1QAZA

Crystal structure of alginate lyase a1-iii from sphingomonas species a1 at 1.78a resolution
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
351
structure length
351
Chain Sequence
GSHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNHSYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHYQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ALGINATE LYASE A1-III)
publication title Crystal structure of alginate lyase A1-III from Sphingomonas species A1 at 1.78 A resolution.
pubmed doi rcsb
source organism Sphingomonas sp.
molecule tags Lyase
total genus 135
structure length 351
sequence length 351
ec nomenclature ec 3.5.1.45: Transferred entry: 6.3.4.6.
pdb deposition date 1999-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 1qazA00
1N7RA 4OK4A 1N7NA 4NEIA 1RWHA 4OK2A 1LXMA 2BRPA 2Q1FA 4E1YA 2BRVX 1I8QA 1LXKA 1HN0A 1F1SA 1HV6A 1RWCA 1RW9A 3E80A 2E24A 1CB8A 1N7PA 1HM2A 1J0NA 1F9GA 1RWAA 4MMIA 4MMHA 4F10A 1C82A 1W3YA 2FUQA 3VSNA 2BRWA 1J0MA 1HMWA 1HM3A 1X1HA 1X1IA 1OJMA 1QAZA 3AFLA 3A0OA 2FUTA 3E7JA 2X03A 3VSMA 5JMDA 1OJPA 2E22A 4OJZA 4FNVA 4OZWA 1LOHA 2WDAA 1HMUA 5JMFA 1N7OA 2WCOA 1X1JA 4OZVA 1RWGA 3NNBA 1OJNA 1RWFA 4F13A 1OJOA 1N7QA 1EGUA 3NFVA
chains in the Genus database with same CATH superfamily
2V3PA 4WVCA 1L1YA 4MU9A 1F9OA 1FAEA 1UT9A 1I8QA 1RW9A 1XWQA 3HXEB 2E24A 1CB8A 1JCRB 1LTXB 4FJQA 4CE7A 3K7XA 2R2LB 1K72A 1N4SB 3VXDA 1O79A 2EABA 3M71A 2FBAA 3M7CA 1GSZA 2RGKA 2Z07A 4TF4A 1FCEA 3WUXA 4L6XA 1N7RA 3E34B 3RENA 1KKTA 4L0GA 1LXKA 1RWCA 4QT9A 1JCSB 3WC3A 3S4AA 3PZ4B 2WY8A 3QDEA 1AYXA 1SQCA 1HXCA 2FV0A 3RX7A 3SDQA 3QFYA 2EAEA 1V5CA 1DOGA 3QPFA 1TNUB 3Q75B 2RI8A 3C72B 1KSDA 1FBWA 3SDUA 3GZKA 3RX5A 1GA2A 1KREA 2Q1FA 1NC5A 1HV6A 3E33B 4GTPB 1NI1B 1J0NA 1KZOB 2I07B 1V7VA 3SQCA 1OJMA 4ZH5A 4AYPA 3E30B 3KQ4A 4ZRQA 4KTPA 4ZH1A 2ZBLA 2ONGA 1O6QA 2B4FA 1KS8A 2H6IB 4GTOB 3PZ3B 2J5CA 5M7IA 4Q88A 5KKBA 1KWFA 2B39A 2JF4A 3M78A 3W7TA 2AHGA 3EZ8A 3QRYA 1RWAA 3ANIA 3RRSA 3Q78B 1TNBB 3DSWB 3SDTA 2V3NA 1WU4A 1H54A 3DSXB 3EUVB 1N1BA 1X1JA 4V1SA 1OJNA 1H35A 3Q7AB 3DRAB 2XQWA 3Q7FB 5IL8A 1N22A 2CQSA 3H3KA 1GLMA 1C82A 3HXFB 4AYQA 2P0VA 3T33A 3S4BA 3DSVB 3DPYB 1FPPB 1TNOB 3SAEA 4D4AA 1H13A 2XFGA 1N95B 2WDAA 1HZFA 1O1TB 1X9DA 2VN4A 4ZG8A 1TF4A 1RWFA 3QT9A 3NFVA 3A3VA 1S64B 4EHMB 4KKJA 4WVBA 2BRPA 1H14A 3N0GA 3K11A 5DHIA 4GL3A 2JJBA 4AYOA 5GW7A 1DL2A 3SDRA 2JG0A 5FOBB 3VW5A 2FUTA 3QG0A 5DHKA 1X81B 2WIIB 2NVPA 3ON6A 3RSYA 3D5RA 3M77A 5IM1A 1V7XA 2DRSA 1XW2A 1N94B 1JCQB 1N7NA 1RWHA 4GTQB 1IA7A 2VN7A 4GTTB 4MMHA 4MMIA 2FUZA 3AFJA 1O1SB 1QBQB 3M02A 1J0MA 2OKXA 1X1IA 4LIXA 3CU7A 3G4FA 1LD7B 1IS9A 3M73A 2E22A 1NXCA 3KSQB 1FT1B 3QXFA 2DRRA 2BBCA 2BEDB 1C3DA 4KTRA 3S4CA 3DSSB 4OK2A 4NEIA 2AFAA 4GAXA 1LD8B 1LF9A 1N7PA 4F10A 3OEDA 3VSNA 2QNOA 1HM3A 1FP3A 5ILIA 3PZ2B 1HX9A 3H7LA 4FXKB 2WINB 5JMDA 1UG9A 1N1ZA 3QWTA 4MBGB 4D4CA 5ILJA 3M76A 3S4DA 1WU5A 2GH4A 2D8LA 1VD5A 1QSJA 4DI5A 5ILKA 4ONTA 3OXUA 5EATA 3GLYA 4XUVA 1GHQA 1O6HA 3HXCB 3Q79B 3PYAA 2EACA 1AGMA 2FUQA 2F0YB 1G87A 4D4DA 1KSCA 4WU0A 1N4RB 4WVAA 1MZCB 4YDOB 3W5MA 2A8ZA 1RQ5A 3EU5B 3GT5A 4BOKA 3M00A 4CJ0A 3DSUB 2ZIRB 3H2WA 4LNBB 1NL4B 2GZ6A 4RNQA 1TN7B 1JS4A 3EU8A 4L9PB 3ACSA 4DODA 3HXDB 2RI9A 3QSPA 4EL8A 3W7UA 3ANJA 3Q73B 3S9VA 3TF4A 1FO2A 1HCUA 1SA4B 2NOJA 5GZKA 3W5NA 1D8DB 2PN5A 3M72A 1IA6A 1H3AA 1H3CA 5AGDA 3SFYB 4DOEA 1OJPA 4OJZA 3WIWA 5CA3A 3M01A 1LOHA 2WY7A 3E37B 2XWBB 2V8JA 5C05A 1CEMA 4F13A 1DCEB 3P5PA 3P2CA 4GTRB 4J5TA 1N4PB 4FUSA 1G9GA 3E80A 5CZLA 3M7LA 2F6DA 1GXMA 2A73B 2V8KA 3DSTB 1HXGA 5M7YA 3PMMA 3WKIA 4YCRA 1HMUA 1HXAA 1S63B 1N24A 2G0DA 5ILHA 1GXNA 3PZ1B 4Z4JA 1FT2B 1TN6B 3RX8A 1H12A 1N4QB 2V8IA 2H6HB 1LF6A 2BRVX 3E6UA 3E73A 2BB5A 2WYNA 1HN0A 3KSLB 4LNGB 4V1RA 4LNVA 5GY3A 1FO3A 4CJ1A 4JJJA 1X1HA 5DGQA 4AYRA 3M7EA 3X17A 2XWJB 3WKGA 1N7OA 2WCOA 2SQCA 2YIKA 1CLCA 1H37A 3SDVA 3WIRA 2H6FB 4TXTA 1N23A 1V7WA 3PYBA 5IK0A 1FMIA 4E1YA 4M76A 3W7SA 5E2JA 5IK9A 1UMPA 4YDEB 3RJ3A 5ILYA 2D5JA 2FV1A 2GOXA 3D5SA 3VSMA 1TN8B 2AHFA 4FXGB 5IKHA 3CIHA 3M74A 1WZZA 3G4DA 2EADA 1N21A 3D3IA 5ILDA 1D8EB 3QT3A 3W7WA 1W3YA 1H36A 3HXBB 3M75A 1KFGA 2ONHA 3AFLA 1GAIA 1QQFA 3A0OA 4KKIA 3ACTA 3E7JA 2DROA 2ZISB 1R76A 3ANKA 3QFZA 2CQTA 4GTMB 3KLSA 5FO8B 3NNBA 5IK6A 5MEHA 1N9AB 4BOJA 4Z4LA 5ILZA 1L2AA 1F9DA 1W6JA 1F1SA 5JPMB 3EQAA 1HM2A 3N0FA 4GTSB 1XWTA 5EASA 2BRWA 1HMWA 4D94A 4D4BA 2DRQA 1QAZA 1O6RA 1H39A 3G6JB 5DGRA 1GAHA 1G9JA 3W7XA 5EAUA 2H6GB 1W6KA 1N7QA 4GTVB 3LZ9A 2IEJB 3P5RA 1KZPB 3E32B 4OK4A 1LXMA 1GXOA 3QXQA 1TNZB 1F9GA 1ULVA 2PMVA 2G02A 4C1SA 5FO7B 1FBOA 3SFXB 1SA5B 1V5DA 1N20A 3WKFA 1KRFA 4Q2BA 1O5MB 1WU6A 3M7BA 2X03A 3WIQA 3WKHA 5IL3A 2ZZRA 1G6IA 1H3BA 4FNVA 5IKAA 4OZWA 5JMFA 1O1RB 4OZVA 4ZRPA 1RWGA 1TNYB 5FO9B 5CD2A 5JPNB 1OJOA 1EGUA 2BB6A
chains in the Genus database with same CATH topology
1N7RA 4OK4A 1N7NA 4NEIA 1RWHA 4OK2A 1LXMA 2BRPA 2Q1FA 4E1YA 2BRVX 1I8QA 1LXKA 1HN0A 1F1SA 1HV6A 1RWCA 1RW9A 3E80A 2E24A 1CB8A 1N7PA 1HM2A 1J0NA 1F9GA 1RWAA 4MMIA 4MMHA 4F10A 1C82A 1W3YA 2FUQA 3VSNA 2BRWA 1J0MA 1HMWA 1HM3A 1X1HA 1X1IA 1OJMA 1QAZA 3AFLA 3A0OA 2FUTA 3E7JA 2X03A 3VSMA 5JMDA 1OJPA 2E22A 4OJZA 4FNVA 4OZWA 1LOHA 2WDAA 1HMUA 5JMFA 1N7OA 2WCOA 1X1JA 4OZVA 1RWGA 3NNBA 1OJNA 1RWFA 4F13A 1OJOA 1N7QA 1EGUA 3NFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7R A;  4OK4 A;  1N7N A;  4NEI A;  1RWH A;  4OK2 A;  1LXM A;  2BRP A;  2Q1F A;  4E1Y A;  2BRV X;  1I8Q A;  1LXK A;  1HN0 A;  1F1S A;  1HV6 A;  1RWC A;  1RW9 A;  3E80 A;  2E24 A;  1CB8 A;  1N7P A;  1HM2 A;  1J0N A;  1F9G A;  1RWA A;  4MMI A;  4MMH A;  4F10 A;  1C82 A;  1W3Y A;  2FUQ A;  3VSN A;  2BRW A;  1J0M A;  1HMW A;  1HM3 A;  1X1H A;  1X1I A;  1OJM A;  1QAZ A;  3AFL A;  3A0O A;  2FUT A;  3E7J A;  2X03 A;  3VSM A;  5JMD A;  1OJP A;  2E22 A;  4OJZ A;  4FNV A;  4OZW A;  1LOH A;  2WDA A;  1HMU A;  5JMF A;  1N7O A;  2WCO A;  1X1J A;  4OZV A;  1RWG A;  3NNB A;  1OJN A;  1RWF A;  4F13 A;  1OJO A;  1N7Q A;  1EGU A;  3NFV A; 
#chains in the Genus database with same CATH topology
 2V3P A;  4WVC A;  1L1Y A;  4MU9 A;  1F9O A;  1FAE A;  1UT9 A;  1I8Q A;  1RW9 A;  1XWQ A;  3HXE B;  2E24 A;  1CB8 A;  1JCR B;  1LTX B;  4FJQ A;  4CE7 A;  3K7X A;  2R2L B;  1K72 A;  1N4S B;  3VXD A;  1O79 A;  2EAB A;  3M71 A;  2FBA A;  3M7C A;  1GSZ A;  2RGK A;  2Z07 A;  4TF4 A;  1FCE A;  3WUX A;  4L6X A;  1N7R A;  3E34 B;  3REN A;  1KKT A;  4L0G A;  1LXK A;  1RWC A;  4QT9 A;  1JCS B;  3WC3 A;  3S4A A;  3PZ4 B;  2WY8 A;  3QDE A;  1AYX A;  1SQC A;  1HXC A;  2FV0 A;  3RX7 A;  3SDQ A;  3QFY A;  2EAE A;  1V5C A;  1DOG A;  3QPF A;  1TNU B;  3Q75 B;  2RI8 A;  3C72 B;  1KSD A;  1FBW A;  3SDU A;  3GZK A;  3RX5 A;  1GA2 A;  1KRE A;  2Q1F A;  1NC5 A;  1HV6 A;  3E33 B;  4GTP B;  1NI1 B;  1J0N A;  1KZO B;  2I07 B;  1V7V A;  3SQC A;  1OJM A;  4ZH5 A;  4AYP A;  3E30 B;  3KQ4 A;  4ZRQ A;  4KTP A;  4ZH1 A;  2ZBL A;  2ONG A;  1O6Q A;  2B4F A;  1KS8 A;  2H6I B;  4GTO B;  3PZ3 B;  2J5C A;  5M7I A;  4Q88 A;  5KKB A;  1KWF A;  2B39 A;  2JF4 A;  3M78 A;  3W7T A;  2AHG A;  3EZ8 A;  3QRY A;  1RWA A;  3ANI A;  3RRS A;  3Q78 B;  1TNB B;  3DSW B;  3SDT A;  2V3N A;  1WU4 A;  1H54 A;  3DSX B;  3EUV B;  1N1B A;  1X1J A;  4V1S A;  1OJN A;  1H35 A;  3Q7A B;  3DRA B;  2XQW A;  3Q7F B;  5IL8 A;  1N22 A;  2CQS A;  3H3K A;  1GLM A;  1C82 A;  3HXF B;  4AYQ A;  2P0V A;  3T33 A;  3S4B A;  3DSV B;  3DPY B;  1FPP B;  1TNO B;  3SAE A;  4D4A A;  1H13 A;  2XFG A;  1N95 B;  2WDA A;  1HZF A;  1O1T B;  1X9D A;  2VN4 A;  4ZG8 A;  1TF4 A;  1RWF A;  3QT9 A;  3NFV A;  3A3V A;  1S64 B;  4EHM B;  4KKJ A;  4WVB A;  2BRP A;  1H14 A;  3N0G A;  3K11 A;  5DHI A;  4GL3 A;  2JJB A;  4AYO A;  5GW7 A;  1DL2 A;  3SDR A;  2JG0 A;  5FOB B;  3VW5 A;  2FUT A;  3QG0 A;  5DHK A;  1X81 B;  2WII B;  2NVP A;  3ON6 A;  3RSY A;  3D5R A;  3M77 A;  5IM1 A;  1V7X A;  2DRS A;  1XW2 A;  1N94 B;  1JCQ B;  1N7N A;  1RWH A;  4GTQ B;  1IA7 A;  2VN7 A;  4GTT B;  4MMH A;  4MMI A;  2FUZ A;  3AFJ A;  1O1S B;  1QBQ B;  3M02 A;  1J0M A;  2OKX A;  1X1I A;  4LIX A;  3CU7 A;  3G4F A;  1LD7 B;  1IS9 A;  3M73 A;  2E22 A;  1NXC A;  3KSQ B;  1FT1 B;  3QXF A;  2DRR A;  2BBC A;  2BED B;  1C3D A;  4KTR A;  3S4C A;  3DSS B;  4OK2 A;  4NEI A;  2AFA A;  4GAX A;  1LD8 B;  1LF9 A;  1N7P A;  4F10 A;  3OED A;  3VSN A;  2QNO A;  1HM3 A;  1FP3 A;  5ILI A;  3PZ2 B;  1HX9 A;  3H7L A;  4FXK B;  2WIN B;  5JMD A;  1UG9 A;  1N1Z A;  3QWT A;  4MBG B;  4D4C A;  5ILJ A;  3M76 A;  3S4D A;  1WU5 A;  2GH4 A;  2D8L A;  1VD5 A;  1QSJ A;  4DI5 A;  5ILK A;  4ONT A;  3OXU A;  5EAT A;  3GLY A;  4XUV A;  1GHQ A;  1O6H A;  3HXC B;  3Q79 B;  3PYA A;  2EAC A;  1AGM A;  2FUQ A;  2F0Y B;  1G87 A;  4D4D A;  1KSC A;  4WU0 A;  1N4R B;  4WVA A;  1MZC B;  4YDO B;  3W5M A;  2A8Z A;  1RQ5 A;  3EU5 B;  3GT5 A;  4BOK A;  3M00 A;  4CJ0 A;  3DSU B;  2ZIR B;  3H2W A;  4LNB B;  1NL4 B;  2GZ6 A;  4RNQ A;  1TN7 B;  1JS4 A;  3EU8 A;  4L9P B;  3ACS A;  4DOD A;  3HXD B;  2RI9 A;  3QSP A;  4EL8 A;  3W7U A;  3ANJ A;  3Q73 B;  3S9V A;  3TF4 A;  1FO2 A;  1HCU A;  1SA4 B;  2NOJ A;  5GZK A;  3W5N A;  1D8D B;  2PN5 A;  3M72 A;  1IA6 A;  1H3A A;  1H3C A;  5AGD A;  3SFY B;  4DOE A;  1OJP A;  4OJZ A;  3WIW A;  5CA3 A;  3M01 A;  1LOH A;  2WY7 A;  3E37 B;  2XWB B;  2V8J A;  5C05 A;  1CEM A;  4F13 A;  1DCE B;  3P5P A;  3P2C A;  4GTR B;  4J5T A;  1N4P B;  4FUS A;  1G9G A;  3E80 A;  5CZL A;  3M7L A;  2F6D A;  1GXM A;  2A73 B;  2V8K A;  3DST B;  1HXG A;  5M7Y A;  3PMM A;  3WKI A;  4YCR A;  1HMU A;  1HXA A;  1S63 B;  1N24 A;  2G0D A;  5ILH A;  1GXN A;  3PZ1 B;  4Z4J A;  1FT2 B;  1TN6 B;  3RX8 A;  1H12 A;  1N4Q B;  2V8I A;  2H6H B;  1LF6 A;  2BRV X;  3E6U A;  3E73 A;  2BB5 A;  2WYN A;  1HN0 A;  3KSL B;  4LNG B;  4V1R A;  4LNV A;  5GY3 A;  1FO3 A;  4CJ1 A;  4JJJ A;  1X1H A;  5DGQ A;  4AYR A;  3M7E A;  3X17 A;  2XWJ B;  3WKG A;  1N7O A;  2WCO A;  2SQC A;  2YIK A;  1CLC A;  1H37 A;  3SDV A;  3WIR A;  2H6F B;  4TXT A;  1N23 A;  1V7W A;  3PYB A;  5IK0 A;  1FMI A;  4E1Y A;  4M76 A;  3W7S A;  5E2J A;  5IK9 A;  1UMP A;  4YDE B;  3RJ3 A;  5ILY A;  2D5J A;  2FV1 A;  2GOX A;  3D5S A;  3VSM A;  1TN8 B;  2AHF A;  4FXG B;  5IKH A;  3CIH A;  3M74 A;  1WZZ A;  3G4D A;  2EAD A;  1N21 A;  3D3I A;  5ILD A;  1D8E B;  3QT3 A;  3W7W A;  1W3Y A;  1H36 A;  3HXB B;  3M75 A;  1KFG A;  2ONH A;  3AFL A;  1GAI A;  1QQF A;  3A0O A;  4KKI A;  3ACT A;  3E7J A;  2DRO A;  2ZIS B;  1R76 A;  3ANK A;  3QFZ A;  2CQT A;  4GTM B;  3KLS A;  5FO8 B;  3NNB A;  5IK6 A;  5MEH A;  1N9A B;  4BOJ A;  4Z4L A;  5ILZ A;  1L2A A;  1F9D A;  1W6J A;  1F1S A;  5JPM B;  3EQA A;  1HM2 A;  3N0F A;  4GTS B;  1XWT A;  5EAS A;  2BRW A;  1HMW A;  4D94 A;  4D4B A;  2DRQ A;  1QAZ A;  1O6R A;  1H39 A;  3G6J B;  5DGR A;  1GAH A;  1G9J A;  3W7X A;  5EAU A;  2H6G B;  1W6K A;  1N7Q A;  4GTV B;  3LZ9 A;  2IEJ B;  3P5R A;  1KZP B;  3E32 B;  4OK4 A;  1LXM A;  1GXO A;  3QXQ A;  1TNZ B;  1F9G A;  1ULV A;  2PMV A;  2G02 A;  4C1S A;  5FO7 B;  1FBO A;  3SFX B;  1SA5 B;  1V5D A;  1N20 A;  3WKF A;  1KRF A;  4Q2B A;  1O5M B;  1WU6 A;  3M7B A;  2X03 A;  3WIQ A;  3WKH A;  5IL3 A;  2ZZR A;  1G6I A;  1H3B A;  4FNV A;  5IKA A;  4OZW A;  5JMF A;  1O1R B;  4OZV A;  4ZRP A;  1RWG A;  1TNY B;  5FO9 B;  5CD2 A;  5JPN B;  1OJO A;  1EGU A;  2BB6 A; 
#chains in the Genus database with same CATH homology
 1N7R A;  4OK4 A;  1N7N A;  4NEI A;  1RWH A;  4OK2 A;  1LXM A;  2BRP A;  2Q1F A;  4E1Y A;  2BRV X;  1I8Q A;  1LXK A;  1HN0 A;  1F1S A;  1HV6 A;  1RWC A;  1RW9 A;  3E80 A;  2E24 A;  1CB8 A;  1N7P A;  1HM2 A;  1J0N A;  1F9G A;  1RWA A;  4MMI A;  4MMH A;  4F10 A;  1C82 A;  1W3Y A;  2FUQ A;  3VSN A;  2BRW A;  1J0M A;  1HMW A;  1HM3 A;  1X1H A;  1X1I A;  1OJM A;  1QAZ A;  3AFL A;  3A0O A;  2FUT A;  3E7J A;  2X03 A;  3VSM A;  5JMD A;  1OJP A;  2E22 A;  4OJZ A;  4FNV A;  4OZW A;  1LOH A;  2WDA A;  1HMU A;  5JMF A;  1N7O A;  2WCO A;  1X1J A;  4OZV A;  1RWG A;  3NNB A;  1OJN A;  1RWF A;  4F13 A;  1OJO A;  1N7Q A;  1EGU A;  3NFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...