1WU4A

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
376
structure length
374
Chain Sequence
EGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSDSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords xylanase Y
publication title Structural Basis for the Specificity of the Reducing End Xylose-releasing Exo-oligoxylanase from Bacillus halodurans C-125
pubmed doi rcsb
source organism Bacillus halodurans
total genus 152
structure length 374
sequence length 376
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2004-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1wu4A01
5KKBA 1WU5A 1IA7A 4AYPA 2CQSA 2F6DA 2B4FA 1V5CA 1KS8A 3E73A 2FBAA 3K11A 4ZH5A 2Z07A 2VN7A 4CJ1A 3TF4A 2A8ZA 1WZZA 3AFJA 1DOGA 4DODA 2DRSA 1G9GA 1LF9A 1AGMA 2NVPA 1JS4A 4ZG8A 3S4AA 3T33A 1IA6A 1UG9A 2FV0A 3H3KA 3VXDA 1L1YA 3A3VA 3QXQA 1LF6A 2D5JA 1F9DA 1KREA 3ANJA 1HCUA 2ZBLA 4AYQA 1FBOA 4Z4JA 4AYOA 1GAHA 1GA2A 2AFAA 2DROA 2YIKA 1K72A 2JG0A 2GH4A 4FUSA 3QPFA 1FMIA 1TF4A 3GLYA 3WKHA 1H54A 1WU6A 1FO2A 2DRRA 3WKIA 1V7XA 3W7UA 3P2CA 2RI9A 3W7WA 4DOEA 4TXTA 4CE7A 2ZZRA 1XWTA 2RI8A 5DGRA 3QDEA 1RQ5A 1IS9A 2VN4A 1G9JA 4J5TA 4WU0A 3WIRA 1WU4A 1KFGA 3H7LA 5CD2A 3W5MA 1H12A 1X9DA 1XW2A 2WYNA 1KRFA 3QRYA 1F9OA 1H13A 3GT5A 3ANIA 4JJJA 1KKTA 3RSYA 1V7VA 3S4BA 3W7SA 3W7XA 3ANKA 1DL2A 2AHFA 4KTPA 3W5NA 3QFZA 3VW5A 3QSPA 1UT9A 3QXFA 1NXCA 5M7IA 3QT3A 1V5DA 3QT9A 4CJ0A 3X17A 1NC5A 3CIHA 1KSCA 3WIQA 2FV1A 4WVBA 5E2JA 1GAIA 1KWFA 2QNOA 2FUZA 1FP3A 2AHGA 1AYXA 2P0VA 5M7YA 4Q88A 5CZLA 5DGQA 1H14A 1XWQA 1L2AA 1V7WA 3WUXA 3RX8A 1GLMA 3ACTA 1G6IA 4XUVA 4EL8A 4Z4LA 3EQAA 1ULVA 4AYRA 5GW7A 3S4DA 3W7TA 3D3IA 4KTRA 3E6UA 4WVCA 4TF4A 1FCEA 3WIWA 5MEHA 1FBWA 3QWTA 2RGKA 3QG0A 2GZ6A 3EZ8A 3RRSA 1VD5A 1CLCA 1KSDA 2CQTA 4L0GA 4Q2BA 1CEMA 2DRQA 2EACA 2OKXA 3S4CA 3WC3A 2EAEA 2JJBA 5GY3A 1G87A 5CA3A 2D8LA 2XFGA 3GZKA 3H2WA 3RX5A 3ACSA 2JF4A 3WKGA 3QFYA 4WVAA 3ON6A 4L6XA 2EADA 2EABA 3RENA 1FAEA 3PMMA 3WKFA 1FO3A 3RX7A
chains in the Genus database with same CATH superfamily
5KKBA 4GTVB 5IM1A 2CQSA 1HMUA 3N0FA 4D4BA 1KS8A 2SQCA 3E73A 4GTSB 4OJZA 1J0NA 3Q7FB 4FXGB 1HM3A 1D8DB 1OJOA 4CJ1A 1N95B 1O79A 1O6RA 1N7OA 3SDRA 1OJPA 2R2LB 4OK2A 5ILHA 3KLSA 1LF9A 3SDUA 2NVPA 4OK4A 4ZG8A 3PZ1B 1HXGA 1L1YA 3A3VA 3M71A 1FT1B 5ILJA 1HCUA 2ZBLA 5IK6A 4Z4JA 4AYOA 2JG0A 1FMIA 2FUQA 3WKHA 1H54A 1WU6A 1FO2A 4D94A 1LD8B 1HX9A 2RI9A 1I8QA 4DOEA 1N4SB 4TXTA 1RWHA 2E24A 4F10A 1HMWA 1RQ5A 1LOHA 2VN4A 1G9JA 4BOKA 5IL3A 1O1SB 2XWBB 1C82A 1EGUA 1XW2A 1N9AB 3QRYA 4JJJA 1H13A 1KKTA 3RSYA 3W7XA 3P5RA 5JMDA 3ANKA 4KTPA 5ILKA 4MMHA 3QXFA 1UT9A 1LTXB 1TNYB 3M7EA 2H6FB 5M7IA 1GAIA 1O1TB 4F13A 4D4CA 1FP3A 2AHGA 3M78A 2PN5A 1H14A 1L2AA 3RX8A 3SDVA 3ACTA 3C72B 2H6GB 1H3CA 2NOJA 3EQAA 1ULVA 1N4QB 1H39A 2ZIRB 3S4DA 4WVCA 1FBWA 3QG0A 2V8IA 1D8EB 2CQTA 4L0GA 2BRVX 3DSTB 3S4CA 2EAEA 3M77A 3P5PA 1HV6A 3Q75B 2WINB 5CA3A 1TNZB 3SAEA 2D8LA 1N1ZA 3GZKA 3RX5A 5ILDA 3ACSA 1LXMA 3DSXB 2EABA 3WKFA 3ANIA 3RX7A 2G0DA 4EHMB 2Q1FA 3Q78B 3E32B 1N7RA 2FBAA 3K11A 4YDEB 2B39A 3PZ2B 1DOGA 2XQWA 1F1SA 1X81B 2DRSA 1GHQA 3PZ3B 4MBGB 1JCSB 1JS4A 3HXEB 3DPYB 1JCQB 3T33A 1IA6A 3VSMA 3M76A 4NEIA 3KSQB 3VXDA 2BRWA 1F9DA 1KREA 3ANJA 3N0GA 3PYBA 1HZFA 5DHKA 1UMPA 1GA2A 2AFAA 2YIKA 1K72A 2BEDB 2GH4A 3QPFA 3Q73B 4DI5A 3WKIA 1V7XA 1MZCB 1RWCA 1H3BA 3E80A 2WDAA 1FT2B 2ZZRA 1XWTA 3DRAB 3KSLB 2J5CA 1IS9A 1TNUB 2I07B 1KFGA 2FUTA 5ILIA 5IL8A 1H12A 3M02A 1N23A 4GTPB 1CB8A 1F9OA 3GT5A 3S4BA 1O5MB 1W6KA 3G4FA 3M00A 5EAUA 1F9GA 1R76A 1GXOA 4ZRQA 1TN6B 1NXCA 1QBQB 1TN7B 1KZPB 3QT9A 3X17A 5EASA 5JPNB 1N7NA 4E1YA 1KSCA 1N4RB 4WVBA 3NNBA 1AYXA 3OEDA 4Q88A 4YDOB 1XWQA 1LD7B 1GLMA 1HN0A 1KZOB 1HXAA 5JMFA 1O6HA 4AYRA 5GW7A 3M74A 3D3IA 4KTRA 1H36A 2BBCA 1X1HA 4TF4A 3QWTA 3EZ8A 1VD5A 1KSDA 4Q2BA 3EU8A 2DRQA 2EACA 2JJBA 3M75A 4KKIA 1G87A 3M01A 1X1IA 2JF4A 4L9PB 3ON6A 2EADA 1RWAA 5IK0A 3VSNA 3AFLA 1FO3A 1SA4B 1WU5A 3D5RA 3DSWB 2F6DA 2B4FA 3KQ4A 1GXMA 4ZH5A 2PMVA 3TF4A 1WZZA 2V3NA 4DODA 4BOJA 2BRPA 3EU5B 1AGMA 4D4DA 1X1JA 3HXDB 3S4AA 4ZRPA 1TNBB 1UG9A 3H3KA 3E7JA 2H6HB 3QXQA 1SQCA 2D5JA 4GTMB 4GTTB 4RNQA 2GOXA 2DROA 3G4DA 4FUSA 1TF4A 2DRRA 3W7UA 2IEJB 2WY7A 4CE7A 5DHIA 2A73B 1SA5B 3S9VA 3QDEA 4J5TA 1WU4A 3SDTA 3A0OA 3LZ9A 3H7LA 4LIXA 4ONTA 1N7QA 2WYNA 1DCEB 3W7SA 1V7VA 1DL2A 1N7PA 5AGDA 3VW5A 5FO7B 3HXCB 3QT3A 1V5DA 1NC5A 3CIHA 3OXUA 3PYAA 3PZ4B 4KKJA 2FV1A 3WIQA 4C1SA 5IKAA 1KWFA 2QNOA 5M7YA 5DGQA 3RJ3A 1V7WA 3WUXA 1W3YA 2WCOA 1H37A 1G6IA 1H3AA 3M72A 5GZKA 4Z4LA 3CU7A 3E33B 3M7BA 3Q7AB 1HM2A 1S63B 3DSUB 1FCEA 4GL3A 1QQFA 4EL8A 2GZ6A 3E30B 3RRSA 1CLCA 2V8KA 1CEMA 3M7CA 3WC3A 1N22A 5GY3A 1NI1B 4QT9A 4OZWA 3HXBB 2WIIB 3WKGA 3QFYA 4WVAA 2ZISB 3EUVB 4FNVA 1FAEA 3PMMA 1LXKA 1C3DA 1IA7A 1NL4B 4AYPA 4GTRB 1V5CA 2XWJB 3Q79B 3G6JB 2Z07A 2VN7A 3SFXB 4D4AA 3K7XA 2A8ZA 4ZH1A 3AFJA 4M76A 1O6QA 1G9GA 1FPPB 4YCRA 1N1BA 4MMIA 4MU9A 1JCRB 5IKHA 3SFYB 1H35A 2FV0A 1GXNA 3DSSB 1LF6A 1RWFA 1OJNA 2X03A 4GAXA 4AYQA 1FBOA 3E37B 2BB6A 3DSVB 1GAHA 1J0MA 3GLYA 1TNOB 1N21A 2G02A 3NFVA 5IK9A 3W7WA 3P2CA 1N4PB 1QAZA 4GTQB 2RI8A 5DGRA 1GSZA 4WU0A 3WIRA 2V3PA 5CD2A 3W5MA 2WY8A 2BB5A 2F0YB 1X9DA 4FJQA 5FO9B 1KRFA 1O1RB 3W5NA 2AHFA 3QFZA 4FXKB 4V1SA 2ONHA 5FO8B 3QSPA 1TN8B 3SDQA 5JPMB 5C05A 4CJ0A 5E2JA 1RWGA 3D5SA 1N24A 2FUZA 2P0VA 5CZLA 4LNBB 1N94B 4OZVA 5ILYA 4XUVA 5EATA 2E22A 4LNVA 2H6IB 2V8JA 5FOBB 3HXFB 5ILZA 3W7TA 3E6UA 1HXCA 3WIWA 5MEHA 2RGKA 4V1RA 2OKXA 1N20A 3SQCA 3M73A 3M7LA 2ONGA 4GTOB 2XFGA 3H2WA 4LNGB 1QSJA 1OJMA 4L6XA 3RENA 1W6JA 1RW9A 3E34B 1S64B
chains in the Genus database with same CATH topology
5KKBA 4GTVB 2CQSA 4D4BA 1KS8A 2SQCA 3E73A 4GTSB 3Q7FB 4FXGB 1D8DB 4CJ1A 1N95B 1O79A 1O6RA 3SDRA 2R2LB 3KLSA 1LF9A 3SDUA 2NVPA 4ZG8A 3PZ1B 1L1YA 3A3VA 3M71A 1FT1B 1HCUA 2ZBLA 4Z4JA 4AYOA 2JG0A 1FMIA 3WKHA 1H54A 1WU6A 1FO2A 4D94A 1LD8B 2RI9A 4DOEA 1N4SB 4TXTA 1RQ5A 2VN4A 1G9JA 4BOKA 1O1SB 2XWBB 1XW2A 1N9AB 3QRYA 4JJJA 1H13A 1KKTA 3RSYA 3W7XA 3P5RA 3ANKA 4KTPA 3QXFA 1UT9A 1LTXB 1TNYB 3M7EA 2H6FB 5M7IA 1GAIA 1O1TB 4D4CA 1FP3A 2AHGA 3M78A 2PN5A 1H14A 1L2AA 3RX8A 3SDVA 3ACTA 3C72B 2H6GB 1H3CA 2NOJA 3EQAA 1ULVA 1N4QB 1H39A 2ZIRB 3S4DA 4WVCA 1FBWA 3QG0A 2V8IA 1D8EB 2CQTA 4L0GA 3S4CA 3DSTB 2EAEA 3M77A 3P5PA 3Q75B 2WINB 5CA3A 1TNZB 3SAEA 2D8LA 3GZKA 3RX5A 3ACSA 3DSXB 2EABA 3WKFA 3ANIA 3RX7A 2G0DA 4EHMB 3Q78B 3E32B 2FBAA 3K11A 4YDEB 2B39A 3PZ2B 1DOGA 2XQWA 1X81B 2DRSA 1GHQA 3PZ3B 4MBGB 1JCSB 1JS4A 3HXEB 3DPYB 1JCQB 3T33A 1IA6A 3M76A 3KSQB 3VXDA 1F9DA 1KREA 3ANJA 3PYBA 1HZFA 1UMPA 1GA2A 2AFAA 2YIKA 1K72A 2BEDB 2GH4A 3QPFA 3Q73B 3WKIA 1V7XA 1MZCB 1H3BA 1FT2B 2ZZRA 1XWTA 3DRAB 3KSLB 1IS9A 1TNUB 2I07B 1KFGA 1H12A 4GTPB 1F9OA 3GT5A 3S4BA 1O5MB 1W6KA 1R76A 1GXOA 4ZRQA 1TN6B 1NXCA 1QBQB 1TN7B 1KZPB 3QT9A 3X17A 5JPNB 1KSCA 1N4RB 4WVBA 1AYXA 3OEDA 4Q88A 4YDOB 1XWQA 1LD7B 1GLMA 1KZOB 1O6HA 4AYRA 5GW7A 3M74A 3D3IA 4KTRA 1H36A 2BBCA 4TF4A 3QWTA 3EZ8A 1VD5A 1KSDA 4Q2BA 3EU8A 2DRQA 2EACA 2JJBA 3M75A 4KKIA 1G87A 2JF4A 4L9PB 3ON6A 2EADA 1FO3A 1SA4B 1WU5A 3D5RA 3DSWB 2F6DA 2B4FA 3KQ4A 1GXMA 4ZH5A 2PMVA 3TF4A 1WZZA 2V3NA 4DODA 4BOJA 3EU5B 1AGMA 4D4DA 3HXDB 3S4AA 4ZRPA 1TNBB 1UG9A 3H3KA 2H6HB 3QXQA 1SQCA 2D5JA 4GTMB 4GTTB 2GOXA 2DROA 4FUSA 1TF4A 2DRRA 3W7UA 2IEJB 2WY7A 4CE7A 2A73B 1SA5B 3S9VA 3QDEA 4J5TA 1WU4A 3SDTA 3H7LA 4LIXA 4ONTA 2WYNA 1DCEB 3W7SA 1V7VA 1DL2A 5AGDA 3VW5A 5FO7B 3HXCB 3QT3A 1V5DA 1NC5A 3CIHA 3OXUA 3PYAA 3PZ4B 4KKJA 2FV1A 3WIQA 4C1SA 1KWFA 2QNOA 5M7YA 5DGQA 3RJ3A 1V7WA 3WUXA 1H37A 1G6IA 1H3AA 3M72A 5GZKA 4Z4LA 3CU7A 3E33B 3M7BA 3Q7AB 1S63B 3DSUB 1FCEA 4GL3A 1QQFA 4EL8A 2GZ6A 3E30B 3RRSA 1CLCA 2V8KA 1CEMA 3M7CA 3WC3A 5GY3A 1NI1B 4QT9A 3HXBB 2WIIB 3WKGA 3QFYA 4WVAA 2ZISB 3EUVB 1FAEA 3PMMA 1C3DA 1IA7A 1NL4B 4AYPA 4GTRB 1V5CA 2XWJB 3Q79B 3G6JB 2Z07A 2VN7A 3SFXB 4D4AA 3K7XA 2A8ZA 4ZH1A 3AFJA 4M76A 1O6QA 1G9GA 1FPPB 4YCRA 4MU9A 1JCRB 3SFYB 1H35A 2FV0A 1GXNA 3DSSB 1LF6A 4AYQA 1FBOA 3E37B 2BB6A 3DSVB 1GAHA 3GLYA 1TNOB 2G02A 3W7WA 3P2CA 1N4PB 4GTQB 2RI8A 5DGRA 1GSZA 4WU0A 3WIRA 2V3PA 5CD2A 3W5MA 2WY8A 2BB5A 2F0YB 1X9DA 5FO9B 1KRFA 1O1RB 3W5NA 2AHFA 3QFZA 4FXKB 4V1SA 5FO8B 3QSPA 1TN8B 3SDQA 5JPMB 4CJ0A 5E2JA 3D5SA 2FUZA 2P0VA 5CZLA 4LNBB 1N94B 4XUVA 4LNVA 2H6IB 2V8JA 5FOBB 3HXFB 3W7TA 3E6UA 3WIWA 5MEHA 2RGKA 4V1RA 2OKXA 3SQCA 3M73A 3M7LA 4GTOB 2XFGA 3H2WA 4LNGB 1QSJA 4L6XA 3RENA 1W6JA 3E34B 1S64B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KKB A;  1WU5 A;  1IA7 A;  4AYP A;  2CQS A;  2F6D A;  2B4F A;  1V5C A;  1KS8 A;  3E73 A;  2FBA A;  3K11 A;  4ZH5 A;  2Z07 A;  2VN7 A;  4CJ1 A;  3TF4 A;  2A8Z A;  1WZZ A;  3AFJ A;  1DOG A;  4DOD A;  2DRS A;  1G9G A;  1LF9 A;  1AGM A;  2NVP A;  1JS4 A;  4ZG8 A;  3S4A A;  3T33 A;  1IA6 A;  1UG9 A;  2FV0 A;  3H3K A;  3VXD A;  1L1Y A;  3A3V A;  3QXQ A;  1LF6 A;  2D5J A;  1F9D A;  1KRE A;  3ANJ A;  1HCU A;  2ZBL A;  4AYQ A;  1FBO A;  4Z4J A;  4AYO A;  1GAH A;  1GA2 A;  2AFA A;  2DRO A;  2YIK A;  1K72 A;  2JG0 A;  2GH4 A;  4FUS A;  3QPF A;  1FMI A;  1TF4 A;  3GLY A;  3WKH A;  1H54 A;  1WU6 A;  1FO2 A;  2DRR A;  3WKI A;  1V7X A;  3W7U A;  3P2C A;  2RI9 A;  3W7W A;  4DOE A;  4TXT A;  4CE7 A;  2ZZR A;  1XWT A;  2RI8 A;  5DGR A;  3QDE A;  1RQ5 A;  1IS9 A;  2VN4 A;  1G9J A;  4J5T A;  4WU0 A;  3WIR A;  1WU4 A;  1KFG A;  3H7L A;  5CD2 A;  3W5M A;  1H12 A;  1X9D A;  1XW2 A;  2WYN A;  1KRF A;  3QRY A;  1F9O A;  1H13 A;  3GT5 A;  3ANI A;  4JJJ A;  1KKT A;  3RSY A;  1V7V A;  3S4B A;  3W7S A;  3W7X A;  3ANK A;  1DL2 A;  2AHF A;  4KTP A;  3W5N A;  3QFZ A;  3VW5 A;  3QSP A;  1UT9 A;  3QXF A;  1NXC A;  5M7I A;  3QT3 A;  1V5D A;  3QT9 A;  4CJ0 A;  3X17 A;  1NC5 A;  3CIH A;  1KSC A;  3WIQ A;  2FV1 A;  4WVB A;  5E2J A;  1GAI A;  1KWF A;  2QNO A;  2FUZ A;  1FP3 A;  2AHG A;  1AYX A;  2P0V A;  5M7Y A;  4Q88 A;  5CZL A;  5DGQ A;  1H14 A;  1XWQ A;  1L2A A;  1V7W A;  3WUX A;  3RX8 A;  1GLM A;  3ACT A;  1G6I A;  4XUV A;  4EL8 A;  4Z4L A;  3EQA A;  1ULV A;  4AYR A;  5GW7 A;  3S4D A;  3W7T A;  3D3I A;  4KTR A;  3E6U A;  4WVC A;  4TF4 A;  1FCE A;  3WIW A;  5MEH A;  1FBW A;  3QWT A;  2RGK A;  3QG0 A;  2GZ6 A;  3EZ8 A;  3RRS A;  1VD5 A;  1CLC A;  1KSD A;  2CQT A;  4L0G A;  4Q2B A;  1CEM A;  2DRQ A;  2EAC A;  2OKX A;  3S4C A;  3WC3 A;  2EAE A;  2JJB A;  5GY3 A;  1G87 A;  5CA3 A;  2D8L A;  2XFG A;  3GZK A;  3H2W A;  3RX5 A;  3ACS A;  2JF4 A;  3WKG A;  3QFY A;  4WVA A;  3ON6 A;  4L6X A;  2EAD A;  2EAB A;  3REN A;  1FAE A;  3PMM A;  3WKF A;  1FO3 A;  3RX7 A; 
#chains in the Genus database with same CATH topology
 5KKB A;  4GTV B;  5IM1 A;  2CQS A;  1HMU A;  3N0F A;  4D4B A;  1KS8 A;  2SQC A;  3E73 A;  4GTS B;  4OJZ A;  1J0N A;  3Q7F B;  4FXG B;  1HM3 A;  1D8D B;  1OJO A;  4CJ1 A;  1N95 B;  1O79 A;  1O6R A;  1N7O A;  3SDR A;  1OJP A;  2R2L B;  4OK2 A;  5ILH A;  3KLS A;  1LF9 A;  3SDU A;  2NVP A;  4OK4 A;  4ZG8 A;  3PZ1 B;  1HXG A;  1L1Y A;  3A3V A;  3M71 A;  1FT1 B;  5ILJ A;  1HCU A;  2ZBL A;  5IK6 A;  4Z4J A;  4AYO A;  2JG0 A;  1FMI A;  2FUQ A;  3WKH A;  1H54 A;  1WU6 A;  1FO2 A;  4D94 A;  1LD8 B;  1HX9 A;  2RI9 A;  1I8Q A;  4DOE A;  1N4S B;  4TXT A;  1RWH A;  2E24 A;  4F10 A;  1HMW A;  1RQ5 A;  1LOH A;  2VN4 A;  1G9J A;  4BOK A;  5IL3 A;  1O1S B;  2XWB B;  1C82 A;  1EGU A;  1XW2 A;  1N9A B;  3QRY A;  4JJJ A;  1H13 A;  1KKT A;  3RSY A;  3W7X A;  3P5R A;  5JMD A;  3ANK A;  4KTP A;  5ILK A;  4MMH A;  3QXF A;  1UT9 A;  1LTX B;  1TNY B;  3M7E A;  2H6F B;  5M7I A;  1GAI A;  1O1T B;  4F13 A;  4D4C A;  1FP3 A;  2AHG A;  3M78 A;  2PN5 A;  1H14 A;  1L2A A;  3RX8 A;  3SDV A;  3ACT A;  3C72 B;  2H6G B;  1H3C A;  2NOJ A;  3EQA A;  1ULV A;  1N4Q B;  1H39 A;  2ZIR B;  3S4D A;  4WVC A;  1FBW A;  3QG0 A;  2V8I A;  1D8E B;  2CQT A;  4L0G A;  2BRV X;  3DST B;  3S4C A;  2EAE A;  3M77 A;  3P5P A;  1HV6 A;  3Q75 B;  2WIN B;  5CA3 A;  1TNZ B;  3SAE A;  2D8L A;  1N1Z A;  3GZK A;  3RX5 A;  5ILD A;  3ACS A;  1LXM A;  3DSX B;  2EAB A;  3WKF A;  3ANI A;  3RX7 A;  2G0D A;  4EHM B;  2Q1F A;  3Q78 B;  3E32 B;  1N7R A;  2FBA A;  3K11 A;  4YDE B;  2B39 A;  3PZ2 B;  1DOG A;  2XQW A;  1F1S A;  1X81 B;  2DRS A;  1GHQ A;  3PZ3 B;  4MBG B;  1JCS B;  1JS4 A;  3HXE B;  3DPY B;  1JCQ B;  3T33 A;  1IA6 A;  3VSM A;  3M76 A;  4NEI A;  3KSQ B;  3VXD A;  2BRW A;  1F9D A;  1KRE A;  3ANJ A;  3N0G A;  3PYB A;  1HZF A;  5DHK A;  1UMP A;  1GA2 A;  2AFA A;  2YIK A;  1K72 A;  2BED B;  2GH4 A;  3QPF A;  3Q73 B;  4DI5 A;  3WKI A;  1V7X A;  1MZC B;  1RWC A;  1H3B A;  3E80 A;  2WDA A;  1FT2 B;  2ZZR A;  1XWT A;  3DRA B;  3KSL B;  2J5C A;  1IS9 A;  1TNU B;  2I07 B;  1KFG A;  2FUT A;  5ILI A;  5IL8 A;  1H12 A;  3M02 A;  1N23 A;  4GTP B;  1CB8 A;  1F9O A;  3GT5 A;  3S4B A;  1O5M B;  1W6K A;  3G4F A;  3M00 A;  5EAU A;  1F9G A;  1R76 A;  1GXO A;  4ZRQ A;  1TN6 B;  1NXC A;  1QBQ B;  1TN7 B;  1KZP B;  3QT9 A;  3X17 A;  5EAS A;  5JPN B;  1N7N A;  4E1Y A;  1KSC A;  1N4R B;  4WVB A;  3NNB A;  1AYX A;  3OED A;  4Q88 A;  4YDO B;  1XWQ A;  1LD7 B;  1GLM A;  1HN0 A;  1KZO B;  1HXA A;  5JMF A;  1O6H A;  4AYR A;  5GW7 A;  3M74 A;  3D3I A;  4KTR A;  1H36 A;  2BBC A;  1X1H A;  4TF4 A;  3QWT A;  3EZ8 A;  1VD5 A;  1KSD A;  4Q2B A;  3EU8 A;  2DRQ A;  2EAC A;  2JJB A;  3M75 A;  4KKI A;  1G87 A;  3M01 A;  1X1I A;  2JF4 A;  4L9P B;  3ON6 A;  2EAD A;  1RWA A;  5IK0 A;  3VSN A;  3AFL A;  1FO3 A;  1SA4 B;  1WU5 A;  3D5R A;  3DSW B;  2F6D A;  2B4F A;  3KQ4 A;  1GXM A;  4ZH5 A;  2PMV A;  3TF4 A;  1WZZ A;  2V3N A;  4DOD A;  4BOJ A;  2BRP A;  3EU5 B;  1AGM A;  4D4D A;  1X1J A;  3HXD B;  3S4A A;  4ZRP A;  1TNB B;  1UG9 A;  3H3K A;  3E7J A;  2H6H B;  3QXQ A;  1SQC A;  2D5J A;  4GTM B;  4GTT B;  4RNQ A;  2GOX A;  2DRO A;  3G4D A;  4FUS A;  1TF4 A;  2DRR A;  3W7U A;  2IEJ B;  2WY7 A;  4CE7 A;  5DHI A;  2A73 B;  1SA5 B;  3S9V A;  3QDE A;  4J5T A;  1WU4 A;  3SDT A;  3A0O A;  3LZ9 A;  3H7L A;  4LIX A;  4ONT A;  1N7Q A;  2WYN A;  1DCE B;  3W7S A;  1V7V A;  1DL2 A;  1N7P A;  5AGD A;  3VW5 A;  5FO7 B;  3HXC B;  3QT3 A;  1V5D A;  1NC5 A;  3CIH A;  3OXU A;  3PYA A;  3PZ4 B;  4KKJ A;  2FV1 A;  3WIQ A;  4C1S A;  5IKA A;  1KWF A;  2QNO A;  5M7Y A;  5DGQ A;  3RJ3 A;  1V7W A;  3WUX A;  1W3Y A;  2WCO A;  1H37 A;  1G6I A;  1H3A A;  3M72 A;  5GZK A;  4Z4L A;  3CU7 A;  3E33 B;  3M7B A;  3Q7A B;  1HM2 A;  1S63 B;  3DSU B;  1FCE A;  4GL3 A;  1QQF A;  4EL8 A;  2GZ6 A;  3E30 B;  3RRS A;  1CLC A;  2V8K A;  1CEM A;  3M7C A;  3WC3 A;  1N22 A;  5GY3 A;  1NI1 B;  4QT9 A;  4OZW A;  3HXB B;  2WII B;  3WKG A;  3QFY A;  4WVA A;  2ZIS B;  3EUV B;  4FNV A;  1FAE A;  3PMM A;  1LXK A;  1C3D A;  1IA7 A;  1NL4 B;  4AYP A;  4GTR B;  1V5C A;  2XWJ B;  3Q79 B;  3G6J B;  2Z07 A;  2VN7 A;  3SFX B;  4D4A A;  3K7X A;  2A8Z A;  4ZH1 A;  3AFJ A;  4M76 A;  1O6Q A;  1G9G A;  1FPP B;  4YCR A;  1N1B A;  4MMI A;  4MU9 A;  1JCR B;  5IKH A;  3SFY B;  1H35 A;  2FV0 A;  1GXN A;  3DSS B;  1LF6 A;  1RWF A;  1OJN A;  2X03 A;  4GAX A;  4AYQ A;  1FBO A;  3E37 B;  2BB6 A;  3DSV B;  1GAH A;  1J0M A;  3GLY A;  1TNO B;  1N21 A;  2G02 A;  3NFV A;  5IK9 A;  3W7W A;  3P2C A;  1N4P B;  1QAZ A;  4GTQ B;  2RI8 A;  5DGR A;  1GSZ A;  4WU0 A;  3WIR A;  2V3P A;  5CD2 A;  3W5M A;  2WY8 A;  2BB5 A;  2F0Y B;  1X9D A;  4FJQ A;  5FO9 B;  1KRF A;  1O1R B;  3W5N A;  2AHF A;  3QFZ A;  4FXK B;  4V1S A;  2ONH A;  5FO8 B;  3QSP A;  1TN8 B;  3SDQ A;  5JPM B;  5C05 A;  4CJ0 A;  5E2J A;  1RWG A;  3D5S A;  1N24 A;  2FUZ A;  2P0V A;  5CZL A;  4LNB B;  1N94 B;  4OZV A;  5ILY A;  4XUV A;  5EAT A;  2E22 A;  4LNV A;  2H6I B;  2V8J A;  5FOB B;  3HXF B;  5ILZ A;  3W7T A;  3E6U A;  1HXC A;  3WIW A;  5MEH A;  2RGK A;  4V1R A;  2OKX A;  1N20 A;  3SQC A;  3M73 A;  3M7L A;  2ONG A;  4GTO B;  2XFG A;  3H2W A;  4LNG B;  1QSJ A;  1OJM A;  4L6X A;  3REN A;  1W6J A;  1RW9 A;  3E34 B;  1S64 B; 
#chains in the Genus database with same CATH homology
 5KKB A;  4GTV B;  2CQS A;  4D4B A;  1KS8 A;  2SQC A;  3E73 A;  4GTS B;  3Q7F B;  4FXG B;  1D8D B;  4CJ1 A;  1N95 B;  1O79 A;  1O6R A;  3SDR A;  2R2L B;  3KLS A;  1LF9 A;  3SDU A;  2NVP A;  4ZG8 A;  3PZ1 B;  1L1Y A;  3A3V A;  3M71 A;  1FT1 B;  1HCU A;  2ZBL A;  4Z4J A;  4AYO A;  2JG0 A;  1FMI A;  3WKH A;  1H54 A;  1WU6 A;  1FO2 A;  4D94 A;  1LD8 B;  2RI9 A;  4DOE A;  1N4S B;  4TXT A;  1RQ5 A;  2VN4 A;  1G9J A;  4BOK A;  1O1S B;  2XWB B;  1XW2 A;  1N9A B;  3QRY A;  4JJJ A;  1H13 A;  1KKT A;  3RSY A;  3W7X A;  3P5R A;  3ANK A;  4KTP A;  3QXF A;  1UT9 A;  1LTX B;  1TNY B;  3M7E A;  2H6F B;  5M7I A;  1GAI A;  1O1T B;  4D4C A;  1FP3 A;  2AHG A;  3M78 A;  2PN5 A;  1H14 A;  1L2A A;  3RX8 A;  3SDV A;  3ACT A;  3C72 B;  2H6G B;  1H3C A;  2NOJ A;  3EQA A;  1ULV A;  1N4Q B;  1H39 A;  2ZIR B;  3S4D A;  4WVC A;  1FBW A;  3QG0 A;  2V8I A;  1D8E B;  2CQT A;  4L0G A;  3S4C A;  3DST B;  2EAE A;  3M77 A;  3P5P A;  3Q75 B;  2WIN B;  5CA3 A;  1TNZ B;  3SAE A;  2D8L A;  3GZK A;  3RX5 A;  3ACS A;  3DSX B;  2EAB A;  3WKF A;  3ANI A;  3RX7 A;  2G0D A;  4EHM B;  3Q78 B;  3E32 B;  2FBA A;  3K11 A;  4YDE B;  2B39 A;  3PZ2 B;  1DOG A;  2XQW A;  1X81 B;  2DRS A;  1GHQ A;  3PZ3 B;  4MBG B;  1JCS B;  1JS4 A;  3HXE B;  3DPY B;  1JCQ B;  3T33 A;  1IA6 A;  3M76 A;  3KSQ B;  3VXD A;  1F9D A;  1KRE A;  3ANJ A;  3PYB A;  1HZF A;  1UMP A;  1GA2 A;  2AFA A;  2YIK A;  1K72 A;  2BED B;  2GH4 A;  3QPF A;  3Q73 B;  3WKI A;  1V7X A;  1MZC B;  1H3B A;  1FT2 B;  2ZZR A;  1XWT A;  3DRA B;  3KSL B;  1IS9 A;  1TNU B;  2I07 B;  1KFG A;  1H12 A;  4GTP B;  1F9O A;  3GT5 A;  3S4B A;  1O5M B;  1W6K A;  1R76 A;  1GXO A;  4ZRQ A;  1TN6 B;  1NXC A;  1QBQ B;  1TN7 B;  1KZP B;  3QT9 A;  3X17 A;  5JPN B;  1KSC A;  1N4R B;  4WVB A;  1AYX A;  3OED A;  4Q88 A;  4YDO B;  1XWQ A;  1LD7 B;  1GLM A;  1KZO B;  1O6H A;  4AYR A;  5GW7 A;  3M74 A;  3D3I A;  4KTR A;  1H36 A;  2BBC A;  4TF4 A;  3QWT A;  3EZ8 A;  1VD5 A;  1KSD A;  4Q2B A;  3EU8 A;  2DRQ A;  2EAC A;  2JJB A;  3M75 A;  4KKI A;  1G87 A;  2JF4 A;  4L9P B;  3ON6 A;  2EAD A;  1FO3 A;  1SA4 B;  1WU5 A;  3D5R A;  3DSW B;  2F6D A;  2B4F A;  3KQ4 A;  1GXM A;  4ZH5 A;  2PMV A;  3TF4 A;  1WZZ A;  2V3N A;  4DOD A;  4BOJ A;  3EU5 B;  1AGM A;  4D4D A;  3HXD B;  3S4A A;  4ZRP A;  1TNB B;  1UG9 A;  3H3K A;  2H6H B;  3QXQ A;  1SQC A;  2D5J A;  4GTM B;  4GTT B;  2GOX A;  2DRO A;  4FUS A;  1TF4 A;  2DRR A;  3W7U A;  2IEJ B;  2WY7 A;  4CE7 A;  2A73 B;  1SA5 B;  3S9V A;  3QDE A;  4J5T A;  1WU4 A;  3SDT A;  3H7L A;  4LIX A;  4ONT A;  2WYN A;  1DCE B;  3W7S A;  1V7V A;  1DL2 A;  5AGD A;  3VW5 A;  5FO7 B;  3HXC B;  3QT3 A;  1V5D A;  1NC5 A;  3CIH A;  3OXU A;  3PYA A;  3PZ4 B;  4KKJ A;  2FV1 A;  3WIQ A;  4C1S A;  1KWF A;  2QNO A;  5M7Y A;  5DGQ A;  3RJ3 A;  1V7W A;  3WUX A;  1H37 A;  1G6I A;  1H3A A;  3M72 A;  5GZK A;  4Z4L A;  3CU7 A;  3E33 B;  3M7B A;  3Q7A B;  1S63 B;  3DSU B;  1FCE A;  4GL3 A;  1QQF A;  4EL8 A;  2GZ6 A;  3E30 B;  3RRS A;  1CLC A;  2V8K A;  1CEM A;  3M7C A;  3WC3 A;  5GY3 A;  1NI1 B;  4QT9 A;  3HXB B;  2WII B;  3WKG A;  3QFY A;  4WVA A;  2ZIS B;  3EUV B;  1FAE A;  3PMM A;  1C3D A;  1IA7 A;  1NL4 B;  4AYP A;  4GTR B;  1V5C A;  2XWJ B;  3Q79 B;  3G6J B;  2Z07 A;  2VN7 A;  3SFX B;  4D4A A;  3K7X A;  2A8Z A;  4ZH1 A;  3AFJ A;  4M76 A;  1O6Q A;  1G9G A;  1FPP B;  4YCR A;  4MU9 A;  1JCR B;  3SFY B;  1H35 A;  2FV0 A;  1GXN A;  3DSS B;  1LF6 A;  4AYQ A;  1FBO A;  3E37 B;  2BB6 A;  3DSV B;  1GAH A;  3GLY A;  1TNO B;  2G02 A;  3W7W A;  3P2C A;  1N4P B;  4GTQ B;  2RI8 A;  5DGR A;  1GSZ A;  4WU0 A;  3WIR A;  2V3P A;  5CD2 A;  3W5M A;  2WY8 A;  2BB5 A;  2F0Y B;  1X9D A;  5FO9 B;  1KRF A;  1O1R B;  3W5N A;  2AHF A;  3QFZ A;  4FXK B;  4V1S A;  5FO8 B;  3QSP A;  1TN8 B;  3SDQ A;  5JPM B;  4CJ0 A;  5E2J A;  3D5S A;  2FUZ A;  2P0V A;  5CZL A;  4LNB B;  1N94 B;  4XUV A;  4LNV A;  2H6I B;  2V8J A;  5FOB B;  3HXF B;  3W7T A;  3E6U A;  3WIW A;  5MEH A;  2RGK A;  4V1R A;  2OKX A;  3SQC A;  3M73 A;  3M7L A;  4GTO B;  2XFG A;  3H2W A;  4LNG B;  1QSJ A;  4L6X A;  3REN A;  1W6J A;  3E34 B;  1S64 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...