4GTSB

Engineered rabggtase in complex with bms analogue 16
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 118
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4gtsB00
4BOJA 1JCSB 4YDEB 1TN8B 4KKIA 1NL4B 2R2LB 3D5RA 3DSSB 2F0YB 1QSJA 1FT1B 5FO7B 2H6GB 2H6HB 1H3CA 1O1SB 1O6HA 1N95B 1SQCA 4D4BA 3E37B 1FPPB 3HXEB 3Q78B 3D5SA 2ZIRB 4LNVA 2WIIB 3CU7A 1H39A 1DCEB 4L9PB 1W6JA 3Q7AB 1MZCB 1S64B 1O1TB 4KKJA 1W6KA 1H35A 4ZRQA 2WINB 4D4AA 3SQCA 2V8JA 4M76A 2A73B 2BB5A 3DSVB 4D4CA 4LNBB 1O5MB 3DPYB 4YDOB 3KQ4A 1QQFA 2V3PA 2PMVA 2BB6A 3Q7FB 4C1SA 1KZPB 1TNBB 1N4QB 2BEDB 2I07B 3E33B 3KSQB 1N9AB 3E34B 3SFXB 4V1SA 4D94A 3HXCB 1TNOB 2V8KA 4ZRPA 1FT2B 3C72B 2G0DA 3HXDB 1TN7B 4GTTB 1UMPA 1O6QA 1SA4B 3E30B 1JCRB 1TNUB 2H6IB 2WY7A 4FXGB 4BOKA 3RJ3A 1N94B 2XQWA 1H36A 1TNYB 1O6RA 3G6JB 4MBGB 5JPNB 2V8IA 1D8DB 3DSXB 2WY8A 1SA5B 1KZOB 4MU9A 2PN5A 3OEDA 5FOBB 2BBCA 3EU5B 4GTQB 1NI1B 5FO8B 3Q73B 4GTPB 3DSTB 1QBQB 2SQCA 2NOJA 1TN6B 2XWBB 4V1RA 3E32B 3K7XA 5AGDA 4D4DA 3PZ1B 5FO9B 3HXBB 1O1RB 4EHMB 2ZISB 2IEJB 4GTMB 4LNGB 3KLSA 4ONTA 1O79A 1C3DA 2GOXA 2V3NA 1TNZB 1LTXB 3KSLB 2B39A 1H3BA 2H6FB 2XWJB 3SFYB 1GXOA 3HXFB 5JPMB 1JCQB 1X81B 3OXUA 1GXMA 1N4RB 3DSUB 4ZH1A 3Q79B 1N4PB 1H3AA 3PZ4B 4GTSB 1GHQA 1H37A 1N4SB 1LD8B 3DSWB 4FXKB 1GSZA 3DRAB 3Q75B 4GTRB 3PZ3B 1HZFA 3PZ2B 1D8EB 1LD7B 1R76A 1S63B 3EUVB 4GTOB 4GTVB 2G02A 1GXNA
chains in the Genus database with same CATH superfamily
4EL8A 4BOJA 1LXKA 1KWFA 3QFYA 3E6UA 5IK0A 1F9OA 2DRSA 1FT1B 2H6HB 1OJOA 1O6HA 4OZVA 2P0VA 1FPPB 3WIRA 3M7CA 4LNVA 1WU4A 3SDQA 1XWTA 1G9JA 2RGKA 4L9PB 3Q7AB 1MZCB 1ULVA 1H35A 4L6XA 1AYXA 4D4CA 4NEIA 3W7TA 3KQ4A 2V3PA 2BB6A 3E34B 4V1SA 5E2JA 2JF4A 2DRRA 1X1HA 1KSDA 1X1IA 3QWTA 3P2CA 3M73A 1UMPA 1OJMA 1O6QA 1SA4B 3E30B 2H6IB 4FXGB 3A0OA 3RJ3A 1N94B 4J5TA 3E73A 5DHKA 4AYQA 3G6JB 2OKXA 5JPNB 3S9VA 2FV1A 3ANIA 3DSXB 3M74A 1SA5B 1KZOB 4WVAA 2VN4A 3NNBA 1HN0A 2PN5A 3OEDA 1V5CA 2D5JA 5FOBB 3EU5B 3Q73B 4GTPB 1FO3A 3VSNA 5ILHA 1QBQB 5IKHA 5IKAA 2NOJA 1TN6B 3M72A 2XWBB 4V1RA 3K7XA 3SDRA 5FO9B 3HXBB 5ILIA 2IEJB 5EATA 4LNGB 3S4CA 1C3DA 2D8LA 2WDAA 2QNOA 3PMMA 2V3NA 4FJQA 3SDVA 3KSLB 3NFVA 2B39A 1FO2A 3ACTA 1G9GA 2Z07A 5ILJA 3M7EA 4FNVA 4ZH1A 1N4PB 1H3AA 3M01A 1RW9A 1GHQA 1LD8B 3DSWB 4FXKB 2E22A 1GSZA 1H14A 4GTRB 1C82A 1LD7B 1N7PA 1R76A 1GXNA 1IA7A 3QG0A 2RI9A 1W3YA 4KKIA 1NL4B 2R2LB 2WYNA 3D5RA 2F0YB 1QSJA 4CJ1A 1N1ZA 1O1SB 1RWAA 2EACA 3A3VA 4D4BA 5ILZA 3RSYA 3HXEB 2ZIRB 3CU7A 4OZWA 1RQ5A 3W7XA 2FV0A 4ZRQA 4CE7A 1K72A 5EASA 2V8JA 2BRPA 1UT9A 4LNBB 2RI8A 3M77A 3DPYB 1DL2A 2PMVA 3N0GA 5M7IA 1N22A 5DHIA 3E33B 3K11A 1H13A 1N9AB 4D94A 1OJPA 4GAXA 1HX9A 1FT2B 3C72B 3W7WA 2FUTA 4OJZA 1HM3A 3HXDB 1KSCA 3RX7A 4FUSA 1RWCA 5IL3A 2XFGA 1FBOA 1JCRB 2AHGA 2WY7A 1GAIA 4BOKA 1TF4A 4WVBA 2EABA 1G87A 1O6RA 3AFJA 4Q88A 2JJBA 1KREA 1D8DB 1WU5A 4RNQA 4MU9A 4Q2BA 1VD5A 1IA6A 3W5MA 1NI1B 5FO8B 3M02A 2ZBLA 1FAEA 4DI5A 3TF4A 3E32B 4D4DA 5AGDA 3WIWA 3KLSA 4ONTA 4F10A 2BRVX 1N24A 1O79A 3QRYA 1CB8A 2AHFA 1UG9A 4ZH5A 5ILYA 4LIXA 3S4DA 5CZLA 3W5NA 1H3BA 2JG0A 1N23A 3SFYB 3HXFB 5JPMB 1HV6A 1J0MA 1X81B 5KKBA 1GXMA 1G6IA 1LXMA 5C05A 1N4SB 1H37A 4TF4A 1HZFA 3PZ2B 1V7WA 1H54A 3P5RA 3WKHA 1JCSB 3H3KA 5MEHA 1TN8B 1LOHA 5ILKA 1DOGA 5EAUA 1HM2A 1N7OA 2H6GB 3QT9A 1H3CA 1SQCA 1V5DA 3E37B 3WC3A 2ZZRA 1XW2A 1QAZA 1F9DA 3QPFA 2DROA 1GA2A 4QT9A 1DCEB 3M7LA 3RX5A 1JS4A 5JMFA 1AGMA 1O1TB 1NC5A 1W6KA 4KKJA 3W7SA 4D4AA 1FBWA 3SQCA 3E80A 3CIHA 2BB5A 4M76A 4L0GA 5CD2A 4AYPA 1O5MB 4AYOA 3Q7FB 3WKIA 1CEMA 1FCEA 1KKTA 1TNBB 1XWQA 1N4QB 3GZKA 4ZG8A 3QFZA 3SFXB 2V8KA 4JJJA 4ZRPA 1RWFA 1KS8A 4GTTB 1I8QA 1TNUB 1OJNA 2X03A 5JMDA 2F6DA 2XQWA 1N1BA 1GLMA 3PYBA 2V8IA 3SDUA 4YCRA 1NXCA 1N20A 3WIQA 4XUVA 1IS9A 3ANKA 1N7QA 4GTQB 3DSTB 1GAHA 1V7XA 1LF9A 1WZZA 2ONGA 1FP3A 3S4AA 1N7NA 2Q1FA 3ANJA 4GTMB 3WKFA 2E24A 1TNZB 1X1JA 1V7VA 3RENA 3WUXA 2H6FB 5M7YA 3EQAA 1GXOA 4TXTA 3RRSA 5GY3A 2EAEA 3OXUA 1N4RB 3DSUB 2B4FA 3QT3A 1J0NA 3Q79B 3PZ4B 4GTSB 4Z4JA 3M75A 3VSMA 2AFAA 5IK9A 1EGUA 3AFLA 3PZ3B 4KTPA 4MMIA 4WU0A 3S4BA 2EADA 4MMHA 1S63B 3EUVB 4GTOB 1H12A 3EU8A 3GT5A 3DRAB 2G02A 1F1SA 4YDEB 3PYAA 3QDEA 3DSSB 3M71A 5ILDA 5FO7B 2NVPA 1N95B 1KRFA 3D3IA 2YIKA 5IM1A 3Q78B 1N7RA 3QXFA 3D5SA 2WIIB 4CJ0A 2ONHA 1H39A 1W6JA 1S64B 2WINB 1HCUA 2A73B 3DSVB 3X17A 5DGRA 3G4FA 1HMUA 4E1YA 4YDOB 1QQFA 3P5PA 3SDTA 4OK4A 4C1SA 1KZPB 2DRQA 5IK6A 3T33A 4DODA 4WVCA 1HXCA 2BEDB 2I07B 1L2AA 3H2WA 1HXGA 3KSQB 4OK2A 3HXCB 1TNOB 1X9DA 2CQTA 1HXAA 2G0DA 3G4DA 5GZKA 2CQSA 1HMWA 1TN7B 4AYRA 2BRWA 3WKGA 1H36A 1CLCA 1TNYB 1LF6A 3VXDA 5CA3A 3M7BA 4MBGB 2A8ZA 3E7JA 2WY8A 2GH4A 3M00A 2FUZA 2J5CA 2WCOA 3GLYA 2GZ6A 2BBCA 5IL8A 2SQCA 1WU6A 3SAEA 3M76A 3PZ1B 3M78A 3RX8A 1O1RB 4EHMB 2ZISB 4Z4LA 3N0FA 5DGQA 3W7UA 2GOXA 1FMIA 2VN7A 3ON6A 4DOEA 3LZ9A 1LTXB 1N21A 1L1YA 5GW7A 2XWJB 3H7LA 2FBAA 3QXQA 1JCQB 1RWGA 3ACSA 3EZ8A 4F13A 4KTRA 1RWHA 3QSPA 4GL3A 1F9GA 3Q75B 2FUQA 1KFGA 1D8EB 4GTVB 3VW5A
chains in the Genus database with same CATH topology
4EL8A 4BOJA 1KWFA 3QFYA 3E6UA 1F9OA 2DRSA 1FT1B 2H6HB 1O6HA 2P0VA 1FPPB 3WIRA 3M7CA 4LNVA 1WU4A 3SDQA 1XWTA 1G9JA 2RGKA 4L9PB 3Q7AB 1MZCB 1ULVA 1H35A 4L6XA 1AYXA 4D4CA 3W7TA 3KQ4A 2V3PA 2BB6A 3E34B 4V1SA 5E2JA 2JF4A 2DRRA 1KSDA 3QWTA 3P2CA 3M73A 1UMPA 1O6QA 1SA4B 3E30B 2H6IB 4FXGB 3RJ3A 1N94B 4J5TA 3E73A 4AYQA 3G6JB 2OKXA 5JPNB 3S9VA 2FV1A 3ANIA 3DSXB 3M74A 1SA5B 1KZOB 4WVAA 2VN4A 2PN5A 3OEDA 1V5CA 2D5JA 5FOBB 3EU5B 3Q73B 4GTPB 1FO3A 1QBQB 2NOJA 1TN6B 3M72A 2XWBB 4V1RA 3K7XA 3SDRA 5FO9B 3HXBB 2IEJB 3S4CA 4LNGB 1C3DA 2D8LA 2QNOA 3PMMA 2V3NA 3SDVA 3KSLB 2B39A 1FO2A 3ACTA 1G9GA 2Z07A 3M7EA 4ZH1A 1N4PB 1H3AA 1GHQA 1LD8B 3DSWB 4FXKB 1GSZA 1H14A 4GTRB 1LD7B 1R76A 1GXNA 1IA7A 3QG0A 2RI9A 4KKIA 1NL4B 2R2LB 2WYNA 3D5RA 2F0YB 1QSJA 4CJ1A 1O1SB 2EACA 3A3VA 4D4BA 3RSYA 3HXEB 2ZIRB 3CU7A 1RQ5A 3W7XA 2FV0A 4ZRQA 4CE7A 1K72A 2V8JA 1UT9A 4LNBB 2RI8A 3M77A 3DPYB 1DL2A 2PMVA 5M7IA 3E33B 3K11A 1H13A 1N9AB 4D94A 1FT2B 3C72B 3W7WA 3HXDB 1KSCA 3RX7A 4FUSA 2XFGA 1FBOA 1JCRB 2AHGA 2WY7A 1GAIA 4BOKA 1TF4A 4WVBA 2EABA 1G87A 1O6RA 3AFJA 4Q88A 2JJBA 1KREA 1D8DB 1WU5A 4MU9A 4Q2BA 1VD5A 1IA6A 3W5MA 1NI1B 5FO8B 2ZBLA 1FAEA 3TF4A 3E32B 4D4DA 5AGDA 3WIWA 3KLSA 4ONTA 1O79A 3QRYA 2AHFA 1UG9A 4ZH5A 4LIXA 3S4DA 5CZLA 3W5NA 1H3BA 2JG0A 3SFYB 3HXFB 5JPMB 1X81B 5KKBA 1GXMA 1G6IA 1N4SB 1H37A 4TF4A 1HZFA 3PZ2B 1V7WA 1H54A 3P5RA 3WKHA 1JCSB 3H3KA 5MEHA 1TN8B 1DOGA 2H6GB 3QT9A 1H3CA 1SQCA 1V5DA 3E37B 3WC3A 2ZZRA 1XW2A 1F9DA 3QPFA 2DROA 1GA2A 4QT9A 1DCEB 3M7LA 3RX5A 1JS4A 1AGMA 1O1TB 1NC5A 1W6KA 4KKJA 3W7SA 4D4AA 1FBWA 3SQCA 3CIHA 2BB5A 4M76A 4L0GA 5CD2A 4AYPA 1O5MB 4AYOA 3Q7FB 3WKIA 1CEMA 1FCEA 1KKTA 1TNBB 1XWQA 1N4QB 3GZKA 4ZG8A 3QFZA 3SFXB 2V8KA 4JJJA 4ZRPA 1KS8A 4GTTB 1TNUB 2F6DA 2XQWA 1GLMA 3PYBA 2V8IA 3SDUA 4YCRA 1NXCA 3WIQA 4XUVA 1IS9A 3ANKA 4GTQB 3DSTB 1GAHA 1V7XA 1LF9A 1WZZA 3S4AA 1FP3A 3ANJA 4GTMB 3WKFA 1TNZB 1V7VA 3RENA 3WUXA 2H6FB 5M7YA 3EQAA 1GXOA 4TXTA 3RRSA 5GY3A 2EAEA 3OXUA 1N4RB 3DSUB 2B4FA 3QT3A 3Q79B 3PZ4B 4GTSB 4Z4JA 3M75A 2AFAA 3PZ3B 4KTPA 4WU0A 3S4BA 2EADA 1S63B 3EUVB 4GTOB 1H12A 3EU8A 3GT5A 3DRAB 2G02A 4YDEB 3PYAA 3QDEA 3DSSB 3M71A 5FO7B 2NVPA 1N95B 1KRFA 3D3IA 2YIKA 3Q78B 3QXFA 3D5SA 2WIIB 4CJ0A 1H39A 1W6JA 1S64B 2WINB 1HCUA 2A73B 3DSVB 3X17A 5DGRA 4YDOB 1QQFA 3P5PA 3SDTA 4C1SA 1KZPB 2DRQA 3T33A 4DODA 4WVCA 2BEDB 2I07B 1L2AA 3H2WA 3KSQB 3HXCB 1TNOB 1X9DA 2CQTA 2G0DA 5GZKA 2CQSA 1TN7B 4AYRA 3WKGA 1H36A 1CLCA 1TNYB 1LF6A 3VXDA 5CA3A 3M7BA 4MBGB 2A8ZA 2WY8A 2GH4A 2FUZA 3GLYA 2GZ6A 2BBCA 2SQCA 1WU6A 3SAEA 3M76A 3PZ1B 3M78A 3RX8A 1O1RB 4EHMB 2ZISB 4Z4LA 5DGQA 3W7UA 2GOXA 1FMIA 2VN7A 3ON6A 4DOEA 1LTXB 1L1YA 5GW7A 2XWJB 3H7LA 2FBAA 3QXQA 1JCQB 3ACSA 3EZ8A 4KTRA 3QSPA 4GL3A 3Q75B 1KFGA 1D8EB 4GTVB 3VW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOJ A;  1JCS B;  4YDE B;  1TN8 B;  4KKI A;  1NL4 B;  2R2L B;  3D5R A;  3DSS B;  2F0Y B;  1QSJ A;  1FT1 B;  5FO7 B;  2H6G B;  2H6H B;  1H3C A;  1O1S B;  1O6H A;  1N95 B;  1SQC A;  4D4B A;  3E37 B;  1FPP B;  3HXE B;  3Q78 B;  3D5S A;  2ZIR B;  4LNV A;  2WII B;  3CU7 A;  1H39 A;  1DCE B;  4L9P B;  1W6J A;  3Q7A B;  1MZC B;  1S64 B;  1O1T B;  4KKJ A;  1W6K A;  1H35 A;  4ZRQ A;  2WIN B;  4D4A A;  3SQC A;  2V8J A;  4M76 A;  2A73 B;  2BB5 A;  3DSV B;  4D4C A;  4LNB B;  1O5M B;  3DPY B;  4YDO B;  3KQ4 A;  1QQF A;  2V3P A;  2PMV A;  2BB6 A;  3Q7F B;  4C1S A;  1KZP B;  1TNB B;  1N4Q B;  2BED B;  2I07 B;  3E33 B;  3KSQ B;  1N9A B;  3E34 B;  3SFX B;  4V1S A;  4D94 A;  3HXC B;  1TNO B;  2V8K A;  4ZRP A;  1FT2 B;  3C72 B;  2G0D A;  3HXD B;  1TN7 B;  4GTT B;  1UMP A;  1O6Q A;  1SA4 B;  3E30 B;  1JCR B;  1TNU B;  2H6I B;  2WY7 A;  4FXG B;  4BOK A;  3RJ3 A;  1N94 B;  2XQW A;  1H36 A;  1TNY B;  1O6R A;  3G6J B;  4MBG B;  5JPN B;  2V8I A;  1D8D B;  3DSX B;  2WY8 A;  1SA5 B;  1KZO B;  4MU9 A;  2PN5 A;  3OED A;  5FOB B;  2BBC A;  3EU5 B;  4GTQ B;  1NI1 B;  5FO8 B;  3Q73 B;  4GTP B;  3DST B;  1QBQ B;  2SQC A;  2NOJ A;  1TN6 B;  2XWB B;  4V1R A;  3E32 B;  3K7X A;  5AGD A;  4D4D A;  3PZ1 B;  5FO9 B;  3HXB B;  1O1R B;  4EHM B;  2ZIS B;  2IEJ B;  4GTM B;  4LNG B;  3KLS A;  4ONT A;  1O79 A;  1C3D A;  2GOX A;  2V3N A;  1TNZ B;  1LTX B;  3KSL B;  2B39 A;  1H3B A;  2H6F B;  2XWJ B;  3SFY B;  1GXO A;  3HXF B;  5JPM B;  1JCQ B;  1X81 B;  3OXU A;  1GXM A;  1N4R B;  3DSU B;  4ZH1 A;  3Q79 B;  1N4P B;  1H3A A;  3PZ4 B;  4GTS B;  1GHQ A;  1H37 A;  1N4S B;  1LD8 B;  3DSW B;  4FXK B;  1GSZ A;  3DRA B;  3Q75 B;  4GTR B;  3PZ3 B;  1HZF A;  3PZ2 B;  1D8E B;  1LD7 B;  1R76 A;  1S63 B;  3EUV B;  4GTO B;  4GTV B;  2G02 A;  1GXN A; 
#chains in the Genus database with same CATH topology
 4EL8 A;  4BOJ A;  1LXK A;  1KWF A;  3QFY A;  3E6U A;  5IK0 A;  1F9O A;  2DRS A;  1FT1 B;  2H6H B;  1OJO A;  1O6H A;  4OZV A;  2P0V A;  1FPP B;  3WIR A;  3M7C A;  4LNV A;  1WU4 A;  3SDQ A;  1XWT A;  1G9J A;  2RGK A;  4L9P B;  3Q7A B;  1MZC B;  1ULV A;  1H35 A;  4L6X A;  1AYX A;  4D4C A;  4NEI A;  3W7T A;  3KQ4 A;  2V3P A;  2BB6 A;  3E34 B;  4V1S A;  5E2J A;  2JF4 A;  2DRR A;  1X1H A;  1KSD A;  1X1I A;  3QWT A;  3P2C A;  3M73 A;  1UMP A;  1OJM A;  1O6Q A;  1SA4 B;  3E30 B;  2H6I B;  4FXG B;  3A0O A;  3RJ3 A;  1N94 B;  4J5T A;  3E73 A;  5DHK A;  4AYQ A;  3G6J B;  2OKX A;  5JPN B;  3S9V A;  2FV1 A;  3ANI A;  3DSX B;  3M74 A;  1SA5 B;  1KZO B;  4WVA A;  2VN4 A;  3NNB A;  1HN0 A;  2PN5 A;  3OED A;  1V5C A;  2D5J A;  5FOB B;  3EU5 B;  3Q73 B;  4GTP B;  1FO3 A;  3VSN A;  5ILH A;  1QBQ B;  5IKH A;  5IKA A;  2NOJ A;  1TN6 B;  3M72 A;  2XWB B;  4V1R A;  3K7X A;  3SDR A;  5FO9 B;  3HXB B;  5ILI A;  2IEJ B;  5EAT A;  4LNG B;  3S4C A;  1C3D A;  2D8L A;  2WDA A;  2QNO A;  3PMM A;  2V3N A;  4FJQ A;  3SDV A;  3KSL B;  3NFV A;  2B39 A;  1FO2 A;  3ACT A;  1G9G A;  2Z07 A;  5ILJ A;  3M7E A;  4FNV A;  4ZH1 A;  1N4P B;  1H3A A;  3M01 A;  1RW9 A;  1GHQ A;  1LD8 B;  3DSW B;  4FXK B;  2E22 A;  1GSZ A;  1H14 A;  4GTR B;  1C82 A;  1LD7 B;  1N7P A;  1R76 A;  1GXN A;  1IA7 A;  3QG0 A;  2RI9 A;  1W3Y A;  4KKI A;  1NL4 B;  2R2L B;  2WYN A;  3D5R A;  2F0Y B;  1QSJ A;  4CJ1 A;  1N1Z A;  1O1S B;  1RWA A;  2EAC A;  3A3V A;  4D4B A;  5ILZ A;  3RSY A;  3HXE B;  2ZIR B;  3CU7 A;  4OZW A;  1RQ5 A;  3W7X A;  2FV0 A;  4ZRQ A;  4CE7 A;  1K72 A;  5EAS A;  2V8J A;  2BRP A;  1UT9 A;  4LNB B;  2RI8 A;  3M77 A;  3DPY B;  1DL2 A;  2PMV A;  3N0G A;  5M7I A;  1N22 A;  5DHI A;  3E33 B;  3K11 A;  1H13 A;  1N9A B;  4D94 A;  1OJP A;  4GAX A;  1HX9 A;  1FT2 B;  3C72 B;  3W7W A;  2FUT A;  4OJZ A;  1HM3 A;  3HXD B;  1KSC A;  3RX7 A;  4FUS A;  1RWC A;  5IL3 A;  2XFG A;  1FBO A;  1JCR B;  2AHG A;  2WY7 A;  1GAI A;  4BOK A;  1TF4 A;  4WVB A;  2EAB A;  1G87 A;  1O6R A;  3AFJ A;  4Q88 A;  2JJB A;  1KRE A;  1D8D B;  1WU5 A;  4RNQ A;  4MU9 A;  4Q2B A;  1VD5 A;  1IA6 A;  3W5M A;  1NI1 B;  5FO8 B;  3M02 A;  2ZBL A;  1FAE A;  4DI5 A;  3TF4 A;  3E32 B;  4D4D A;  5AGD A;  3WIW A;  3KLS A;  4ONT A;  4F10 A;  2BRV X;  1N24 A;  1O79 A;  3QRY A;  1CB8 A;  2AHF A;  1UG9 A;  4ZH5 A;  5ILY A;  4LIX A;  3S4D A;  5CZL A;  3W5N A;  1H3B A;  2JG0 A;  1N23 A;  3SFY B;  3HXF B;  5JPM B;  1HV6 A;  1J0M A;  1X81 B;  5KKB A;  1GXM A;  1G6I A;  1LXM A;  5C05 A;  1N4S B;  1H37 A;  4TF4 A;  1HZF A;  3PZ2 B;  1V7W A;  1H54 A;  3P5R A;  3WKH A;  1JCS B;  3H3K A;  5MEH A;  1TN8 B;  1LOH A;  5ILK A;  1DOG A;  5EAU A;  1HM2 A;  1N7O A;  2H6G B;  3QT9 A;  1H3C A;  1SQC A;  1V5D A;  3E37 B;  3WC3 A;  2ZZR A;  1XW2 A;  1QAZ A;  1F9D A;  3QPF A;  2DRO A;  1GA2 A;  4QT9 A;  1DCE B;  3M7L A;  3RX5 A;  1JS4 A;  5JMF A;  1AGM A;  1O1T B;  1NC5 A;  1W6K A;  4KKJ A;  3W7S A;  4D4A A;  1FBW A;  3SQC A;  3E80 A;  3CIH A;  2BB5 A;  4M76 A;  4L0G A;  5CD2 A;  4AYP A;  1O5M B;  4AYO A;  3Q7F B;  3WKI A;  1CEM A;  1FCE A;  1KKT A;  1TNB B;  1XWQ A;  1N4Q B;  3GZK A;  4ZG8 A;  3QFZ A;  3SFX B;  2V8K A;  4JJJ A;  4ZRP A;  1RWF A;  1KS8 A;  4GTT B;  1I8Q A;  1TNU B;  1OJN A;  2X03 A;  5JMD A;  2F6D A;  2XQW A;  1N1B A;  1GLM A;  3PYB A;  2V8I A;  3SDU A;  4YCR A;  1NXC A;  1N20 A;  3WIQ A;  4XUV A;  1IS9 A;  3ANK A;  1N7Q A;  4GTQ B;  3DST B;  1GAH A;  1V7X A;  1LF9 A;  1WZZ A;  2ONG A;  1FP3 A;  3S4A A;  1N7N A;  2Q1F A;  3ANJ A;  4GTM B;  3WKF A;  2E24 A;  1TNZ B;  1X1J A;  1V7V A;  3REN A;  3WUX A;  2H6F B;  5M7Y A;  3EQA A;  1GXO A;  4TXT A;  3RRS A;  5GY3 A;  2EAE A;  3OXU A;  1N4R B;  3DSU B;  2B4F A;  3QT3 A;  1J0N A;  3Q79 B;  3PZ4 B;  4GTS B;  4Z4J A;  3M75 A;  3VSM A;  2AFA A;  5IK9 A;  1EGU A;  3AFL A;  3PZ3 B;  4KTP A;  4MMI A;  4WU0 A;  3S4B A;  2EAD A;  4MMH A;  1S63 B;  3EUV B;  4GTO B;  1H12 A;  3EU8 A;  3GT5 A;  3DRA B;  2G02 A;  1F1S A;  4YDE B;  3PYA A;  3QDE A;  3DSS B;  3M71 A;  5ILD A;  5FO7 B;  2NVP A;  1N95 B;  1KRF A;  3D3I A;  2YIK A;  5IM1 A;  3Q78 B;  1N7R A;  3QXF A;  3D5S A;  2WII B;  4CJ0 A;  2ONH A;  1H39 A;  1W6J A;  1S64 B;  2WIN B;  1HCU A;  2A73 B;  3DSV B;  3X17 A;  5DGR A;  3G4F A;  1HMU A;  4E1Y A;  4YDO B;  1QQF A;  3P5P A;  3SDT A;  4OK4 A;  4C1S A;  1KZP B;  2DRQ A;  5IK6 A;  3T33 A;  4DOD A;  4WVC A;  1HXC A;  2BED B;  2I07 B;  1L2A A;  3H2W A;  1HXG A;  3KSQ B;  4OK2 A;  3HXC B;  1TNO B;  1X9D A;  2CQT A;  1HXA A;  2G0D A;  3G4D A;  5GZK A;  2CQS A;  1HMW A;  1TN7 B;  4AYR A;  2BRW A;  3WKG A;  1H36 A;  1CLC A;  1TNY B;  1LF6 A;  3VXD A;  5CA3 A;  3M7B A;  4MBG B;  2A8Z A;  3E7J A;  2WY8 A;  2GH4 A;  3M00 A;  2FUZ A;  2J5C A;  2WCO A;  3GLY A;  2GZ6 A;  2BBC A;  5IL8 A;  2SQC A;  1WU6 A;  3SAE A;  3M76 A;  3PZ1 B;  3M78 A;  3RX8 A;  1O1R B;  4EHM B;  2ZIS B;  4Z4L A;  3N0F A;  5DGQ A;  3W7U A;  2GOX A;  1FMI A;  2VN7 A;  3ON6 A;  4DOE A;  3LZ9 A;  1LTX B;  1N21 A;  1L1Y A;  5GW7 A;  2XWJ B;  3H7L A;  2FBA A;  3QXQ A;  1JCQ B;  1RWG A;  3ACS A;  3EZ8 A;  4F13 A;  4KTR A;  1RWH A;  3QSP A;  4GL3 A;  1F9G A;  3Q75 B;  2FUQ A;  1KFG A;  1D8E B;  4GTV B;  3VW5 A; 
#chains in the Genus database with same CATH homology
 4EL8 A;  4BOJ A;  1KWF A;  3QFY A;  3E6U A;  1F9O A;  2DRS A;  1FT1 B;  2H6H B;  1O6H A;  2P0V A;  1FPP B;  3WIR A;  3M7C A;  4LNV A;  1WU4 A;  3SDQ A;  1XWT A;  1G9J A;  2RGK A;  4L9P B;  3Q7A B;  1MZC B;  1ULV A;  1H35 A;  4L6X A;  1AYX A;  4D4C A;  3W7T A;  3KQ4 A;  2V3P A;  2BB6 A;  3E34 B;  4V1S A;  5E2J A;  2JF4 A;  2DRR A;  1KSD A;  3QWT A;  3P2C A;  3M73 A;  1UMP A;  1O6Q A;  1SA4 B;  3E30 B;  2H6I B;  4FXG B;  3RJ3 A;  1N94 B;  4J5T A;  3E73 A;  4AYQ A;  3G6J B;  2OKX A;  5JPN B;  3S9V A;  2FV1 A;  3ANI A;  3DSX B;  3M74 A;  1SA5 B;  1KZO B;  4WVA A;  2VN4 A;  2PN5 A;  3OED A;  1V5C A;  2D5J A;  5FOB B;  3EU5 B;  3Q73 B;  4GTP B;  1FO3 A;  1QBQ B;  2NOJ A;  1TN6 B;  3M72 A;  2XWB B;  4V1R A;  3K7X A;  3SDR A;  5FO9 B;  3HXB B;  2IEJ B;  3S4C A;  4LNG B;  1C3D A;  2D8L A;  2QNO A;  3PMM A;  2V3N A;  3SDV A;  3KSL B;  2B39 A;  1FO2 A;  3ACT A;  1G9G A;  2Z07 A;  3M7E A;  4ZH1 A;  1N4P B;  1H3A A;  1GHQ A;  1LD8 B;  3DSW B;  4FXK B;  1GSZ A;  1H14 A;  4GTR B;  1LD7 B;  1R76 A;  1GXN A;  1IA7 A;  3QG0 A;  2RI9 A;  4KKI A;  1NL4 B;  2R2L B;  2WYN A;  3D5R A;  2F0Y B;  1QSJ A;  4CJ1 A;  1O1S B;  2EAC A;  3A3V A;  4D4B A;  3RSY A;  3HXE B;  2ZIR B;  3CU7 A;  1RQ5 A;  3W7X A;  2FV0 A;  4ZRQ A;  4CE7 A;  1K72 A;  2V8J A;  1UT9 A;  4LNB B;  2RI8 A;  3M77 A;  3DPY B;  1DL2 A;  2PMV A;  5M7I A;  3E33 B;  3K11 A;  1H13 A;  1N9A B;  4D94 A;  1FT2 B;  3C72 B;  3W7W A;  3HXD B;  1KSC A;  3RX7 A;  4FUS A;  2XFG A;  1FBO A;  1JCR B;  2AHG A;  2WY7 A;  1GAI A;  4BOK A;  1TF4 A;  4WVB A;  2EAB A;  1G87 A;  1O6R A;  3AFJ A;  4Q88 A;  2JJB A;  1KRE A;  1D8D B;  1WU5 A;  4MU9 A;  4Q2B A;  1VD5 A;  1IA6 A;  3W5M A;  1NI1 B;  5FO8 B;  2ZBL A;  1FAE A;  3TF4 A;  3E32 B;  4D4D A;  5AGD A;  3WIW A;  3KLS A;  4ONT A;  1O79 A;  3QRY A;  2AHF A;  1UG9 A;  4ZH5 A;  4LIX A;  3S4D A;  5CZL A;  3W5N A;  1H3B A;  2JG0 A;  3SFY B;  3HXF B;  5JPM B;  1X81 B;  5KKB A;  1GXM A;  1G6I A;  1N4S B;  1H37 A;  4TF4 A;  1HZF A;  3PZ2 B;  1V7W A;  1H54 A;  3P5R A;  3WKH A;  1JCS B;  3H3K A;  5MEH A;  1TN8 B;  1DOG A;  2H6G B;  3QT9 A;  1H3C A;  1SQC A;  1V5D A;  3E37 B;  3WC3 A;  2ZZR A;  1XW2 A;  1F9D A;  3QPF A;  2DRO A;  1GA2 A;  4QT9 A;  1DCE B;  3M7L A;  3RX5 A;  1JS4 A;  1AGM A;  1O1T B;  1NC5 A;  1W6K A;  4KKJ A;  3W7S A;  4D4A A;  1FBW A;  3SQC A;  3CIH A;  2BB5 A;  4M76 A;  4L0G A;  5CD2 A;  4AYP A;  1O5M B;  4AYO A;  3Q7F B;  3WKI A;  1CEM A;  1FCE A;  1KKT A;  1TNB B;  1XWQ A;  1N4Q B;  3GZK A;  4ZG8 A;  3QFZ A;  3SFX B;  2V8K A;  4JJJ A;  4ZRP A;  1KS8 A;  4GTT B;  1TNU B;  2F6D A;  2XQW A;  1GLM A;  3PYB A;  2V8I A;  3SDU A;  4YCR A;  1NXC A;  3WIQ A;  4XUV A;  1IS9 A;  3ANK A;  4GTQ B;  3DST B;  1GAH A;  1V7X A;  1LF9 A;  1WZZ A;  3S4A A;  1FP3 A;  3ANJ A;  4GTM B;  3WKF A;  1TNZ B;  1V7V A;  3REN A;  3WUX A;  2H6F B;  5M7Y A;  3EQA A;  1GXO A;  4TXT A;  3RRS A;  5GY3 A;  2EAE A;  3OXU A;  1N4R B;  3DSU B;  2B4F A;  3QT3 A;  3Q79 B;  3PZ4 B;  4GTS B;  4Z4J A;  3M75 A;  2AFA A;  3PZ3 B;  4KTP A;  4WU0 A;  3S4B A;  2EAD A;  1S63 B;  3EUV B;  4GTO B;  1H12 A;  3EU8 A;  3GT5 A;  3DRA B;  2G02 A;  4YDE B;  3PYA A;  3QDE A;  3DSS B;  3M71 A;  5FO7 B;  2NVP A;  1N95 B;  1KRF A;  3D3I A;  2YIK A;  3Q78 B;  3QXF A;  3D5S A;  2WII B;  4CJ0 A;  1H39 A;  1W6J A;  1S64 B;  2WIN B;  1HCU A;  2A73 B;  3DSV B;  3X17 A;  5DGR A;  4YDO B;  1QQF A;  3P5P A;  3SDT A;  4C1S A;  1KZP B;  2DRQ A;  3T33 A;  4DOD A;  4WVC A;  2BED B;  2I07 B;  1L2A A;  3H2W A;  3KSQ B;  3HXC B;  1TNO B;  1X9D A;  2CQT A;  2G0D A;  5GZK A;  2CQS A;  1TN7 B;  4AYR A;  3WKG A;  1H36 A;  1CLC A;  1TNY B;  1LF6 A;  3VXD A;  5CA3 A;  3M7B A;  4MBG B;  2A8Z A;  2WY8 A;  2GH4 A;  2FUZ A;  3GLY A;  2GZ6 A;  2BBC A;  2SQC A;  1WU6 A;  3SAE A;  3M76 A;  3PZ1 B;  3M78 A;  3RX8 A;  1O1R B;  4EHM B;  2ZIS B;  4Z4L A;  5DGQ A;  3W7U A;  2GOX A;  1FMI A;  2VN7 A;  3ON6 A;  4DOE A;  1LTX B;  1L1Y A;  5GW7 A;  2XWJ B;  3H7L A;  2FBA A;  3QXQ A;  1JCQ B;  3ACS A;  3EZ8 A;  4KTR A;  3QSP A;  4GL3 A;  3Q75 B;  1KFG A;  1D8E B;  4GTV B;  3VW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...