1WU4A

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
376
structure length
374
Chain Sequence
EGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSDSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylanase Y
publication title Structural Basis for the Specificity of the Reducing End Xylose-releasing Exo-oligoxylanase from Bacillus halodurans C-125
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 152
structure length 374
sequence length 376
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1wu4A01
3S4AA 3A3VA 1F9OA 3H3KA 1V7VA 5KKBA 5MEHA 2F6DA 2ZBLA 1GAIA 1GA2A 3RX5A 3QPFA 1FO3A 3WUXA 1FP3A 2AHFA 2JJBA 1DOGA 4Q2BA 4AYRA 4DODA 4Z4LA 1JS4A 1KKTA 2EADA 1V5DA 5M7IA 4WVAA 4Q88A 3WKFA 3WIRA 1KRFA 1FAEA 2YIKA 1IA7A 4ZH5A 5M7YA 5CA3A 1L2AA 2RI9A 1WZZA 3QG0A 4L6XA 3PMMA 3GLYA 3T33A 1KS8A 2WYNA 2FUZA 1FMIA 5CZLA 4CE7A 1UT9A 1WU4A 1IA6A 3W7UA 1AGMA 5DGQA 5GY3A 4AYOA 3QWTA 2GZ6A 4AYQA 2DRRA 1K72A 1KFGA 3RSYA 1H12A 3RX7A 1V7XA 3VXDA 4ZG8A 2GH4A 2DRSA 1XW2A 2CQTA 3S4BA 4EL8A 1F9DA 2Z07A 3D3IA 3QDEA 5DGRA 1L1YA 2FBAA 3E73A 3RRSA 1H54A 1UG9A 1V5CA 2RI8A 3QXQA 3WIQA 2AHGA 2VN7A 1AYXA 4KTPA 3W5MA 3W7XA 1LF9A 3P2CA 3ANIA 1DL2A 2DRQA 4WVBA 4L0GA 3GT5A 3EZ8A 3QFYA 3ANJA 2D8LA 3S4CA 2AFAA 1G9GA 4AYPA 3H7LA 3H2WA 4XUVA 4WVCA 1CEMA 3WC3A 5E2JA 1HCUA 4FUSA 4WU0A 3WKHA 2FV0A 1GLMA 3CIHA 2FV1A 3ANKA 2EABA 3QFZA 5GW7A 1WU5A 1FCEA 2XFGA 1LF6A 3ON6A 1V7WA 3QT3A 3QXFA 3EQAA 3WIWA 1H14A 2DROA 4JJJA 4TF4A 1VD5A 1GAHA 1NXCA 2OKXA 4TXTA 3VW5A 2RGKA 3WKIA 1FO2A 1FBOA 1WU6A 3RENA 4KTRA 3RX8A 3WKGA 2A8ZA 3ACTA 2D5JA 1KREA 2ZZRA 3E6UA 3TF4A 4J5TA 4DOEA 1IS9A 4Z4JA 1FBWA 2EACA 1H13A 1NC5A 2VN4A 1KSDA 3K11A 2CQSA 3S4DA 3AFJA 3W5NA 2QNOA 3W7WA 3ACSA 1XWTA 3X17A 5CD2A 1ULVA 3QSPA 1XWQA 3QT9A 2JF4A 1KWFA 1G87A 2EAEA 4CJ0A 4CJ1A 2NVPA 2P0VA 1X9DA 1RQ5A 1G6IA 1G9JA 1CLCA 1TF4A 3GZKA 3W7TA 2B4FA 1KSCA 2JG0A 3QRYA 3W7SA
chains in the Genus database with same CATH superfamily
3A3VA 1V7VA 2NOJA 1GA2A 3RX5A 1FP3A 3SDVA 4Z4LA 2V3NA 2ONGA 2EADA 1V5DA 3M73A 1N22A 1C82A 4Q88A 4FXGB 2V3PA 4ZH5A 2YIKA 1GXMA 1L2AA 4GTRB 1OJNA 3E7JA 3M7BA 1O1TB 1UT9A 2H6FB 3PYAA 3G4FA 1HMWA 3N0GA 4ZG8A 2A73B 3M76A 5FO7B 1XW2A 3HXDB 3HXFB 1N7QA 3D3IA 2V8IA 2V8KA 3LZ9A 1SA4B 5ILZA 1AYXA 4KTPA 3DSVB 2DRQA 4LNBB 1LD8B 2BRPA 3M02A 1N21A 4MU9A 3GT5A 3M78A 3E80A 1FT2B 2D8LA 2AFAA 1KZOB 3CU7A 3H2WA 2ZIRB 1KZPB 4FUSA 1RWGA 3HXCB 5GW7A 1FCEA 3N0FA 3Q73B 3EQAA 3WIWA 2OKXA 1TNOB 3E32B 1QAZA 3M01A 4GTPB 4KTRA 3Q7FB 1N7RA 3M7LA 3ACTA 1FT1B 5IK9A 3E37B 2EACA 5ILDA 3KSQB 2VN4A 3Q78B 3HXEB 4E1YA 3S4DA 1GSZA 2BB6A 5FO9B 4GTTB 4D4AA 1TNUB 3QSPA 1N7NA 3QT9A 1KWFA 1SQCA 2PN5A 2B4FA 1KSCA 1QBQB 1N7OA 2H6IB 1F9OA 2B39A 2PMVA 1FO3A 4DODA 1LD7B 1W3YA 4AYRA 1DCEB 2E22A 4EHMB 1X1JA 3DSWB 3SFXB 4WVAA 2XWBB 1MZCB 4QT9A 3SDRA 1WZZA 3PZ2B 3SFYB 3GLYA 4MMIA 4GTSB 2WYNA 4LNGB 1FMIA 2BRVX 2XQWA 4V1SA 2WDAA 5GY3A 1D8DB 4OZWA 2G0DA 2GZ6A 3OXUA 4GL3A 4KKIA 4GTVB 4FJQA 2F0YB 3RX7A 4YDOB 1O79A 3C72B 2DRSA 2CQTA 3S4BA 1H37A 1TNBB 1L1YA 3E73A 1NI1B 4D4DA 1UG9A 2RI8A 3M71A 2R2LB 5IM1A 2VN7A 3W5MA 5ILYA 1DL2A 1H3BA 1HMUA 4LIXA 3DRAB 4L0GA 3PZ4B 3SDQA 4RNQA 5IKHA 1N4PB 3S4CA 1OJOA 4AYPA 5IL8A 3H7LA 1TNZB 1O6HA 3WC3A 1GLMA 3CIHA 2FV1A 1N23A 3ANKA 1S63B 3QXFA 1V7WA 3QT3A 1H39A 1GAHA 4OK4A 1GXNA 1FO2A 1O1SB 1O5MB 1J0MA 1S64B 4OK2A 3SAEA 2A8ZA 2J5CA 2Q1FA 4NEIA 4J5TA 5IK6A 1N4SB 3G6JB 1H13A 5JMFA 1N95B 3VSNA 3DSSB 4D94A 3W7WA 1QQFA 1G87A 1JCRB 4CJ1A 4MBGB 1X9DA 1RQ5A 2XWJB 3DSXB 1G9JA 1GHQA 5C05A 4GTMB 3KSLB 3QRYA 4AYQA 4V1RA 3S4AA 4L9PB 5KKBA 1CB8A 4YDEB 3P5PA 1GAIA 2SQCA 2JJBA 4Q2BA 1TN6B 1O1RB 1JS4A 1LXMA 3SDTA 3WKFA 3WIRA 4KKJA 1FAEA 3A0OA 5M7YA 2RI9A 3QG0A 2E24A 3T33A 1KS8A 1SA5B 2GOXA 1HX9A 2FUZA 3PZ1B 5IKAA 1D8EB 3M72A 3DSUB 1EGUA 3QWTA 2DRRA 1KFGA 3DPYB 3M75A 5IK0A 3RSYA 1H12A 2WIIB 1V7XA 1N20A 2GH4A 2H6HB 4BOKA 1W6KA 2Z07A 3D5SA 5FOBB 5DGRA 5CA3A 2FBAA 4ZRQA 5EAUA 1FPPB 3W7XA 1LF9A 1QSJA 3P2CA 3ANIA 3M77A 5JMDA 5JPMB 2ZISB 3E30B 3E34B 1W6JA 3SDUA 1HZFA 3QFYA 1N24A 4GTQB 1O6RA 3DSTB 3Q79B 1LTXB 4WVCA 4BOJA 5IL3A 3WKHA 2FV0A 3OEDA 1RWFA 3D5RA 2XFGA 4F10A 4C1SA 3NNBA 3ON6A 3M00A 1N1ZA 4D4BA 1H14A 2DROA 4TF4A 1VD5A 1X1IA 3Q75B 1O6QA 2RGKA 5FO8B 3SQCA 1WU6A 4DI5A 3RENA 5ILJA 1TN7B 3RX8A 3WKGA 3K7XA 2D5JA 1KREA 3TF4A 4FXKB 1IS9A 4Z4JA 1H35A 1FBWA 1NC5A 3KLSA 3K11A 2CQSA 3AFJA 3W5NA 1J0NA 1LXKA 1RWHA 1N9AB 3EUVB 5CD2A 1ULVA 1XWQA 2JF4A 3PZ3B 4OZVA 2EAEA 1N4RB 2NVPA 1G6IA 1CLCA 1RWAA 1TF4A 3W7TA 1JCSB 2JG0A 3P5RA 3W7SA 1HXAA 2WINB 2V8JA 3H3KA 1H3AA 5MEHA 1OJMA 2F6DA 5DHKA 2ZBLA 3QPFA 3WUXA 2AHFA 1DOGA 1UMPA 3M74A 1KKTA 5M7IA 3KQ4A 1KRFA 1IA7A 3Q7AB 1HM2A 2X03A 4L6XA 3PMMA 1H36A 5CZLA 4CE7A 1I8QA 2BRWA 1H3CA 1IA6A 1WU4A 3W7UA 1AGMA 5DGQA 4YCRA 4AYOA 1HXGA 3NFVA 1K72A 3PYBA 5EASA 4D4CA 4GTOB 4ZH1A 3VXDA 5ILKA 3RJ3A 4EL8A 1F9DA 2WY8A 1N7PA 3QDEA 3RRSA 1H54A 4GAXA 1V5CA 3QXQA 3WIQA 5ILIA 2AHGA 1HM3A 1LOHA 5AGDA 5GZKA 4MMHA 1F9GA 3EU8A 2BB5A 3EU5B 4WVBA 5ILHA 1N4QB 1HXCA 3EZ8A 3ANJA 1F1SA 3M7CA 2BBCA 1G9GA 5EATA 3M7EA 1OJPA 3VSMA 4XUVA 1CEMA 5E2JA 1HCUA 4WU0A 2EABA 3QFZA 1RW9A 1WU5A 4F13A 1RWCA 3E33B 3G4DA 1LF6A 1N1BA 4LNVA 1X81B 1NL4B 2H6GB 2I07B 4JJJA 1NXCA 4TXTA 1HN0A 3VW5A 1HV6A 3S9VA 3WKIA 1X1HA 1TN8B 2BEDB 4FNVA 1FBOA 4M76A 4OJZA 5DHIA 2WY7A 2IEJB 1N94B 2ZZRA 4ONTA 3E6UA 2FUQA 4DOEA 1R76A 5JPNB 1C3DA 1KSDA 2G02A 2QNOA 3ACSA 1XWTA 3X17A 1TNYB 4CJ0A 3HXBB 1JCQB 2ONHA 2P0VA 1GXOA 2WCOA 3AFLA 2FUTA 3GZKA 4ZRPA
chains in the Genus database with same CATH topology
3A3VA 1V7VA 2NOJA 1GA2A 3RX5A 1FP3A 3SDVA 4Z4LA 2V3NA 2EADA 1V5DA 3M73A 4Q88A 4FXGB 2V3PA 4ZH5A 2YIKA 1GXMA 1L2AA 4GTRB 3M7BA 1O1TB 1UT9A 2H6FB 3PYAA 4ZG8A 2A73B 3M76A 5FO7B 1XW2A 3HXDB 3HXFB 3D3IA 2V8IA 2V8KA 1SA4B 1AYXA 4KTPA 3DSVB 2DRQA 4LNBB 1LD8B 4MU9A 3GT5A 3M78A 1FT2B 2D8LA 2AFAA 1KZOB 3CU7A 3H2WA 2ZIRB 1KZPB 4FUSA 3HXCB 5GW7A 1FCEA 3Q73B 3EQAA 3WIWA 2OKXA 1TNOB 3E32B 4GTPB 4KTRA 3Q7FB 3M7LA 3ACTA 1FT1B 3E37B 2EACA 3KSQB 2VN4A 3Q78B 3HXEB 3S4DA 1GSZA 2BB6A 5FO9B 4GTTB 4D4AA 1TNUB 3QSPA 3QT9A 1KWFA 1SQCA 2PN5A 2B4FA 1KSCA 1QBQB 2H6IB 1F9OA 2B39A 2PMVA 1FO3A 4DODA 1LD7B 4AYRA 1DCEB 4EHMB 3DSWB 3SFXB 4WVAA 2XWBB 1MZCB 4QT9A 3SDRA 1WZZA 3PZ2B 3SFYB 3GLYA 4GTSB 2WYNA 4LNGB 1FMIA 2XQWA 4V1SA 5GY3A 1D8DB 2G0DA 2GZ6A 3OXUA 4GL3A 4KKIA 4GTVB 2F0YB 3RX7A 4YDOB 1O79A 3C72B 2DRSA 2CQTA 3S4BA 1H37A 1TNBB 1L1YA 3E73A 1NI1B 4D4DA 1UG9A 2RI8A 3M71A 2R2LB 2VN7A 3W5MA 1DL2A 1H3BA 4LIXA 3DRAB 4L0GA 3PZ4B 3SDQA 3S4CA 1N4PB 4AYPA 3H7LA 1TNZB 1O6HA 3WC3A 1GLMA 3CIHA 2FV1A 3ANKA 1S63B 3QXFA 1V7WA 3QT3A 1H39A 1GAHA 1GXNA 1FO2A 1O1SB 1O5MB 1S64B 3SAEA 2A8ZA 4J5TA 1N4SB 3G6JB 1H13A 1N95B 3DSSB 4D94A 3W7WA 1QQFA 1G87A 1JCRB 4CJ1A 4MBGB 1X9DA 1RQ5A 2XWJB 3DSXB 1G9JA 1GHQA 4GTMB 3KSLB 3QRYA 4AYQA 4V1RA 3S4AA 4L9PB 5KKBA 4YDEB 3P5PA 1GAIA 2SQCA 2JJBA 4Q2BA 1TN6B 1O1RB 1JS4A 3SDTA 3WKFA 3WIRA 4KKJA 1FAEA 5M7YA 2RI9A 3QG0A 3T33A 1KS8A 1SA5B 2GOXA 3PZ1B 2FUZA 1D8EB 3M72A 3DSUB 3QWTA 2DRRA 1KFGA 3DPYB 3M75A 3RSYA 1H12A 2WIIB 1V7XA 2GH4A 2H6HB 4BOKA 1W6KA 2Z07A 3D5SA 5FOBB 5DGRA 5CA3A 2FBAA 4ZRQA 1FPPB 3W7XA 1LF9A 1QSJA 3P2CA 3ANIA 3M77A 5JPMB 2ZISB 3E30B 3E34B 1W6JA 3SDUA 1HZFA 3QFYA 4GTQB 1O6RA 3DSTB 3Q79B 1LTXB 4WVCA 4BOJA 3WKHA 2FV0A 3OEDA 3D5RA 2XFGA 4C1SA 3ON6A 4D4BA 1H14A 2DROA 4TF4A 1VD5A 3Q75B 1O6QA 2RGKA 5FO8B 3SQCA 1WU6A 3RENA 1TN7B 3RX8A 3WKGA 3K7XA 2D5JA 1KREA 3TF4A 4FXKB 1IS9A 4Z4JA 1H35A 1FBWA 1NC5A 3KLSA 3K11A 2CQSA 3AFJA 3W5NA 1N9AB 3EUVB 5CD2A 1ULVA 1XWQA 2JF4A 3PZ3B 2EAEA 1N4RB 2NVPA 1G6IA 1CLCA 1TF4A 3W7TA 1JCSB 2JG0A 3P5RA 3W7SA 2WINB 2V8JA 3H3KA 1H3AA 5MEHA 2F6DA 2ZBLA 3QPFA 3WUXA 2AHFA 1DOGA 1UMPA 3M74A 1KKTA 5M7IA 3KQ4A 1KRFA 1IA7A 3Q7AB 4L6XA 3PMMA 1H36A 5CZLA 4CE7A 1H3CA 1IA6A 1WU4A 3W7UA 1AGMA 5DGQA 4YCRA 4AYOA 1K72A 3PYBA 4D4CA 4GTOB 4ZH1A 3VXDA 3RJ3A 4EL8A 1F9DA 2WY8A 3QDEA 3RRSA 1H54A 1V5CA 3QXQA 3WIQA 2AHGA 5AGDA 5GZKA 3EU8A 2BB5A 3EU5B 4WVBA 1N4QB 3EZ8A 3ANJA 3M7CA 2BBCA 1G9GA 3M7EA 4XUVA 1CEMA 5E2JA 1HCUA 4WU0A 2EABA 3QFZA 1WU5A 3E33B 1LF6A 4LNVA 1X81B 1NL4B 2H6GB 2I07B 4JJJA 1NXCA 4TXTA 3VW5A 3S9VA 3WKIA 1TN8B 2BEDB 1FBOA 4M76A 2WY7A 2IEJB 1N94B 2ZZRA 4ONTA 3E6UA 4DOEA 1R76A 5JPNB 1C3DA 1KSDA 2G02A 2QNOA 3ACSA 1XWTA 3X17A 1TNYB 4CJ0A 3HXBB 1JCQB 2P0VA 1GXOA 3GZKA 4ZRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S4A A;  3A3V A;  1F9O A;  3H3K A;  1V7V A;  5KKB A;  5MEH A;  2F6D A;  2ZBL A;  1GAI A;  1GA2 A;  3RX5 A;  3QPF A;  1FO3 A;  3WUX A;  1FP3 A;  2AHF A;  2JJB A;  1DOG A;  4Q2B A;  4AYR A;  4DOD A;  4Z4L A;  1JS4 A;  1KKT A;  2EAD A;  1V5D A;  5M7I A;  4WVA A;  4Q88 A;  3WKF A;  3WIR A;  1KRF A;  1FAE A;  2YIK A;  1IA7 A;  4ZH5 A;  5M7Y A;  5CA3 A;  1L2A A;  2RI9 A;  1WZZ A;  3QG0 A;  4L6X A;  3PMM A;  3GLY A;  3T33 A;  1KS8 A;  2WYN A;  2FUZ A;  1FMI A;  5CZL A;  4CE7 A;  1UT9 A;  1WU4 A;  1IA6 A;  3W7U A;  1AGM A;  5DGQ A;  5GY3 A;  4AYO A;  3QWT A;  2GZ6 A;  4AYQ A;  2DRR A;  1K72 A;  1KFG A;  3RSY A;  1H12 A;  3RX7 A;  1V7X A;  3VXD A;  4ZG8 A;  2GH4 A;  2DRS A;  1XW2 A;  2CQT A;  3S4B A;  4EL8 A;  1F9D A;  2Z07 A;  3D3I A;  3QDE A;  5DGR A;  1L1Y A;  2FBA A;  3E73 A;  3RRS A;  1H54 A;  1UG9 A;  1V5C A;  2RI8 A;  3QXQ A;  3WIQ A;  2AHG A;  2VN7 A;  1AYX A;  4KTP A;  3W5M A;  3W7X A;  1LF9 A;  3P2C A;  3ANI A;  1DL2 A;  2DRQ A;  4WVB A;  4L0G A;  3GT5 A;  3EZ8 A;  3QFY A;  3ANJ A;  2D8L A;  3S4C A;  2AFA A;  1G9G A;  4AYP A;  3H7L A;  3H2W A;  4XUV A;  4WVC A;  1CEM A;  3WC3 A;  5E2J A;  1HCU A;  4FUS A;  4WU0 A;  3WKH A;  2FV0 A;  1GLM A;  3CIH A;  2FV1 A;  3ANK A;  2EAB A;  3QFZ A;  5GW7 A;  1WU5 A;  1FCE A;  2XFG A;  1LF6 A;  3ON6 A;  1V7W A;  3QT3 A;  3QXF A;  3EQA A;  3WIW A;  1H14 A;  2DRO A;  4JJJ A;  4TF4 A;  1VD5 A;  1GAH A;  1NXC A;  2OKX A;  4TXT A;  3VW5 A;  2RGK A;  3WKI A;  1FO2 A;  1FBO A;  1WU6 A;  3REN A;  4KTR A;  3RX8 A;  3WKG A;  2A8Z A;  3ACT A;  2D5J A;  1KRE A;  2ZZR A;  3E6U A;  3TF4 A;  4J5T A;  4DOE A;  1IS9 A;  4Z4J A;  1FBW A;  2EAC A;  1H13 A;  1NC5 A;  2VN4 A;  1KSD A;  3K11 A;  2CQS A;  3S4D A;  3AFJ A;  3W5N A;  2QNO A;  3W7W A;  3ACS A;  1XWT A;  3X17 A;  5CD2 A;  1ULV A;  3QSP A;  1XWQ A;  3QT9 A;  2JF4 A;  1KWF A;  1G87 A;  2EAE A;  4CJ0 A;  4CJ1 A;  2NVP A;  2P0V A;  1X9D A;  1RQ5 A;  1G6I A;  1G9J A;  1CLC A;  1TF4 A;  3GZK A;  3W7T A;  2B4F A;  1KSC A;  2JG0 A;  3QRY A;  3W7S A; 
#chains in the Genus database with same CATH topology
 3A3V A;  1V7V A;  2NOJ A;  1GA2 A;  3RX5 A;  1FP3 A;  3SDV A;  4Z4L A;  2V3N A;  2ONG A;  2EAD A;  1V5D A;  3M73 A;  1N22 A;  1C82 A;  4Q88 A;  4FXG B;  2V3P A;  4ZH5 A;  2YIK A;  1GXM A;  1L2A A;  4GTR B;  1OJN A;  3E7J A;  3M7B A;  1O1T B;  1UT9 A;  2H6F B;  3PYA A;  3G4F A;  1HMW A;  3N0G A;  4ZG8 A;  2A73 B;  3M76 A;  5FO7 B;  1XW2 A;  3HXD B;  3HXF B;  1N7Q A;  3D3I A;  2V8I A;  2V8K A;  3LZ9 A;  1SA4 B;  5ILZ A;  1AYX A;  4KTP A;  3DSV B;  2DRQ A;  4LNB B;  1LD8 B;  2BRP A;  3M02 A;  1N21 A;  4MU9 A;  3GT5 A;  3M78 A;  3E80 A;  1FT2 B;  2D8L A;  2AFA A;  1KZO B;  3CU7 A;  3H2W A;  2ZIR B;  1KZP B;  4FUS A;  1RWG A;  3HXC B;  5GW7 A;  1FCE A;  3N0F A;  3Q73 B;  3EQA A;  3WIW A;  2OKX A;  1TNO B;  3E32 B;  1QAZ A;  3M01 A;  4GTP B;  4KTR A;  3Q7F B;  1N7R A;  3M7L A;  3ACT A;  1FT1 B;  5IK9 A;  3E37 B;  2EAC A;  5ILD A;  3KSQ B;  2VN4 A;  3Q78 B;  3HXE B;  4E1Y A;  3S4D A;  1GSZ A;  2BB6 A;  5FO9 B;  4GTT B;  4D4A A;  1TNU B;  3QSP A;  1N7N A;  3QT9 A;  1KWF A;  1SQC A;  2PN5 A;  2B4F A;  1KSC A;  1QBQ B;  1N7O A;  2H6I B;  1F9O A;  2B39 A;  2PMV A;  1FO3 A;  4DOD A;  1LD7 B;  1W3Y A;  4AYR A;  1DCE B;  2E22 A;  4EHM B;  1X1J A;  3DSW B;  3SFX B;  4WVA A;  2XWB B;  1MZC B;  4QT9 A;  3SDR A;  1WZZ A;  3PZ2 B;  3SFY B;  3GLY A;  4MMI A;  4GTS B;  2WYN A;  4LNG B;  1FMI A;  2BRV X;  2XQW A;  4V1S A;  2WDA A;  5GY3 A;  1D8D B;  4OZW A;  2G0D A;  2GZ6 A;  3OXU A;  4GL3 A;  4KKI A;  4GTV B;  4FJQ A;  2F0Y B;  3RX7 A;  4YDO B;  1O79 A;  3C72 B;  2DRS A;  2CQT A;  3S4B A;  1H37 A;  1TNB B;  1L1Y A;  3E73 A;  1NI1 B;  4D4D A;  1UG9 A;  2RI8 A;  3M71 A;  2R2L B;  5IM1 A;  2VN7 A;  3W5M A;  5ILY A;  1DL2 A;  1H3B A;  1HMU A;  4LIX A;  3DRA B;  4L0G A;  3PZ4 B;  3SDQ A;  4RNQ A;  5IKH A;  1N4P B;  3S4C A;  1OJO A;  4AYP A;  5IL8 A;  3H7L A;  1TNZ B;  1O6H A;  3WC3 A;  1GLM A;  3CIH A;  2FV1 A;  1N23 A;  3ANK A;  1S63 B;  3QXF A;  1V7W A;  3QT3 A;  1H39 A;  1GAH A;  4OK4 A;  1GXN A;  1FO2 A;  1O1S B;  1O5M B;  1J0M A;  1S64 B;  4OK2 A;  3SAE A;  2A8Z A;  2J5C A;  2Q1F A;  4NEI A;  4J5T A;  5IK6 A;  1N4S B;  3G6J B;  1H13 A;  5JMF A;  1N95 B;  3VSN A;  3DSS B;  4D94 A;  3W7W A;  1QQF A;  1G87 A;  1JCR B;  4CJ1 A;  4MBG B;  1X9D A;  1RQ5 A;  2XWJ B;  3DSX B;  1G9J A;  1GHQ A;  5C05 A;  4GTM B;  3KSL B;  3QRY A;  4AYQ A;  4V1R A;  3S4A A;  4L9P B;  5KKB A;  1CB8 A;  4YDE B;  3P5P A;  1GAI A;  2SQC A;  2JJB A;  4Q2B A;  1TN6 B;  1O1R B;  1JS4 A;  1LXM A;  3SDT A;  3WKF A;  3WIR A;  4KKJ A;  1FAE A;  3A0O A;  5M7Y A;  2RI9 A;  3QG0 A;  2E24 A;  3T33 A;  1KS8 A;  1SA5 B;  2GOX A;  1HX9 A;  2FUZ A;  3PZ1 B;  5IKA A;  1D8E B;  3M72 A;  3DSU B;  1EGU A;  3QWT A;  2DRR A;  1KFG A;  3DPY B;  3M75 A;  5IK0 A;  3RSY A;  1H12 A;  2WII B;  1V7X A;  1N20 A;  2GH4 A;  2H6H B;  4BOK A;  1W6K A;  2Z07 A;  3D5S A;  5FOB B;  5DGR A;  5CA3 A;  2FBA A;  4ZRQ A;  5EAU A;  1FPP B;  3W7X A;  1LF9 A;  1QSJ A;  3P2C A;  3ANI A;  3M77 A;  5JMD A;  5JPM B;  2ZIS B;  3E30 B;  3E34 B;  1W6J A;  3SDU A;  1HZF A;  3QFY A;  1N24 A;  4GTQ B;  1O6R A;  3DST B;  3Q79 B;  1LTX B;  4WVC A;  4BOJ A;  5IL3 A;  3WKH A;  2FV0 A;  3OED A;  1RWF A;  3D5R A;  2XFG A;  4F10 A;  4C1S A;  3NNB A;  3ON6 A;  3M00 A;  1N1Z A;  4D4B A;  1H14 A;  2DRO A;  4TF4 A;  1VD5 A;  1X1I A;  3Q75 B;  1O6Q A;  2RGK A;  5FO8 B;  3SQC A;  1WU6 A;  4DI5 A;  3REN A;  5ILJ A;  1TN7 B;  3RX8 A;  3WKG A;  3K7X A;  2D5J A;  1KRE A;  3TF4 A;  4FXK B;  1IS9 A;  4Z4J A;  1H35 A;  1FBW A;  1NC5 A;  3KLS A;  3K11 A;  2CQS A;  3AFJ A;  3W5N A;  1J0N A;  1LXK A;  1RWH A;  1N9A B;  3EUV B;  5CD2 A;  1ULV A;  1XWQ A;  2JF4 A;  3PZ3 B;  4OZV A;  2EAE A;  1N4R B;  2NVP A;  1G6I A;  1CLC A;  1RWA A;  1TF4 A;  3W7T A;  1JCS B;  2JG0 A;  3P5R A;  3W7S A;  1HXA A;  2WIN B;  2V8J A;  3H3K A;  1H3A A;  5MEH A;  1OJM A;  2F6D A;  5DHK A;  2ZBL A;  3QPF A;  3WUX A;  2AHF A;  1DOG A;  1UMP A;  3M74 A;  1KKT A;  5M7I A;  3KQ4 A;  1KRF A;  1IA7 A;  3Q7A B;  1HM2 A;  2X03 A;  4L6X A;  3PMM A;  1H36 A;  5CZL A;  4CE7 A;  1I8Q A;  2BRW A;  1H3C A;  1IA6 A;  1WU4 A;  3W7U A;  1AGM A;  5DGQ A;  4YCR A;  4AYO A;  1HXG A;  3NFV A;  1K72 A;  3PYB A;  5EAS A;  4D4C A;  4GTO B;  4ZH1 A;  3VXD A;  5ILK A;  3RJ3 A;  4EL8 A;  1F9D A;  2WY8 A;  1N7P A;  3QDE A;  3RRS A;  1H54 A;  4GAX A;  1V5C A;  3QXQ A;  3WIQ A;  5ILI A;  2AHG A;  1HM3 A;  1LOH A;  5AGD A;  5GZK A;  4MMH A;  1F9G A;  3EU8 A;  2BB5 A;  3EU5 B;  4WVB A;  5ILH A;  1N4Q B;  1HXC A;  3EZ8 A;  3ANJ A;  1F1S A;  3M7C A;  2BBC A;  1G9G A;  5EAT A;  3M7E A;  1OJP A;  3VSM A;  4XUV A;  1CEM A;  5E2J A;  1HCU A;  4WU0 A;  2EAB A;  3QFZ A;  1RW9 A;  1WU5 A;  4F13 A;  1RWC A;  3E33 B;  3G4D A;  1LF6 A;  1N1B A;  4LNV A;  1X81 B;  1NL4 B;  2H6G B;  2I07 B;  4JJJ A;  1NXC A;  4TXT A;  1HN0 A;  3VW5 A;  1HV6 A;  3S9V A;  3WKI A;  1X1H A;  1TN8 B;  2BED B;  4FNV A;  1FBO A;  4M76 A;  4OJZ A;  5DHI A;  2WY7 A;  2IEJ B;  1N94 B;  2ZZR A;  4ONT A;  3E6U A;  2FUQ A;  4DOE A;  1R76 A;  5JPN B;  1C3D A;  1KSD A;  2G02 A;  2QNO A;  3ACS A;  1XWT A;  3X17 A;  1TNY B;  4CJ0 A;  3HXB B;  1JCQ B;  2ONH A;  2P0V A;  1GXO A;  2WCO A;  3AFL A;  2FUT A;  3GZK A;  4ZRP A; 
#chains in the Genus database with same CATH homology
 3A3V A;  1V7V A;  2NOJ A;  1GA2 A;  3RX5 A;  1FP3 A;  3SDV A;  4Z4L A;  2V3N A;  2EAD A;  1V5D A;  3M73 A;  4Q88 A;  4FXG B;  2V3P A;  4ZH5 A;  2YIK A;  1GXM A;  1L2A A;  4GTR B;  3M7B A;  1O1T B;  1UT9 A;  2H6F B;  3PYA A;  4ZG8 A;  2A73 B;  3M76 A;  5FO7 B;  1XW2 A;  3HXD B;  3HXF B;  3D3I A;  2V8I A;  2V8K A;  1SA4 B;  1AYX A;  4KTP A;  3DSV B;  2DRQ A;  4LNB B;  1LD8 B;  4MU9 A;  3GT5 A;  3M78 A;  1FT2 B;  2D8L A;  2AFA A;  1KZO B;  3CU7 A;  3H2W A;  2ZIR B;  1KZP B;  4FUS A;  3HXC B;  5GW7 A;  1FCE A;  3Q73 B;  3EQA A;  3WIW A;  2OKX A;  1TNO B;  3E32 B;  4GTP B;  4KTR A;  3Q7F B;  3M7L A;  3ACT A;  1FT1 B;  3E37 B;  2EAC A;  3KSQ B;  2VN4 A;  3Q78 B;  3HXE B;  3S4D A;  1GSZ A;  2BB6 A;  5FO9 B;  4GTT B;  4D4A A;  1TNU B;  3QSP A;  3QT9 A;  1KWF A;  1SQC A;  2PN5 A;  2B4F A;  1KSC A;  1QBQ B;  2H6I B;  1F9O A;  2B39 A;  2PMV A;  1FO3 A;  4DOD A;  1LD7 B;  4AYR A;  1DCE B;  4EHM B;  3DSW B;  3SFX B;  4WVA A;  2XWB B;  1MZC B;  4QT9 A;  3SDR A;  1WZZ A;  3PZ2 B;  3SFY B;  3GLY A;  4GTS B;  2WYN A;  4LNG B;  1FMI A;  2XQW A;  4V1S A;  5GY3 A;  1D8D B;  2G0D A;  2GZ6 A;  3OXU A;  4GL3 A;  4KKI A;  4GTV B;  2F0Y B;  3RX7 A;  4YDO B;  1O79 A;  3C72 B;  2DRS A;  2CQT A;  3S4B A;  1H37 A;  1TNB B;  1L1Y A;  3E73 A;  1NI1 B;  4D4D A;  1UG9 A;  2RI8 A;  3M71 A;  2R2L B;  2VN7 A;  3W5M A;  1DL2 A;  1H3B A;  4LIX A;  3DRA B;  4L0G A;  3PZ4 B;  3SDQ A;  3S4C A;  1N4P B;  4AYP A;  3H7L A;  1TNZ B;  1O6H A;  3WC3 A;  1GLM A;  3CIH A;  2FV1 A;  3ANK A;  1S63 B;  3QXF A;  1V7W A;  3QT3 A;  1H39 A;  1GAH A;  1GXN A;  1FO2 A;  1O1S B;  1O5M B;  1S64 B;  3SAE A;  2A8Z A;  4J5T A;  1N4S B;  3G6J B;  1H13 A;  1N95 B;  3DSS B;  4D94 A;  3W7W A;  1QQF A;  1G87 A;  1JCR B;  4CJ1 A;  4MBG B;  1X9D A;  1RQ5 A;  2XWJ B;  3DSX B;  1G9J A;  1GHQ A;  4GTM B;  3KSL B;  3QRY A;  4AYQ A;  4V1R A;  3S4A A;  4L9P B;  5KKB A;  4YDE B;  3P5P A;  1GAI A;  2SQC A;  2JJB A;  4Q2B A;  1TN6 B;  1O1R B;  1JS4 A;  3SDT A;  3WKF A;  3WIR A;  4KKJ A;  1FAE A;  5M7Y A;  2RI9 A;  3QG0 A;  3T33 A;  1KS8 A;  1SA5 B;  2GOX A;  3PZ1 B;  2FUZ A;  1D8E B;  3M72 A;  3DSU B;  3QWT A;  2DRR A;  1KFG A;  3DPY B;  3M75 A;  3RSY A;  1H12 A;  2WII B;  1V7X A;  2GH4 A;  2H6H B;  4BOK A;  1W6K A;  2Z07 A;  3D5S A;  5FOB B;  5DGR A;  5CA3 A;  2FBA A;  4ZRQ A;  1FPP B;  3W7X A;  1LF9 A;  1QSJ A;  3P2C A;  3ANI A;  3M77 A;  5JPM B;  2ZIS B;  3E30 B;  3E34 B;  1W6J A;  3SDU A;  1HZF A;  3QFY A;  4GTQ B;  1O6R A;  3DST B;  3Q79 B;  1LTX B;  4WVC A;  4BOJ A;  3WKH A;  2FV0 A;  3OED A;  3D5R A;  2XFG A;  4C1S A;  3ON6 A;  4D4B A;  1H14 A;  2DRO A;  4TF4 A;  1VD5 A;  3Q75 B;  1O6Q A;  2RGK A;  5FO8 B;  3SQC A;  1WU6 A;  3REN A;  1TN7 B;  3RX8 A;  3WKG A;  3K7X A;  2D5J A;  1KRE A;  3TF4 A;  4FXK B;  1IS9 A;  4Z4J A;  1H35 A;  1FBW A;  1NC5 A;  3KLS A;  3K11 A;  2CQS A;  3AFJ A;  3W5N A;  1N9A B;  3EUV B;  5CD2 A;  1ULV A;  1XWQ A;  2JF4 A;  3PZ3 B;  2EAE A;  1N4R B;  2NVP A;  1G6I A;  1CLC A;  1TF4 A;  3W7T A;  1JCS B;  2JG0 A;  3P5R A;  3W7S A;  2WIN B;  2V8J A;  3H3K A;  1H3A A;  5MEH A;  2F6D A;  2ZBL A;  3QPF A;  3WUX A;  2AHF A;  1DOG A;  1UMP A;  3M74 A;  1KKT A;  5M7I A;  3KQ4 A;  1KRF A;  1IA7 A;  3Q7A B;  4L6X A;  3PMM A;  1H36 A;  5CZL A;  4CE7 A;  1H3C A;  1IA6 A;  1WU4 A;  3W7U A;  1AGM A;  5DGQ A;  4YCR A;  4AYO A;  1K72 A;  3PYB A;  4D4C A;  4GTO B;  4ZH1 A;  3VXD A;  3RJ3 A;  4EL8 A;  1F9D A;  2WY8 A;  3QDE A;  3RRS A;  1H54 A;  1V5C A;  3QXQ A;  3WIQ A;  2AHG A;  5AGD A;  5GZK A;  3EU8 A;  2BB5 A;  3EU5 B;  4WVB A;  1N4Q B;  3EZ8 A;  3ANJ A;  3M7C A;  2BBC A;  1G9G A;  3M7E A;  4XUV A;  1CEM A;  5E2J A;  1HCU A;  4WU0 A;  2EAB A;  3QFZ A;  1WU5 A;  3E33 B;  1LF6 A;  4LNV A;  1X81 B;  1NL4 B;  2H6G B;  2I07 B;  4JJJ A;  1NXC A;  4TXT A;  3VW5 A;  3S9V A;  3WKI A;  1TN8 B;  2BED B;  1FBO A;  4M76 A;  2WY7 A;  2IEJ B;  1N94 B;  2ZZR A;  4ONT A;  3E6U A;  4DOE A;  1R76 A;  5JPN B;  1C3D A;  1KSD A;  2G02 A;  2QNO A;  3ACS A;  1XWT A;  3X17 A;  1TNY B;  4CJ0 A;  3HXB B;  1JCQ B;  2P0V A;  1GXO A;  3GZK A;  4ZRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...