9JA 3PYAA 4QT9A 3RRSA 1NC5A 1N4SB 3QRYA 1WU5A 3D5RA 1H13A 2BBCA 2FUTA 1S63B 3KSLB 2V8IA 1X1IA 3OEDA 4LIXA 5CZLA 4MMHA 2B39A 3M71A 4RNQA 2CQTA 1X81B 3P5RA 1W3YA 3M7LA 4CJ1A 1KKTA 3DRAB 4GTVB 4GTOB 3SDUA 4NEIA 1F9GA 1RWFA 1GXMA 1RWAA 1OJMA 4MBGB 4MU9A 3W7WA 3EZ8A 3DSSB 3S9VA 2XFGA 4CJ0A 3PZ4B 3PYBA 3TF4A 4Q88A 1GAHA 1DCEB 3HXBB 1L1YA 5ILDA 3LZ9A 3RJ3A 4MMIA 1K72A 2ZZRA 1HXGA 3M7BA 4EL8A 2AHFA 4ONTA 2BB5A 1V7WA 3QFZA 3M72A 1HMWA 1KSCA 1OJOA 3SQCA 1QSJA 4ZH1A 1TNUB 5GW7A 4D4DA 3GT5A 1UT9A 3M73A 1TN6B 2ZBLA 3M7EA 4FUSA 2GZ6A 1C82A 1FAEA 1S64B 3M77A 3WIWA 2H6HB 3WKHA 5ILKA 3QXFA 1SA5B 1N4PB 3K11A 1TN7B 1G6IA 2VN7A 4F13A 2CQSA 2EABA 3E7JA 1JCSB 3W7XA 1O79A 4TXTA 5KKBA 3SDTA 3G4DA 1H3AA 4GTQB 5GY3A 5ILZA 2XQWA 1RQ5A 1FO2A 1QAZA 3N0FA 4YCRA 1H39A 4V1SA 2PN5A 4DI5A 3RENA 1H36A 3EUVB 2V3NA 3WUXA 3HXDB 2GOXA 3QSPA 1F9OA 4FXKB 3K7XA 2RI9A 3EU8A 4D4BA 3W5MA 5DHKA 2FBAA 4WVBA 1CB8A 1HM2A 1HXCA 1W6KA 2A8ZA 4AYPA 4OK4A 5C05A 4OK2A 1FBWA 2V8KA 3A3VA 2X03A 4WVCA 3E73A 1FO3A 1CEMA 2NOJA 3QT9A 1HV6A 4L0GA 1NL4B 1X1JA 2D5JA 4ZRQA 1LTXB 2BEDB 5ILIA 4EHMB 3ANJA 1UMPA 1VD5A 1X9DA 2IEJB 1GXNA 3E6UA 4JJJA 3VW5A 3WKGA 3GZKA 1N94B 4KTRA 4BOJA 4YDEB 2Q1FA 3H2WA 1N4RB 4KKJA 3SDQA 4ZG8A 4C1SA 3CIHA 1MZCB 4GTRB 3E80A 3ACSA 5IK0A 1FPPB 1GSZA 3M78A 3RSYA 1TF4A 3M75A 1I8QA 3WIRA 4DODA 3H3KA 3RX7A 1HCUA 2XWJB 3NNBA 5DGRA 1H3BA 3HXCB 3PZ2B 4AYOA 1KREA 1WZZA 4GTSB 4M76A 2RI8A 3PZ3B 3M76A 4BOKA 4Z4LA 1LOHA 2DRQA 1O1SB 4LNBB 2J5CA 3ANIA 1L2AA 1R76A 1KZOB 3KLSA 1AGMA 3S4DA 3VXDA 3SDRA 1F1SA 3AFJA 1N24A 3WKFA 1N9AB 2EADA 3W7SA 1W6JA 2JJBA 3T33A 2NVPA 5EATA 2BRWA 4D94A 2B4FA 1X1HA 1G87A 2DRRA 2A73B 2JG0A 1HXAA 3S4CA 1GLMA 4LNGB 3E34B 3KSQB 1RWGA 1NXCA 4YDOB 1FMIA 1IA7A 3DPYB 2V8JA 4FJQA 5CA3A 1O6QA 1D8DB 2DROA 4WU0A 1N23A 2E22A 2FUZA 3SFXB 5E2JA 5M7YA 1JS4A 1J0MA 3KQ4A 1FT2B 4OZVA 1ULVA 1F9DA 2P0VA 2WY7A 1LF9A
chains in the Genus database with same CATH topology
1H37A 3GLYA 1GHQA 2AFAA 5DGQA 1H14A 2F6DA 3WIQA 1UG9A 5FO8B 4D4AA 2VN4A 4J5TA 5M7IA 4V1RA 4GTTB 4WVAA 3Q73B 2AHGA 3EU5B 1O6RA 1HZFA 1FT1B 2R2LB 4AYRA 1WU4A 1H54A 1SA4B 3D5SA 3Q79B 3QWTA 2QNOA 3WC3A 1GXOA 1H12A 2I07B 1D8EB 2WINB 2WYNA 3E37B 3PZ1B 3EQAA 3G6JB 2H6FB 3QG0A 3P2CA 1V5DA 4LNVA 3QPFA 1H35A 2ZISB 1XWTA 1JCRB 3QXQA 1SQCA 1AYXA 4TF4A 1QBQB 1TN8B 3ACTA 4L6XA 3QDEA 1G9GA 3DSUB 2JF4A 1DOGA 2FV0A 3SDVA 3D3IA 1JCQB 3DSVB 2Z07A 1XWQA 1CLCA 2YIKA 5GZKA 1DL2A 4GTPB 3Q75B 2V3PA 3PMMA 2H6GB 1O6HA 1KZPB 4KKIA 5AGDA 3E32B 3C72B 3Q78B 4Q2BA 4ZRPA 2RGKA 4L9PB 3QT3A 3X17A 1KSDA 1TNBB 3QFYA 1KRFA 3RX5A 1O5MB 4GL3A 3E30B 4GTMB 1IS9A 1FBOA 5JPMB 1GA2A 3Q7FB 5FOBB 3SAEA 1LD8B 3M74A 3M7CA 2BB6A 3WKIA 1N95B 1V7VA 3S4AA 2G02A 1FP3A 3H7LA 3P5PA 3W7TA 1TNOB 3HXFB 4CE7A 1KFGA 2D8LA 3E33B 1V5CA 3HXEB 3Q7AB 1N4QB 1TNYB 3SFYB 2ZIRB 2DRSA 2EAEA 3W5NA 3DSWB 1LD7B 1FCEA 1H3CA 3DSTB 4ZH5A 1LF6A 1C3DA 4DOEA 4AYQA 4KTPA 5FO7B 4FXGB 2PMVA 3DSXB 4XUVA 5CD2A 2SQCA 1KS8A 2WY8A 2WIIB 3W7UA 1IA6A 2H6IB 1TNZB 1O1TB 2EACA 2OKXA 2XWBB 1NI1B 1KWFA 1QQFA 3RX8A 3S4BA 3ANKA 4D4CA 5JPNB 1WU6A 2G0DA 4Z4JA 2GH4A 5FO9B 1GAIA 1V7XA 3CU7A 3OXUA 3ON6A 1O1RB 2FV1A 1XW2A 2F0YB 5MEHA 1G9JA 3PYAA 4QT9A 3RRSA 1NC5A 1N4SB 3QRYA 1WU5A 3D5RA 1H13A 2BBCA 3KSLB 1S63B 2V8IA 3OEDA 4LIXA 5CZLA 2B39A 3M71A 2CQTA 1X81B 3P5RA 3M7LA 4CJ1A 1KKTA 3DRAB 4GTVB 4GTOB 3SDUA 1GXMA 4MBGB 4MU9A 3W7WA 3EZ8A 3DSSB 3S9VA 2XFGA 4CJ0A 3PZ4B 3PYBA 3TF4A 4Q88A 1GAHA 1DCEB 3HXBB 1L1YA 3RJ3A 1K72A 2ZZRA 3M7BA 4EL8A 2AHFA 4ONTA 2BB5A 1V7WA 3QFZA 3M72A 1KSCA 3SQCA 1QSJA 4ZH1A 1TNUB 5GW7A 4D4DA 3GT5A 1UT9A 3M73A 1TN6B 2ZBLA 3M7EA 4FUSA 2GZ6A 1FAEA 1S64B 3M77A 3WIWA 2H6HB 3WKHA 3QXFA 1SA5B 1N4PB 3K11A 1TN7B 1G6IA 2VN7A 2CQSA 2EABA 1JCSB 3W7XA 1O79A 4TXTA 5KKBA 3SDTA 4GTQB 1H3AA 5GY3A 2XQWA 1RQ5A 1FO2A 4YCRA 1H39A 4V1SA 2PN5A 3RENA 1H36A 3EUVB 2V3NA 3WUXA 3HXDB 2GOXA 3QSPA 1F9OA 4FXKB 3K7XA 2RI9A 3EU8A 4D4BA 3W5MA 2FBAA 4WVBA 1W6KA 2A8ZA 4AYPA 1FBWA 2V8KA 3A3VA 4WVCA 3E73A 1FO3A 1CEMA 2NOJA 3QT9A 4L0GA 1NL4B 2D5JA 4ZRQA 1LTXB 2BEDB 4EHMB 3ANJA 1UMPA 1VD5A 1X9DA 2IEJB 1GXNA 3E6UA 4JJJA 3VW5A 3WKGA 3GZKA 1N94B 4KTRA 4BOJA 4YDEB 3H2WA 1N4RB 4KKJA 3SDQA 4ZG8A 4C1SA 3CIHA 1MZCB 4GTRB 3ACSA 1FPPB 1GSZA 3M78A 3RSYA 1TF4A 3M75A 3WIRA 4DODA 3H3KA 3RX7A 1HCUA 2XWJB 5DGRA 1H3BA 3HXCB 3PZ2B 4AYOA 1KREA 1WZZA 4GTSB 4M76A 2RI8A 3PZ3B 3M76A 4BOKA 4Z4LA 2DRQA 1O1SB 4LNBB 3ANIA 1L2AA 1R76A 1KZOB 3KLSA 1AGMA 3S4DA 3VXDA 3SDRA 3AFJA 3WKFA 1N9AB 2EADA 3W7SA 1W6JA 2JJBA 3T33A 2NVPA 4D94A 2B4FA 1G87A 2DRRA 2A73B 2JG0A 3S4CA 1GLMA 4LNGB 3E34B 3KSQB 1NXCA 4YDOB 1FMIA 1IA7A 3DPYB 2V8JA 5CA3A 1O6QA 1D8DB 2DROA 4WU0A 2FUZA 3SFXB 5E2JA 5M7YA 1JS4A 3KQ4A 1FT2B 1ULVA 1F9DA 2P0VA 2WY7A 1LF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8I A;  3OED A;  1H37 A;  4L9P B;  1GHQ A;  1W6K A;  2B39 A;  1TNB B;  2V8K A;  5FO8 B;  1O5M B;  4D4A A;  3E30 B;  1X81 B;  4GTM B;  4V1R A;  4GTT B;  5JPM B;  3DRA B;  2NOJ A;  4GTV B;  3Q73 B;  4GTO B;  3Q7F B;  3EU5 B;  1GXM A;  5FOB B;  1O6R A;  1HZF A;  1NL4 B;  1FT1 B;  1LD8 B;  2R2L B;  4MBG B;  4MU9 A;  4ZRQ A;  1LTX B;  2BED B;  3DSS B;  2BB6 A;  1N95 B;  4EHM B;  1SA4 B;  3D5S A;  3Q79 B;  3PZ4 B;  1UMP A;  2IEJ B;  1GXN A;  2G02 A;  1GXO A;  2I07 B;  1TNO B;  1N94 B;  3HXF B;  1DCE B;  3HXB B;  4BOJ A;  3RJ3 A;  3E33 B;  4YDE B;  1D8E B;  1N4R B;  2WIN B;  4KKJ A;  3HXE B;  3Q7A B;  1N4Q B;  1TNY B;  3SFY B;  4C1S A;  1MZC B;  4GTR B;  2ZIR B;  3E37 B;  3PZ1 B;  3G6J B;  1FPP B;  1GSZ A;  2H6F B;  3DSW B;  1LD7 B;  4ONT A;  2BB5 A;  3KSL B;  1H3C A;  3DST B;  3SQC A;  4LNV A;  1C3D A;  2XWJ B;  1H35 A;  1QSJ A;  2ZIS B;  1H3B A;  3HXC B;  1JCR B;  5FO7 B;  4FXG B;  3PZ2 B;  4ZH1 A;  1TNU B;  2PMV A;  3DSX B;  1SQC A;  2SQC A;  4D4D A;  2WY8 A;  4GTS B;  4M76 A;  1QBQ B;  2WII B;  2H6I B;  3PZ3 B;  4BOK A;  1TN6 B;  1TNZ B;  1O1T B;  1O1S B;  1TN8 B;  2XWB B;  4LNB B;  1NI1 B;  1QQF A;  3DSU B;  1R76 A;  1KZO B;  3KLS A;  1S64 B;  2H6H B;  4D4C A;  5JPN B;  1SA5 B;  2G0D A;  1N4P B;  1TN7 B;  1N9A B;  1W6J A;  1JCQ B;  5FO9 B;  3DSV B;  4D94 A;  3CU7 A;  1JCS B;  3OXU A;  4GTP B;  1O1R B;  3Q75 B;  2A73 B;  1O79 A;  4GTQ B;  1H3A A;  2V3P A;  4LNG B;  3E34 B;  2F0Y B;  2H6G B;  3KSQ B;  4YDO B;  2XQW A;  3DPY B;  2V8J A;  1O6Q A;  1H39 A;  1D8D B;  1O6H A;  1KZP B;  4KKI A;  4V1S A;  1N4S B;  2PN5 A;  5AGD A;  1H36 A;  3D5R A;  2V3N A;  3EUV B;  3SFX B;  3HXD B;  2GOX A;  3E32 B;  3C72 B;  3Q78 B;  2BBC A;  3K7X A;  4FXK B;  3KQ4 A;  4D4B A;  1FT2 B;  4ZRP A;  2WY7 A;  1S63 B; 
#chains in the Genus database with same CATH topology
 1H37 A;  3GLY A;  1GHQ A;  2AFA A;  5DGQ A;  1H14 A;  2F6D A;  3WIQ A;  1UG9 A;  5FO8 B;  4D4A A;  2VN4 A;  4J5T A;  5M7I A;  4V1R A;  4GTT B;  4WVA A;  3Q73 B;  2AHG A;  3EU5 B;  1O6R A;  1HZF A;  1FT1 B;  2R2L B;  3M02 A;  4AYR A;  1WU4 A;  1H54 A;  3VSN A;  4E1Y A;  1OJN A;  1SA4 B;  3D5S A;  3Q79 B;  3QWT A;  2QNO A;  3WC3 A;  1N7O A;  5EAS A;  1GXO A;  1H12 A;  2I07 B;  1N7P A;  3M01 A;  5IKA A;  5IM1 A;  1D8E B;  1N1B A;  2WIN B;  3A0O A;  2WCO A;  2WYN A;  3E37 B;  3PZ1 B;  3EQA A;  3G6J B;  5IKH A;  5IK9 A;  2H6F B;  1N22 A;  3QG0 A;  3P2C A;  1V5D A;  4LNV A;  3QPF A;  1H35 A;  2ZIS B;  1XWT A;  1JCR B;  5IK6 A;  3QXQ A;  1SQC A;  1AYX A;  5JMD A;  4TF4 A;  1QBQ B;  1EGU A;  2BRV X;  1TN8 B;  3ACT A;  4L6X A;  3QDE A;  1G9G A;  3DSU B;  2JF4 A;  1DOG A;  2FV0 A;  3SDV A;  5ILY A;  2ONG A;  3D3I A;  4F10 A;  1JCQ B;  3DSV B;  2Z07 A;  1XWQ A;  3M00 A;  1CLC A;  1OJP A;  2YIK A;  5GZK A;  2FUQ A;  1DL2 A;  5ILJ A;  4GTP B;  3Q75 B;  1RWC A;  2V3P A;  3PMM A;  1N7R A;  2H6G B;  1N1Z A;  1O6H A;  1KZP B;  4KKI A;  5AGD A;  3E32 B;  3C72 B;  3Q78 B;  1N20 A;  4Q2B A;  4ZRP A;  3NFV A;  3G4F A;  1HN0 A;  2RGK A;  2WDA A;  5EAU A;  4L9P B;  1J0N A;  3QT3 A;  3X17 A;  1KSD A;  4GAX A;  1TNB B;  3QFY A;  1KRF A;  3RX5 A;  1O5M B;  4GL3 A;  3E30 B;  4GTM B;  1IS9 A;  1FBO A;  5JPM B;  1GA2 A;  1HMU A;  3Q7F B;  5FOB B;  3SAE A;  1LD8 B;  3M74 A;  3M7C A;  2BB6 A;  3WKI A;  1N95 B;  1V7V A;  3S4A A;  5JMF A;  2G02 A;  3N0G A;  1FP3 A;  2E24 A;  3H7L A;  3P5P A;  3W7T A;  1HX9 A;  1TNO B;  3HXF B;  4CE7 A;  1KFG A;  2D8L A;  3E33 B;  3VSM A;  1V5C A;  3HXE B;  3Q7A B;  1N4Q B;  3AFL A;  1TNY B;  1HM3 A;  3SFY B;  2ZIR B;  2DRS A;  2EAE A;  1RWH A;  3W5N A;  3DSW B;  1LD7 B;  1N7Q A;  1FCE A;  1H3C A;  3DST B;  4ZH5 A;  1LF6 A;  1C3D A;  4DOE A;  4AYQ A;  4KTP A;  4OZW A;  4OJZ A;  5FO7 B;  4FXG B;  1RW9 A;  1LXK A;  2PMV A;  3DSX B;  4XUV A;  5CD2 A;  4FNV A;  2SQC A;  1KS8 A;  1LXM A;  2WY8 A;  2WII B;  3W7U A;  1IA6 A;  2H6I B;  1TNZ B;  5IL3 A;  1O1T B;  2EAC A;  2OKX A;  2XWB B;  1NI1 B;  1KWF A;  1QQF A;  3RX8 A;  2ONH A;  5ILH A;  3S4B A;  1N21 A;  3ANK A;  4D4C A;  5JPN B;  1WU6 A;  2G0D A;  4Z4J A;  2GH4 A;  5IL8 A;  5FO9 B;  5DHI A;  1GAI A;  2BRP A;  1V7X A;  3CU7 A;  3OXU A;  3ON6 A;  1O1R B;  2FV1 A;  1XW2 A;  1N7N A;  2F0Y B;  5MEH A;  1G9J A;  3PYA A;  4QT9 A;  3RRS A;  1NC5 A;  1N4S B;  3QRY A;  1WU5 A;  3D5R A;  1H13 A;  2BBC A;  2FUT A;  1S63 B;  3KSL B;  2V8I A;  1X1I A;  3OED A;  4LIX A;  5CZL A;  4MMH A;  2B39 A;  3M71 A;  4RNQ A;  2CQT A;  1X81 B;  3P5R A;  1W3Y A;  3M7L A;  4CJ1 A;  1KKT A;  3DRA B;  4GTV B;  4GTO B;  3SDU A;  4NEI A;  1F9G A;  1RWF A;  1GXM A;  1RWA A;  1OJM A;  4MBG B;  4MU9 A;  3W7W A;  3EZ8 A;  3DSS B;  3S9V A;  2XFG A;  4CJ0 A;  3PZ4 B;  3PYB A;  3TF4 A;  4Q88 A;  1GAH A;  1DCE B;  3HXB B;  1L1Y A;  5ILD A;  3LZ9 A;  3RJ3 A;  4MMI A;  1K72 A;  2ZZR A;  1HXG A;  3M7B A;  4EL8 A;  2AHF A;  4ONT A;  2BB5 A;  1V7W A;  3QFZ A;  3M72 A;  1HMW A;  1KSC A;  1OJO A;  3SQC A;  1QSJ A;  4ZH1 A;  1TNU B;  5GW7 A;  4D4D A;  3GT5 A;  1UT9 A;  3M73 A;  1TN6 B;  2ZBL A;  3M7E A;  4FUS A;  2GZ6 A;  1C82 A;  1FAE A;  1S64 B;  3M77 A;  3WIW A;  2H6H B;  3WKH A;  5ILK A;  3QXF A;  1SA5 B;  1N4P B;  3K11 A;  1TN7 B;  1G6I A;  2VN7 A;  4F13 A;  2CQS A;  2EAB A;  3E7J A;  1JCS B;  3W7X A;  1O79 A;  4TXT A;  5KKB A;  3SDT A;  3G4D A;  1H3A A;  4GTQ B;  5GY3 A;  5ILZ A;  2XQW A;  1RQ5 A;  1FO2 A;  1QAZ A;  3N0F A;  4YCR A;  1H39 A;  4V1S A;  2PN5 A;  4DI5 A;  3REN A;  1H36 A;  3EUV B;  2V3N A;  3WUX A;  3HXD B;  2GOX A;  3QSP A;  1F9O A;  4FXK B;  3K7X A;  2RI9 A;  3EU8 A;  4D4B A;  3W5M A;  5DHK A;  2FBA A;  4WVB A;  1CB8 A;  1HM2 A;  1HXC A;  1W6K A;  2A8Z A;  4AYP A;  4OK4 A;  5C05 A;  4OK2 A;  1FBW A;  2V8K A;  3A3V A;  2X03 A;  4WVC A;  3E73 A;  1FO3 A;  1CEM A;  2NOJ A;  3QT9 A;  1HV6 A;  4L0G A;  1NL4 B;  1X1J A;  2D5J A;  4ZRQ A;  1LTX B;  2BED B;  5ILI A;  4EHM B;  3ANJ A;  1UMP A;  1VD5 A;  1X9D A;  2IEJ B;  1GXN A;  3E6U A;  4JJJ A;  3VW5 A;  3WKG A;  3GZK A;  1N94 B;  4KTR A;  4BOJ A;  4YDE B;  2Q1F A;  3H2W A;  1N4R B;  4KKJ A;  3SDQ A;  4ZG8 A;  4C1S A;  3CIH A;  1MZC B;  4GTR B;  3E80 A;  3ACS A;  5IK0 A;  1FPP B;  1GSZ A;  3M78 A;  3RSY A;  1TF4 A;  3M75 A;  1I8Q A;  3WIR A;  4DOD A;  3H3K A;  3RX7 A;  1HCU A;  2XWJ B;  3NNB A;  5DGR A;  1H3B A;  3HXC B;  3PZ2 B;  4AYO A;  1KRE A;  1WZZ A;  4GTS B;  4M76 A;  2RI8 A;  3PZ3 B;  3M76 A;  4BOK A;  4Z4L A;  1LOH A;  2DRQ A;  1O1S B;  4LNB B;  2J5C A;  3ANI A;  1L2A A;  1R76 A;  1KZO B;  3KLS A;  1AGM A;  3S4D A;  3VXD A;  3SDR A;  1F1S A;  3AFJ A;  1N24 A;  3WKF A;  1N9A B;  2EAD A;  3W7S A;  1W6J A;  2JJB A;  3T33 A;  2NVP A;  5EAT A;  2BRW A;  4D94 A;  2B4F A;  1X1H A;  1G87 A;  2DRR A;  2A73 B;  2JG0 A;  1HXA A;  3S4C A;  1GLM A;  4LNG B;  3E34 B;  3KSQ B;  1RWG A;  1NXC A;  4YDO B;  1FMI A;  1IA7 A;  3DPY B;  2V8J A;  4FJQ A;  5CA3 A;  1O6Q A;  1D8D B;  2DRO A;  4WU0 A;  1N23 A;  2E22 A;  2FUZ A;  3SFX B;  5E2J A;  5M7Y A;  1JS4 A;  1J0M A;  3KQ4 A;  1FT2 B;  4OZV A;  1ULV A;  1F9D A;  2P0V A;  2WY7 A;  1LF9 A; 
#chains in the Genus database with same CATH homology
 1H37 A;  3GLY A;  1GHQ A;  2AFA A;  5DGQ A;  1H14 A;  2F6D A;  3WIQ A;  1UG9 A;  5FO8 B;  4D4A A;  2VN4 A;  4J5T A;  5M7I A;  4V1R A;  4GTT B;  4WVA A;  3Q73 B;  2AHG A;  3EU5 B;  1O6R A;  1HZF A;  1FT1 B;  2R2L B;  4AYR A;  1WU4 A;  1H54 A;  1SA4 B;  3D5S A;  3Q79 B;  3QWT A;  2QNO A;  3WC3 A;  1GXO A;  1H12 A;  2I07 B;  1D8E B;  2WIN B;  2WYN A;  3E37 B;  3PZ1 B;  3EQA A;  3G6J B;  2H6F B;  3QG0 A;  3P2C A;  1V5D A;  4LNV A;  3QPF A;  1H35 A;  2ZIS B;  1XWT A;  1JCR B;  3QXQ A;  1SQC A;  1AYX A;  4TF4 A;  1QBQ B;  1TN8 B;  3ACT A;  4L6X A;  3QDE A;  1G9G A;  3DSU B;  2JF4 A;  1DOG A;  2FV0 A;  3SDV A;  3D3I A;  1JCQ B;  3DSV B;  2Z07 A;  1XWQ A;  1CLC A;  2YIK A;  5GZK A;  1DL2 A;  4GTP B;  3Q75 B;  2V3P A;  3PMM A;  2H6G B;  1O6H A;  1KZP B;  4KKI A;  5AGD A;  3E32 B;  3C72 B;  3Q78 B;  4Q2B A;  4ZRP A;  2RGK A;  4L9P B;  3QT3 A;  3X17 A;  1KSD A;  1TNB B;  3QFY A;  1KRF A;  3RX5 A;  1O5M B;  4GL3 A;  3E30 B;  4GTM B;  1IS9 A;  1FBO A;  5JPM B;  1GA2 A;  3Q7F B;  5FOB B;  3SAE A;  1LD8 B;  3M74 A;  3M7C A;  2BB6 A;  3WKI A;  1N95 B;  1V7V A;  3S4A A;  2G02 A;  1FP3 A;  3H7L A;  3P5P A;  3W7T A;  1TNO B;  3HXF B;  4CE7 A;  1KFG A;  2D8L A;  3E33 B;  1V5C A;  3HXE B;  3Q7A B;  1N4Q B;  1TNY B;  3SFY B;  2ZIR B;  2DRS A;  2EAE A;  3W5N A;  3DSW B;  1LD7 B;  1FCE A;  1H3C A;  3DST B;  4ZH5 A;  1LF6 A;  1C3D A;  4DOE A;  4AYQ A;  4KTP A;  5FO7 B;  4FXG B;  2PMV A;  3DSX B;  4XUV A;  5CD2 A;  2SQC A;  1KS8 A;  2WY8 A;  2WII B;  3W7U A;  1IA6 A;  2H6I B;  1TNZ B;  1O1T B;  2EAC A;  2OKX A;  2XWB B;  1NI1 B;  1KWF A;  1QQF A;  3RX8 A;  3S4B A;  3ANK A;  4D4C A;  5JPN B;  1WU6 A;  2G0D A;  4Z4J A;  2GH4 A;  5FO9 B;  1GAI A;  1V7X A;  3CU7 A;  3OXU A;  3ON6 A;  1O1R B;  2FV1 A;  1XW2 A;  2F0Y B;  5MEH A;  1G9J A;  3PYA A;  4QT9 A;  3RRS A;  1NC5 A;  1N4S B;  3QRY A;  1WU5 A;  3D5R A;  1H13 A;  2BBC A;  3KSL B;  1S63 B;  2V8I A;  3OED A;  4LIX A;  5CZL A;  2B39 A;  3M71 A;  2CQT A;  1X81 B;  3P5R A;  3M7L A;  4CJ1 A;  1KKT A;  3DRA B;  4GTV B;  4GTO B;  3SDU A;  1GXM A;  4MBG B;  4MU9 A;  3W7W A;  3EZ8 A;  3DSS B;  3S9V A;  2XFG A;  4CJ0 A;  3PZ4 B;  3PYB A;  3TF4 A;  4Q88 A;  1GAH A;  1DCE B;  3HXB B;  1L1Y A;  3RJ3 A;  1K72 A;  2ZZR A;  3M7B A;  4EL8 A;  2AHF A;  4ONT A;  2BB5 A;  1V7W A;  3QFZ A;  3M72 A;  1KSC A;  3SQC A;  1QSJ A;  4ZH1 A;  1TNU B;  5GW7 A;  4D4D A;  3GT5 A;  1UT9 A;  3M73 A;  1TN6 B;  2ZBL A;  3M7E A;  4FUS A;  2GZ6 A;  1FAE A;  1S64 B;  3M77 A;  3WIW A;  2H6H B;  3WKH A;  3QXF A;  1SA5 B;  1N4P B;  3K11 A;  1TN7 B;  1G6I A;  2VN7 A;  2CQS A;  2EAB A;  1JCS B;  3W7X A;  1O79 A;  4TXT A;  5KKB A;  3SDT A;  4GTQ B;  1H3A A;  5GY3 A;  2XQW A;  1RQ5 A;  1FO2 A;  4YCR A;  1H39 A;  4V1S A;  2PN5 A;  3REN A;  1H36 A;  3EUV B;  2V3N A;  3WUX A;  3HXD B;  2GOX A;  3QSP A;  1F9O A;  4FXK B;  3K7X A;  2RI9 A;  3EU8 A;  4D4B A;  3W5M A;  2FBA A;  4WVB A;  1W6K A;  2A8Z A;  4AYP A;  1FBW A;  2V8K A;  3A3V A;  4WVC A;  3E73 A;  1FO3 A;  1CEM A;  2NOJ A;  3QT9 A;  4L0G A;  1NL4 B;  2D5J A;  4ZRQ A;  1LTX B;  2BED B;  4EHM B;  3ANJ A;  1UMP A;  1VD5 A;  1X9D A;  2IEJ B;  1GXN A;  3E6U A;  4JJJ A;  3VW5 A;  3WKG A;  3GZK A;  1N94 B;  4KTR A;  4BOJ A;  4YDE B;  3H2W A;  1N4R B;  4KKJ A;  3SDQ A;  4ZG8 A;  4C1S A;  3CIH A;  1MZC B;  4GTR B;  3ACS A;  1FPP B;  1GSZ A;  3M78 A;  3RSY A;  1TF4 A;  3M75 A;  3WIR A;  4DOD A;  3H3K A;  3RX7 A;  1HCU A;  2XWJ B;  5DGR A;  1H3B A;  3HXC B;  3PZ2 B;  4AYO A;  1KRE A;  1WZZ A;  4GTS B;  4M76 A;  2RI8 A;  3PZ3 B;  3M76 A;  4BOK A;  4Z4L A;  2DRQ A;  1O1S B;  4LNB B;  3ANI A;  1L2A A;  1R76 A;  1KZO B;  3KLS A;  1AGM A;  3S4D A;  3VXD A;  3SDR A;  3AFJ A;  3WKF A;  1N9A B;  2EAD A;  3W7S A;  1W6J A;  2JJB A;  3T33 A;  2NVP A;  4D94 A;  2B4F A;  1G87 A;  2DRR A;  2A73 B;  2JG0 A;  3S4C A;  1GLM A;  4LNG B;  3E34 B;  3KSQ B;  1NXC A;  4YDO B;  1FMI A;  1IA7 A;  3DPY B;  2V8J A;  5CA3 A;  1O6Q A;  1D8D B;  2DRO A;  4WU0 A;  2FUZ A;  3SFX B;  5E2J A;  5M7Y A;  1JS4 A;  3KQ4 A;  1FT2 B;  1ULV A;  1F9D A;  2P0V A;  2WY7 A;  1LF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...