1QAZA

Crystal structure of alginate lyase a1-iii from sphingomonas species a1 at 1.78a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
351
structure length
351
Chain Sequence
GSHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNHSYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHYQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords PROTEIN (ALGINATE LYASE A1-III)
publication title Crystal structure of alginate lyase A1-III from Sphingomonas species A1 at 1.78 A resolution.
pubmed doi rcsb
source organism Sphingomonas sp.
total genus 135
structure length 351
sequence length 351
ec nomenclature ec 3.5.1.45: Transferred entry: 6.3.4.6.
pdb deposition date 1999-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 1qazA00
1I8QA 1CB8A 1HV6A 4MMHA 2WCOA 2E24A 4OK2A 1HM3A 2X03A 4F10A 1HMWA 1RWHA 1EGUA 1OJOA 1N7NA 2FUTA 2FUQA 1N7OA 4OZVA 1X1HA 1LXMA 1F1SA 1RWAA 3E7JA 1LXKA 3VSMA 2BRPA 1C82A 1RWFA 2BRVX 2Q1FA 2BRWA 3NNBA 1OJNA 1J0NA 4MMIA 1RWCA 2WDAA 3E80A 1RW9A 3VSNA 5JMDA 4OZWA 1QAZA 4NEIA 3AFLA 1F9GA 1RWGA 4FNVA 1J0MA 1N7RA 1OJMA 1W3YA 4OJZA 2E22A 3A0OA 4OK4A 5JMFA 1N7QA 4E1YA 1X1IA 1HN0A 1HM2A 1HMUA 1OJPA 4F13A 1LOHA 1N7PA 1X1JA 3NFVA
chains in the Genus database with same CATH superfamily
1GXOA 3DSXB 3W7SA 4DI5A 4ZG8A 2A73B 2V3PA 1V5CA 1H13A 1WU4A 2FV0A 2EADA 2H6GB 2BEDB 5IKHA 2GZ6A 1H37A 4ZRQA 5DGQA 1K72A 4GTTB 3M01A 4V1RA 1OJMA 1H54A 3A0OA 1TNYB 4FJQA 5IK6A 3E34B 2PMVA 2JG0A 3QRYA 1GSZA 1VD5A 4F10A 5FO8B 1TN8B 2F0YB 1RWHA 3DSVB 1XW2A 1H36A 1KZPB 4L0GA 3M74A 3PZ2B 3M02A 2AHGA 2ZISB 3QXQA 4CJ0A 3M73A 1TN7B 3M78A 2J5CA 3EQAA 3P5PA 3E37B 4MMIA 1XWTA 1H3AA 1N4QB 4FNVA 2YIKA 3WC3A 5JMFA 3ANIA 4OJZA 3M00A 5DHIA 3VW5A 1X1JA 3AFJA 5IM1A 3N0FA 1N4PB 4OK2A 2ZBLA 4AYPA 3W7WA 1N4SB 1NC5A 2FUQA 4OZVA 4FXKB 5GW7A 3P2CA 1CEMA 3DSUB 4KKJA 2RGKA 1N1ZA 1TNBB 2BB6A 3OEDA 3KSLB 4EL8A 1RW9A 5JMDA 5MEHA 1FT2B 1NXCA 3Q7FB 4AYOA 2ONHA 3KQ4A 3S4CA 2XWBB 4TF4A 3W7UA 3T33A 3PYBA 1HM3A 1LTXB 4C1SA 5FOBB 4BOKA 4CE7A 1QBQB 1N7OA 4D4CA 1LXKA 4Z4JA 2A8ZA 2V8KA 4GTOB 4ZRPA 4GTSB 1RWGA 1TNZB 4GTVB 1FBOA 1FMIA 1LF9A 2RI8A 2E22A 3RX7A 1MZCB 1FT1B 1O6RA 4D4DA 1W6KA 3QT9A 3Q7AB 3ON6A 3SFXB 1LOHA 1GLMA 2JF4A 4WVBA 3WIWA 5CD2A 1HXAA 1X81B 1EGUA 1KS8A 2FUTA 1HCUA 4AYQA 1GXMA 3M7LA 1GXNA 1WU5A 3TF4A 3W7TA 3QWTA 4GTPB 1V5DA 1TF4A 3H3KA 4OZWA 3HXBB 4GTMB 4D94A 4E1YA 5IL3A 3NFVA 4WVCA 2X03A 4AYRA 1IA7A 1XWQA 5FO7B 4ZH1A 3RX5A 5ILJA 1C82A 4LIXA 3M75A 3SDQA 4RNQA 3KSQB 3G6JB 2D5JA 3WKFA 2FV1A 5ILYA 2ZIRB 3M7EA 1C3DA 3QDEA 1AYXA 3SAEA 1NI1B 3ACSA 1I8QA 3EU5B 3WUXA 1LD8B 3M77A 2AFAA 1UG9A 1H3CA 3GLYA 1O1TB 3DRAB 1WZZA 5EATA 5IKAA 1LXMA 2EACA 3RSYA 4GAXA 2BBCA 1H12A 5IK9A 1O1SB 5ILDA 1W6JA 3C72B 3EUVB 3HXEB 2DRSA 3E73A 3QSPA 1LF6A 5ILHA 1AGMA 1O6QA 1KZOB 5GZKA 3K11A 5KKBA 4LNBB 1HMWA 2F6DA 2DRQA 2XWJB 4DODA 1KKTA 1OJOA 3D3IA 1FAEA 1F9OA 4ZH5A 2PN5A 1HX9A 4YCRA 1F9DA 1DOGA 2JJBA 1L2AA 3M71A 1JS4A 1KWFA 5IK0A 1JCQB 1FBWA 1O5MB 1X9DA 4GL3A 4F13A 2GOXA 4DOEA 2OKXA 5M7IA 2E24A 1N24A 3W7XA 3CIHA 1N7NA 3Q75B 3VSMA 4XUVA 3S9VA 2VN7A 5FO9B 1SA5B 3PYAA 2WINB 3H2WA 2WDAA 4FUSA 2DRRA 1HXCA 1JCSB 1W3YA 3HXDB 3QFZA 5DGRA 4L9PB 1N7QA 1HN0A 2GH4A 2I07B 1HMUA 2CQTA 5ILIA 1N22A 4GTQB 4MU9A 1CB8A 1O79A 2CQSA 2WCOA 5AGDA 4M76A 5C05A 1X1HA 1G9JA 3M76A 1V7WA 2XQWA 1UMPA 1RWFA 3E33B 2FUZA 3RX8A 4CJ1A 5JPMB 1N1BA 3QPFA 3Q79B 1RQ5A 1KSDA 3RENA 4NEIA 1F9GA 1FO2A 1SA4B 2P0VA 1N7RA 3G4FA 1JCRB 3WKIA 3X17A 1OJPA 3SFYB 1FPPB 3KLSA 4Z4LA 1D8DB 4JJJA 5CZLA 3QFYA 3WIQA 3P5RA 1F1SA 3E7JA 1O6HA 3W5MA 1FCEA 1KREA 2Q1FA 3RJ3A 2V3NA 3NNBA 3QG0A 2V8IA 2NOJA 3E30B 4LNGB 3VXDA 2AHFA 1NL4B 3DPYB 3ANJA 1S64B 1IA6A 1X1IA 1UT9A 3E32B 2VN4A 5M7YA 5JPNB 1H3BA 3Q78B 1KFGA 4MBGB 1O1RB 2WY8A 3SDUA 1GHQA 1RWAA 1DL2A 3WIRA 2B4FA 2DROA 1G9GA 1HXGA 2B39A 3GZKA 4KTRA 3CU7A 1FP3A 4FXGB 2H6HB 1G6IA 3E80A 3SDRA 1TN6B 3AFLA 4LNVA 1J0MA 2H6IB 3HXFB 4OK4A 1TNUB 3ACTA 5ILZA 1D8EB 5EASA 1TNOB 1GA2A 4KKIA 4YDEB 1N7PA 1HV6A 4MMHA 3QT3A 1H14A 4QT9A 1S63B 2ONGA 1LD7B 3PZ3B 3PZ1B 4YDOB 1J0NA 3M72A 1QAZA 3H7LA 3DSWB 2G0DA 3A3VA 2EABA 5E2JA 4ONTA 2FBAA 1KSCA 4BOJA 2G02A 2BB5A 1N20A 3GT5A 5IL8A 1R76A 1H35A 2XFGA 3M7BA 2V8JA 1N9AB 3EZ8A 2BRVX 1V7VA 4V1SA 1SQCA 2QNOA 2D8LA 5EAUA 3SDVA 4Q2BA 3W5NA 1V7XA 1WU6A 2ZZRA 2IEJB 4GTRB 3WKGA 5CA3A 1FO3A 4D4BA 1GAHA 4D4AA 5ILKA 3G4DA 3D5RA 1QSJA 5DHKA 4EHMB 2RI9A 3QXFA 2EAEA 3S4AA 2BRPA 1G87A 2BRWA 3SQCA 2WYNA 3N0GA 1RWCA 3PZ4B 4TXTA 3D5SA 3E6UA 3WKHA 3K7XA 3LZ9A 2WY7A 2Z07A 1HM2A 1DCEB 4J5TA 1N94B 4KTPA 3M7CA 1CLCA 3PMMA 1KRFA 2WIIB 4WU0A 4Q88A 2NVPA 3S4BA 1N95B 3OXUA 1OJNA 1QQFA 3HXCB 1N23A 3RRSA 1IS9A 3EU8A 1GAIA 3VSNA 4L6XA 1ULVA 3Q73B 3DSSB 3S4DA 1HZFA 2R2LB 1N4RB 1N21A 3SDTA 2SQCA 5GY3A 2H6FB 3ANKA 4WVAA 1H39A 1L1YA 3DSTB
chains in the Genus database with same CATH topology
1I8QA 1CB8A 1HV6A 4MMHA 2WCOA 2E24A 4OK2A 1HM3A 2X03A 4F10A 1HMWA 1RWHA 1EGUA 1OJOA 1N7NA 2FUTA 2FUQA 1N7OA 4OZVA 1X1HA 1LXMA 1F1SA 1RWAA 3E7JA 1LXKA 3VSMA 2BRPA 1C82A 1RWFA 2BRVX 2Q1FA 2BRWA 3NNBA 1OJNA 1J0NA 4MMIA 1RWCA 2WDAA 3E80A 1RW9A 3VSNA 5JMDA 4OZWA 1QAZA 4NEIA 3AFLA 1F9GA 1RWGA 4FNVA 1J0MA 1N7RA 1OJMA 1W3YA 4OJZA 2E22A 3A0OA 4OK4A 5JMFA 1N7QA 4E1YA 1X1IA 1HN0A 1HM2A 1HMUA 1OJPA 4F13A 1LOHA 1N7PA 1X1JA 3NFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8Q A;  1CB8 A;  1HV6 A;  4MMH A;  2WCO A;  2E24 A;  4OK2 A;  1HM3 A;  2X03 A;  4F10 A;  1HMW A;  1RWH A;  1EGU A;  1OJO A;  1N7N A;  2FUT A;  2FUQ A;  1N7O A;  4OZV A;  1X1H A;  1LXM A;  1F1S A;  1RWA A;  3E7J A;  1LXK A;  3VSM A;  2BRP A;  1C82 A;  1RWF A;  2BRV X;  2Q1F A;  2BRW A;  3NNB A;  1OJN A;  1J0N A;  4MMI A;  1RWC A;  2WDA A;  3E80 A;  1RW9 A;  3VSN A;  5JMD A;  4OZW A;  1QAZ A;  4NEI A;  3AFL A;  1F9G A;  1RWG A;  4FNV A;  1J0M A;  1N7R A;  1OJM A;  1W3Y A;  4OJZ A;  2E22 A;  3A0O A;  4OK4 A;  5JMF A;  1N7Q A;  4E1Y A;  1X1I A;  1HN0 A;  1HM2 A;  1HMU A;  1OJP A;  4F13 A;  1LOH A;  1N7P A;  1X1J A;  3NFV A; 
#chains in the Genus database with same CATH topology
 1GXO A;  3DSX B;  3W7S A;  4DI5 A;  4ZG8 A;  2A73 B;  2V3P A;  1V5C A;  1H13 A;  1WU4 A;  2FV0 A;  2EAD A;  2H6G B;  2BED B;  5IKH A;  2GZ6 A;  1H37 A;  4ZRQ A;  5DGQ A;  1K72 A;  4GTT B;  3M01 A;  4V1R A;  1OJM A;  1H54 A;  3A0O A;  1TNY B;  4FJQ A;  5IK6 A;  3E34 B;  2PMV A;  2JG0 A;  3QRY A;  1GSZ A;  1VD5 A;  4F10 A;  5FO8 B;  1TN8 B;  2F0Y B;  1RWH A;  3DSV B;  1XW2 A;  1H36 A;  1KZP B;  4L0G A;  3M74 A;  3PZ2 B;  3M02 A;  2AHG A;  2ZIS B;  3QXQ A;  4CJ0 A;  3M73 A;  1TN7 B;  3M78 A;  2J5C A;  3EQA A;  3P5P A;  3E37 B;  4MMI A;  1XWT A;  1H3A A;  1N4Q B;  4FNV A;  2YIK A;  3WC3 A;  5JMF A;  3ANI A;  4OJZ A;  3M00 A;  5DHI A;  3VW5 A;  1X1J A;  3AFJ A;  5IM1 A;  3N0F A;  1N4P B;  4OK2 A;  2ZBL A;  4AYP A;  3W7W A;  1N4S B;  1NC5 A;  2FUQ A;  4OZV A;  4FXK B;  5GW7 A;  3P2C A;  1CEM A;  3DSU B;  4KKJ A;  2RGK A;  1N1Z A;  1TNB B;  2BB6 A;  3OED A;  3KSL B;  4EL8 A;  1RW9 A;  5JMD A;  5MEH A;  1FT2 B;  1NXC A;  3Q7F B;  4AYO A;  2ONH A;  3KQ4 A;  3S4C A;  2XWB B;  4TF4 A;  3W7U A;  3T33 A;  3PYB A;  1HM3 A;  1LTX B;  4C1S A;  5FOB B;  4BOK A;  4CE7 A;  1QBQ B;  1N7O A;  4D4C A;  1LXK A;  4Z4J A;  2A8Z A;  2V8K A;  4GTO B;  4ZRP A;  4GTS B;  1RWG A;  1TNZ B;  4GTV B;  1FBO A;  1FMI A;  1LF9 A;  2RI8 A;  2E22 A;  3RX7 A;  1MZC B;  1FT1 B;  1O6R A;  4D4D A;  1W6K A;  3QT9 A;  3Q7A B;  3ON6 A;  3SFX B;  1LOH A;  1GLM A;  2JF4 A;  4WVB A;  3WIW A;  5CD2 A;  1HXA A;  1X81 B;  1EGU A;  1KS8 A;  2FUT A;  1HCU A;  4AYQ A;  1GXM A;  3M7L A;  1GXN A;  1WU5 A;  3TF4 A;  3W7T A;  3QWT A;  4GTP B;  1V5D A;  1TF4 A;  3H3K A;  4OZW A;  3HXB B;  4GTM B;  4D94 A;  4E1Y A;  5IL3 A;  3NFV A;  4WVC A;  2X03 A;  4AYR A;  1IA7 A;  1XWQ A;  5FO7 B;  4ZH1 A;  3RX5 A;  5ILJ A;  1C82 A;  4LIX A;  3M75 A;  3SDQ A;  4RNQ A;  3KSQ B;  3G6J B;  2D5J A;  3WKF A;  2FV1 A;  5ILY A;  2ZIR B;  3M7E A;  1C3D A;  3QDE A;  1AYX A;  3SAE A;  1NI1 B;  3ACS A;  1I8Q A;  3EU5 B;  3WUX A;  1LD8 B;  3M77 A;  2AFA A;  1UG9 A;  1H3C A;  3GLY A;  1O1T B;  3DRA B;  1WZZ A;  5EAT A;  5IKA A;  1LXM A;  2EAC A;  3RSY A;  4GAX A;  2BBC A;  1H12 A;  5IK9 A;  1O1S B;  5ILD A;  1W6J A;  3C72 B;  3EUV B;  3HXE B;  2DRS A;  3E73 A;  3QSP A;  1LF6 A;  5ILH A;  1AGM A;  1O6Q A;  1KZO B;  5GZK A;  3K11 A;  5KKB A;  4LNB B;  1HMW A;  2F6D A;  2DRQ A;  2XWJ B;  4DOD A;  1KKT A;  1OJO A;  3D3I A;  1FAE A;  1F9O A;  4ZH5 A;  2PN5 A;  1HX9 A;  4YCR A;  1F9D A;  1DOG A;  2JJB A;  1L2A A;  3M71 A;  1JS4 A;  1KWF A;  5IK0 A;  1JCQ B;  1FBW A;  1O5M B;  1X9D A;  4GL3 A;  4F13 A;  2GOX A;  4DOE A;  2OKX A;  5M7I A;  2E24 A;  1N24 A;  3W7X A;  3CIH A;  1N7N A;  3Q75 B;  3VSM A;  4XUV A;  3S9V A;  2VN7 A;  5FO9 B;  1SA5 B;  3PYA A;  2WIN B;  3H2W A;  2WDA A;  4FUS A;  2DRR A;  1HXC A;  1JCS B;  1W3Y A;  3HXD B;  3QFZ A;  5DGR A;  4L9P B;  1N7Q A;  1HN0 A;  2GH4 A;  2I07 B;  1HMU A;  2CQT A;  5ILI A;  1N22 A;  4GTQ B;  4MU9 A;  1CB8 A;  1O79 A;  2CQS A;  2WCO A;  5AGD A;  4M76 A;  5C05 A;  1X1H A;  1G9J A;  3M76 A;  1V7W A;  2XQW A;  1UMP A;  1RWF A;  3E33 B;  2FUZ A;  3RX8 A;  4CJ1 A;  5JPM B;  1N1B A;  3QPF A;  3Q79 B;  1RQ5 A;  1KSD A;  3REN A;  4NEI A;  1F9G A;  1FO2 A;  1SA4 B;  2P0V A;  1N7R A;  3G4F A;  1JCR B;  3WKI A;  3X17 A;  1OJP A;  3SFY B;  1FPP B;  3KLS A;  4Z4L A;  1D8D B;  4JJJ A;  5CZL A;  3QFY A;  3WIQ A;  3P5R A;  1F1S A;  3E7J A;  1O6H A;  3W5M A;  1FCE A;  1KRE A;  2Q1F A;  3RJ3 A;  2V3N A;  3NNB A;  3QG0 A;  2V8I A;  2NOJ A;  3E30 B;  4LNG B;  3VXD A;  2AHF A;  1NL4 B;  3DPY B;  3ANJ A;  1S64 B;  1IA6 A;  1X1I A;  1UT9 A;  3E32 B;  2VN4 A;  5M7Y A;  5JPN B;  1H3B A;  3Q78 B;  1KFG A;  4MBG B;  1O1R B;  2WY8 A;  3SDU A;  1GHQ A;  1RWA A;  1DL2 A;  3WIR A;  2B4F A;  2DRO A;  1G9G A;  1HXG A;  2B39 A;  3GZK A;  4KTR A;  3CU7 A;  1FP3 A;  4FXG B;  2H6H B;  1G6I A;  3E80 A;  3SDR A;  1TN6 B;  3AFL A;  4LNV A;  1J0M A;  2H6I B;  3HXF B;  4OK4 A;  1TNU B;  3ACT A;  5ILZ A;  1D8E B;  5EAS A;  1TNO B;  1GA2 A;  4KKI A;  4YDE B;  1N7P A;  1HV6 A;  4MMH A;  3QT3 A;  1H14 A;  4QT9 A;  1S63 B;  2ONG A;  1LD7 B;  3PZ3 B;  3PZ1 B;  4YDO B;  1J0N A;  3M72 A;  1QAZ A;  3H7L A;  3DSW B;  2G0D A;  3A3V A;  2EAB A;  5E2J A;  4ONT A;  2FBA A;  1KSC A;  4BOJ A;  2G02 A;  2BB5 A;  1N20 A;  3GT5 A;  5IL8 A;  1R76 A;  1H35 A;  2XFG A;  3M7B A;  2V8J A;  1N9A B;  3EZ8 A;  2BRV X;  1V7V A;  4V1S A;  1SQC A;  2QNO A;  2D8L A;  5EAU A;  3SDV A;  4Q2B A;  3W5N A;  1V7X A;  1WU6 A;  2ZZR A;  2IEJ B;  4GTR B;  3WKG A;  5CA3 A;  1FO3 A;  4D4B A;  1GAH A;  4D4A A;  5ILK A;  3G4D A;  3D5R A;  1QSJ A;  5DHK A;  4EHM B;  2RI9 A;  3QXF A;  2EAE A;  3S4A A;  2BRP A;  1G87 A;  2BRW A;  3SQC A;  2WYN A;  3N0G A;  1RWC A;  3PZ4 B;  4TXT A;  3D5S A;  3E6U A;  3WKH A;  3K7X A;  3LZ9 A;  2WY7 A;  2Z07 A;  1HM2 A;  1DCE B;  4J5T A;  1N94 B;  4KTP A;  3M7C A;  1CLC A;  3PMM A;  1KRF A;  2WII B;  4WU0 A;  4Q88 A;  2NVP A;  3S4B A;  1N95 B;  3OXU A;  1OJN A;  1QQF A;  3HXC B;  1N23 A;  3RRS A;  1IS9 A;  3EU8 A;  1GAI A;  3VSN A;  4L6X A;  1ULV A;  3Q73 B;  3DSS B;  3S4D A;  1HZF A;  2R2L B;  1N4R B;  1N21 A;  3SDT A;  2SQC A;  5GY3 A;  2H6F B;  3ANK A;  4WVA A;  1H39 A;  1L1Y A;  3DST B; 
#chains in the Genus database with same CATH homology
 1I8Q A;  1CB8 A;  1HV6 A;  4MMH A;  2WCO A;  2E24 A;  4OK2 A;  1HM3 A;  2X03 A;  4F10 A;  1HMW A;  1RWH A;  1EGU A;  1OJO A;  1N7N A;  2FUT A;  2FUQ A;  1N7O A;  4OZV A;  1X1H A;  1LXM A;  1F1S A;  1RWA A;  3E7J A;  1LXK A;  3VSM A;  2BRP A;  1C82 A;  1RWF A;  2BRV X;  2Q1F A;  2BRW A;  3NNB A;  1OJN A;  1J0N A;  4MMI A;  1RWC A;  2WDA A;  3E80 A;  1RW9 A;  3VSN A;  5JMD A;  4OZW A;  1QAZ A;  4NEI A;  3AFL A;  1F9G A;  1RWG A;  4FNV A;  1J0M A;  1N7R A;  1OJM A;  1W3Y A;  4OJZ A;  2E22 A;  3A0O A;  4OK4 A;  5JMF A;  1N7Q A;  4E1Y A;  1X1I A;  1HN0 A;  1HM2 A;  1HMU A;  1OJP A;  4F13 A;  1LOH A;  1N7P A;  1X1J A;  3NFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...