1HZFA

C4adg fragment of human complement factor c4a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
302
Chain Sequence
b'SPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWGQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR C4A
publication title X-ray crystal structure of the C4d fragment of human complement component C4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 109
structure length 302
sequence length 326
ec nomenclature ec 3.4.21.43: Classical-complement-pathway C3/C5 convertase.
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1hzfA00
1O5MB 1TNUB 1JCRB 1FPPB 3Q7FB 3K7XA 3SFYB 1TN8B 3DSSB 3EU5B 4LNGB 4V1SA 4GTVB 3RJ3A 4D4CA 1H3CA 1LTXB 1GHQA 1FT2B 2XWJB 3C72B 4GTTB 1GXMA 1MZCB 1TNZB 1N4PB 1JCSB 2V8JA 1TNYB 1O1RB 3CU7A 3Q79B 1S64B 4V1RA 1O6HA 3DSWB 4BOJA 3DSUB 3E33B 1C3DA 1QSJA 1N94B 2V3PA 2ZISB 4FXGB 5JPMB 4D94A 2PMVA 3HXCB 3G6JB 1H36A 1GXNA 2H6IB 1TN6B 3DSTB 3SFXB 1S63B 2BB5A 4YDOB 2WINB 1UMPA 4GTRB 4ZH1A 3OXUA 1GSZA 3DSVB 1H39A 1NI1B 1H35A 2WY8A 1JCQB 1HZFA 4KKIA 3KSQB 1SQCA 3Q75B 3EUVB 2BB6A 2NOJA 1TNBB 2ZIRB 1SA5B 1H3BA 1H3AA 3E34B 4C1SA 2R2LB 3D5SA 4MU9A 5FO7B 3DPYB 4KKJA 1H37A 2IEJB 2PN5A 3E37B 5FO8B 2V8KA 3PZ4B 3PZ1B 4LNVA 2WIIB 1SA4B 2I07B 2WY7A 1GXOA 3KSLB 4LNBB 1N95B 1O1SB 2XQWA 5FO9B 1TN7B 1KZPB 3D5RA 1W6JA 1W6KA 1QBQB 4D4AA 1D8EB 4ONTA 1O6RA 1R76A 3Q78B 3HXEB 5AGDA 1N4QB 4M76A 2G02A 1LD8B 1DCEB 2H6GB 4FXKB 3PZ2B 2H6FB 4GTOB 2A73B 4ZRQA 3DSXB 3HXDB 4BOKA 1O1TB 1N4RB 3DRAB 3Q7AB 2V8IA 3SQCA 2SQCA 2XWBB 4EHMB 2V3NA 4YDEB 4D4DA 1FT1B 2H6HB 3E30B 3HXBB 4GTSB 5JPNB 2BEDB 1N4SB 2G0DA 2BBCA 1D8DB 1X81B 4MBGB 3HXFB 2B39A 1O79A 1N9AB 1QQFA 3Q73B 4GTPB 3OEDA 1KZOB 3E32B 2GOXA 3PZ3B 1LD7B 3KLSA 2F0YB 4D4BA 4L9PB 1TNOB 1NL4B 3KQ4A 4ZRPA 4GTMB 1O6QA 5FOBB 4GTQB
chains in the Genus database with same CATH superfamily
2RI9A 3PYAA 2JF4A 3Q7FB 1AYXA 2Q1FA 2OKXA 4WVBA 2EACA 3EU5B 3QSPA 3QXFA 4D4CA 5ILYA 3AFLA 4GTTB 2XWJB 3S4AA 3QT9A 3S4DA 3WKGA 5EASA 4FUSA 3SDQA 4FXGB 1L2AA 1LXKA 5IK0A 3QFZA 1LF6A 1TN6B 1TF4A 5GY3A 1H35A 4FNVA 3KSQB 3NFVA 2ZIRB 1AGMA 3X17A 1J0NA 2B4FA 4C1SA 3E34B 1NC5A 1HX9A 2R2LB 3DPYB 5DGRA 2IEJB 3VSNA 1KRFA 2WYNA 3E37B 3M02A 2WCOA 3WKFA 4LNVA 3PZ1B 4GAXA 1GXOA 1N95B 1OJPA 1W6KA 1D8EB 3K11A 1O6RA 3HXEB 1KWFA 1VD5A 1WU6A 3ACTA 4GTOB 1GAHA 3PYBA 1WU5A 1O1TB 3G4FA 1WZZA 1V7VA 3SDVA 3WKHA 2SQCA 2XWBB 1H12A 4ZH5A 3RX5A 4Z4JA 2AHGA 1CEMA 1FT1B 4GL3A 5M7YA 3RENA 4NEIA 2BRPA 2AHFA 5IL3A 1FAEA 2BBCA 5IKAA 1D8DB 1HXCA 4J5TA 1G87A 3M75A 5IL8A 3Q73B 2XFGA 5GW7A 5IKHA 1LD7B 4D4BA 1FT2B 1IA6A 1N22A 4FJQA 1EGUA 1G9GA 4GTQB 1TNUB 4AYQA 1JCRB 4CE7A 2A8ZA 5ILJA 4ZG8A 3DSSB 4LNGB 1V5DA 1RQ5A 1TNZB 1XWQA 1HXGA 4EL8A 1IS9A 3CU7A 3NNBA 4V1RA 1KKTA 5E2JA 3RRSA 1N94B 2DRSA 2V3PA 3M74A 4F13A 3G6JB 1H36A 1F9DA 1S63B 3W7SA 2WINB 4ZH1A 3OXUA 1N7QA 2EAEA 4KKIA 1N1ZA 1SQCA 1W3YA 2NOJA 1UG9A 1SA5B 2VN7A 3M72A 1X9DA 2DRRA 3E7JA 4Q2BA 1CB8A 2FBAA 1RWCA 5JMDA 1V7WA 3WIWA 2E22A 4OK2A 4QT9A 5FO8B 5EATA 1LXMA 2JG0A 1KFGA 1FP3A 5FO9B 2XQWA 1TN7B 5JMFA 1KZPB 3WC3A 1KSDA 1J0MA 1QBQB 3M73A 1HN0A 4L0GA 5M7IA 1FBWA 1RWGA 3WUXA 1FBOA 3ANJA 3QXQA 1FO3A 5AGDA 3SDTA 3D3IA 3M71A 2RI8A 1LD8B 1DCEB 1KSCA 4FXKB 2WDAA 2ZZRA 2H6FB 3S4CA 1OJOA 3WKIA 3M77A 1N4RB 5GZKA 3DRAB 3Q7AB 1N21A 2D8LA 3SDRA 2DRQA 1K72A 3WIQA 1H14A 2FUZA 3W7UA 1ULVA 2G0DA 4OJZA 1X81B 1G6IA 4MBGB 2E24A 4KTPA 2ONHA 1N9AB 2FV0A 4GTPB 4L6XA 3ACSA 1HM3A 3QG0A 3E32B 2GOXA 5CA3A 3QFYA 2VN4A 1TNOB 4YCRA 4GTMB 4Q88A 2NVPA 2RGKA 3K7XA 3SFYB 4XUVA 3W7WA 1TN8B 3E73A 1OJNA 1H3CA 3C72B 1GXMA 1MZCB 3G4DA 3QWTA 1JCSB 3ON6A 1TNYB 5ILZA 1KS8A 2CQTA 3Q79B 1O6HA 3DSWB 3RX7A 4BOJA 3DSUB 1LF9A 3GLYA 3A3VA 3H2WA 4DI5A 2Z07A 1GXNA 1FCEA 4AYRA 4DODA 4TXTA 4YDOB 1UMPA 2F6DA 5DHKA 1GSZA 1NI1B 1XW2A 2WY8A 1JCQB 1HZFA 3Q75B 3W5NA 3QT3A 4Z4LA 2BRWA 5DHIA 1H3BA 2GZ6A 4MU9A 4MMIA 2AFAA 3AFJA 1H37A 5MEHA 4WVAA 1KREA 1H13A 1X1HA 5IM1A 3PZ4B 3CIHA 2WIIB 2I07B 2WY7A 1O1SB 1W6JA 2ONGA 3M7CA 1L1YA 3GZKA 1R76A 1HM2A 1N4QB 4M76A 3ANKA 2H6GB 4OZVA 1RWAA 3P2CA 1GA2A 2A73B 4ZRQA 1DL2A 3DSXB 2DROA 2J5CA 2V8IA 3M00A 3SQCA 1V5CA 2CQSA 3E80A 3W7XA 3VSMA 5IK9A 2V3NA 4D4DA 3EQAA 2H6HB 3HXBB 4GTSB 5C05A 5JPNB 1N4SB 4CJ1A 3RX8A 4LIXA 2P0VA 5IK6A 3M7LA 3M7BA 1N24A 2BRVX 1X1JA 1WU4A 1IA7A 3HXFB 2B39A 4WU0A 3OEDA 3M78A 3S4BA 4E1YA 1HXAA 1KZOB 3LZ9A 2FV1A 1XWTA 3S9VA 3KLSA 1N23A 3N0FA 3W7TA 1NL4B 3EZ8A 3SDUA 1F9OA 2ZBLA 1DOGA 1O6QA 3GT5A 5FOBB 2FUTA 3W5MA 1O5MB 3H7LA 5ILIA 1FPPB 2EADA 1RWFA 4V1SA 3RJ3A 4GTVB 5KKBA 1C82A 1N7NA 1LTXB 1GHQA 1N4PB 1N1BA 2V8JA 1O1RB 2X03A 1S64B 3WIRA 4MMHA 3E33B 5CD2A 1C3DA 1QSJA 4RNQA 3VW5A 4OZWA 1I8QA 1FMIA 2ZISB 5JPMB 1JS4A 4D94A 1F9GA 5EAUA 2PMVA 3HXCB 1F1SA 2H6IB 3DSTB 3SFXB 1CLCA 1RW9A 2QNOA 2BB5A 1N7OA 4GTRB 3DSVB 1H39A 1N7PA 3M7EA 4TF4A 1N20A 3QRYA 3EU8A 1HMUA 3EUVB 3M76A 1X1IA 2BB6A 1TNBB 2YIKA 2GH4A 4F10A 1H3AA 3D5SA 5FO7B 1HV6A 1V7XA 1GAIA 1G9JA 4KKJA 2PN5A 4WVCA 4OK4A 2JJBA 2V8KA 3P5RA 4CJ0A 1SA4B 3T33A 4DOEA 3KSLB 4LNBB 2D5JA 3QDEA 3D5RA 4D4AA 4ONTA 5ILKA 1FO2A 1QAZA 3Q78B 2G02A 4KTRA 1HMWA 3PZ2B 3M01A 3PMMA 1H54A 4JJJA 4AYPA 3HXDB 1GLMA 4BOKA 3RSYA 1HCUA 5ILHA 3P5PA 3QPFA 2EABA 4EHMB 1OJMA 4YDEB 3N0GA 1LOHA 3E30B 1UT9A 2BEDB 5DGQA 1N7RA 1RWHA 3H3KA 3ANIA 3VXDA 3TF4A 1O79A 1QQFA 2FUQA 3A0OA 5ILDA 3PZ3B 1NXCA 3SAEA 2F0YB 4L9PB 5CZLA 3KQ4A 3E6UA 4ZRPA 4AYOA
chains in the Genus database with same CATH topology
2RI9A 3PYAA 2JF4A 3Q7FB 1AYXA 2OKXA 4WVBA 2EACA 3EU5B 3QSPA 3QXFA 4D4CA 4GTTB 3S4AA 2XWJB 3QT9A 3S4DA 3WKGA 4FUSA 3SDQA 4FXGB 1L2AA 3QFZA 1LF6A 1TN6B 1TF4A 5GY3A 1H35A 3KSQB 2ZIRB 1AGMA 3X17A 2B4FA 4C1SA 3E34B 1NC5A 2R2LB 3DPYB 5DGRA 2IEJB 1KRFA 2WYNA 3E37B 3WKFA 4LNVA 3PZ1B 1GXOA 1N95B 1W6KA 1D8EB 3K11A 1O6RA 3HXEB 1KWFA 1VD5A 1WU6A 3ACTA 4GTOB 1GAHA 3PYBA 1WU5A 1O1TB 1WZZA 1V7VA 3SDVA 3WKHA 2SQCA 2XWBB 1H12A 4ZH5A 3RX5A 4Z4JA 2AHGA 1CEMA 1FT1B 4GL3A 5M7YA 3RENA 2AHFA 1FAEA 2BBCA 1D8DB 4J5TA 1G87A 3M75A 3Q73B 2XFGA 5GW7A 1LD7B 4D4BA 1FT2B 1IA6A 1G9GA 4GTQB 1TNUB 4AYQA 1JCRB 4CE7A 2A8ZA 4ZG8A 3DSSB 4LNGB 1V5DA 1RQ5A 1TNZB 1XWQA 4EL8A 1IS9A 3CU7A 4V1RA 1KKTA 5E2JA 3RRSA 1N94B 2DRSA 2V3PA 3M74A 3G6JB 1H36A 1F9DA 1S63B 3W7SA 2WINB 4ZH1A 3OXUA 2EAEA 4KKIA 1SQCA 2NOJA 1UG9A 1SA5B 2VN7A 3M72A 1X9DA 2DRRA 4Q2BA 2FBAA 1V7WA 3WIWA 4QT9A 5FO8B 2JG0A 1KFGA 1FP3A 5FO9B 2XQWA 1TN7B 1KZPB 3WC3A 1KSDA 1QBQB 3M73A 4L0GA 5M7IA 1FBWA 3WUXA 1FBOA 3QXQA 3ANJA 1FO3A 5AGDA 3SDTA 3D3IA 3M71A 2RI8A 1LD8B 1DCEB 1KSCA 4FXKB 2ZZRA 2H6FB 3S4CA 3WKIA 3M77A 1N4RB 5GZKA 3DRAB 3Q7AB 2D8LA 3SDRA 2DRQA 1K72A 3WIQA 1H14A 2FUZA 3W7UA 1ULVA 2G0DA 1X81B 1G6IA 4MBGB 4KTPA 1N9AB 2FV0A 4GTPB 4L6XA 3ACSA 3QG0A 3E32B 2GOXA 5CA3A 3QFYA 2VN4A 1TNOB 4YCRA 4GTMB 4Q88A 2NVPA 2RGKA 3K7XA 3SFYB 4XUVA 3W7WA 1TN8B 3E73A 1H3CA 3C72B 1GXMA 1MZCB 3QWTA 1JCSB 3ON6A 1TNYB 1KS8A 2CQTA 3Q79B 1O6HA 3DSWB 3RX7A 4BOJA 3DSUB 1LF9A 3GLYA 3A3VA 3H2WA 2Z07A 1GXNA 1FCEA 4AYRA 4DODA 4TXTA 4YDOB 1UMPA 2F6DA 1GSZA 1NI1B 1XW2A 2WY8A 1JCQB 1HZFA 3Q75B 3W5NA 3QT3A 4Z4LA 1H3BA 2GZ6A 4MU9A 2AFAA 3AFJA 1H37A 5MEHA 4WVAA 1KREA 1H13A 3PZ4B 3CIHA 2WIIB 2I07B 2WY7A 1O1SB 1W6JA 3M7CA 1L1YA 3GZKA 1R76A 1N4QB 4M76A 3ANKA 2H6GB 3P2CA 1GA2A 2A73B 4ZRQA 1DL2A 3DSXB 2DROA 2V8IA 3SQCA 1V5CA 2CQSA 3W7XA 2V3NA 4D4DA 3EQAA 2H6HB 3HXBB 4GTSB 5JPNB 1N4SB 4CJ1A 3RX8A 4LIXA 2P0VA 3M7LA 3M7BA 1WU4A 1IA7A 3HXFB 2B39A 4WU0A 3OEDA 3M78A 3S4BA 1KZOB 2FV1A 1XWTA 3S9VA 3KLSA 3W7TA 1NL4B 3EZ8A 3SDUA 1F9OA 2ZBLA 1DOGA 1O6QA 3GT5A 5FOBB 3W5MA 1O5MB 3H7LA 1FPPB 2EADA 3RJ3A 4V1SA 4GTVB 5KKBA 1LTXB 1GHQA 1N4PB 2V8JA 1O1RB 1S64B 3WIRA 3E33B 5CD2A 1C3DA 1QSJA 3VW5A 2ZISB 1FMIA 5JPMB 1JS4A 4D94A 2PMVA 3HXCB 2H6IB 3DSTB 3SFXB 1CLCA 2QNOA 2BB5A 4GTRB 3DSVB 1H39A 3M7EA 4TF4A 3QRYA 3EU8A 3EUVB 3M76A 2BB6A 1TNBB 2YIKA 2GH4A 1H3AA 3D5SA 5FO7B 1V7XA 1GAIA 1G9JA 4KKJA 2PN5A 4WVCA 2JJBA 2V8KA 3P5RA 4CJ0A 1SA4B 3T33A 4DOEA 3KSLB 4LNBB 2D5JA 3QDEA 3D5RA 4D4AA 4ONTA 1FO2A 3Q78B 2G02A 4KTRA 3PZ2B 3PMMA 1H54A 4JJJA 4AYPA 3HXDB 1GLMA 4BOKA 3RSYA 1HCUA 3P5PA 3QPFA 2EABA 4EHMB 4YDEB 3E30B 1UT9A 2BEDB 5DGQA 3H3KA 3ANIA 3VXDA 3TF4A 1O79A 1QQFA 3PZ3B 1NXCA 3SAEA 2F0YB 4L9PB 5CZLA 3KQ4A 3E6UA 4ZRPA 4AYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O5M B;  1TNU B;  1JCR B;  1FPP B;  3Q7F B;  3K7X A;  3SFY B;  1TN8 B;  3DSS B;  3EU5 B;  4LNG B;  4V1S A;  4GTV B;  3RJ3 A;  4D4C A;  1H3C A;  1LTX B;  1GHQ A;  1FT2 B;  2XWJ B;  3C72 B;  4GTT B;  1GXM A;  1MZC B;  1TNZ B;  1N4P B;  1JCS B;  2V8J A;  1TNY B;  1O1R B;  3CU7 A;  3Q79 B;  1S64 B;  4V1R A;  1O6H A;  3DSW B;  4BOJ A;  3DSU B;  3E33 B;  1C3D A;  1QSJ A;  1N94 B;  2V3P A;  2ZIS B;  4FXG B;  5JPM B;  4D94 A;  2PMV A;  3HXC B;  3G6J B;  1H36 A;  1GXN A;  2H6I B;  1TN6 B;  3DST B;  3SFX B;  1S63 B;  2BB5 A;  4YDO B;  2WIN B;  1UMP A;  4GTR B;  4ZH1 A;  3OXU A;  1GSZ A;  3DSV B;  1H39 A;  1NI1 B;  1H35 A;  2WY8 A;  1JCQ B;  1HZF A;  4KKI A;  3KSQ B;  1SQC A;  3Q75 B;  3EUV B;  2BB6 A;  2NOJ A;  1TNB B;  2ZIR B;  1SA5 B;  1H3B A;  1H3A A;  3E34 B;  4C1S A;  2R2L B;  3D5S A;  4MU9 A;  5FO7 B;  3DPY B;  4KKJ A;  1H37 A;  2IEJ B;  2PN5 A;  3E37 B;  5FO8 B;  2V8K A;  3PZ4 B;  3PZ1 B;  4LNV A;  2WII B;  1SA4 B;  2I07 B;  2WY7 A;  1GXO A;  3KSL B;  4LNB B;  1N95 B;  1O1S B;  2XQW A;  5FO9 B;  1TN7 B;  1KZP B;  3D5R A;  1W6J A;  1W6K A;  1QBQ B;  4D4A A;  1D8E B;  4ONT A;  1O6R A;  1R76 A;  3Q78 B;  3HXE B;  5AGD A;  1N4Q B;  4M76 A;  2G02 A;  1LD8 B;  1DCE B;  2H6G B;  4FXK B;  3PZ2 B;  2H6F B;  4GTO B;  2A73 B;  4ZRQ A;  3DSX B;  3HXD B;  4BOK A;  1O1T B;  1N4R B;  3DRA B;  3Q7A B;  2V8I A;  3SQC A;  2SQC A;  2XWB B;  4EHM B;  2V3N A;  4YDE B;  4D4D A;  1FT1 B;  2H6H B;  3E30 B;  3HXB B;  4GTS B;  5JPN B;  2BED B;  1N4S B;  2G0D A;  2BBC A;  1D8D B;  1X81 B;  4MBG B;  3HXF B;  2B39 A;  1O79 A;  1N9A B;  1QQF A;  3Q73 B;  4GTP B;  3OED A;  1KZO B;  3E32 B;  2GOX A;  3PZ3 B;  1LD7 B;  3KLS A;  2F0Y B;  4D4B A;  4L9P B;  1TNO B;  1NL4 B;  3KQ4 A;  4ZRP A;  4GTM B;  1O6Q A;  5FOB B;  4GTQ B; 
#chains in the Genus database with same CATH topology
 2RI9 A;  3PYA A;  2JF4 A;  3Q7F B;  1AYX A;  2Q1F A;  2OKX A;  4WVB A;  2EAC A;  3EU5 B;  3QSP A;  3QXF A;  4D4C A;  5ILY A;  3AFL A;  4GTT B;  2XWJ B;  3S4A A;  3QT9 A;  3S4D A;  3WKG A;  5EAS A;  4FUS A;  3SDQ A;  4FXG B;  1L2A A;  1LXK A;  5IK0 A;  3QFZ A;  1LF6 A;  1TN6 B;  1TF4 A;  5GY3 A;  1H35 A;  4FNV A;  3KSQ B;  3NFV A;  2ZIR B;  1AGM A;  3X17 A;  1J0N A;  2B4F A;  4C1S A;  3E34 B;  1NC5 A;  1HX9 A;  2R2L B;  3DPY B;  5DGR A;  2IEJ B;  3VSN A;  1KRF A;  2WYN A;  3E37 B;  3M02 A;  2WCO A;  3WKF A;  4LNV A;  3PZ1 B;  4GAX A;  1GXO A;  1N95 B;  1OJP A;  1W6K A;  1D8E B;  3K11 A;  1O6R A;  3HXE B;  1KWF A;  1VD5 A;  1WU6 A;  3ACT A;  4GTO B;  1GAH A;  3PYB A;  1WU5 A;  1O1T B;  3G4F A;  1WZZ A;  1V7V A;  3SDV A;  3WKH A;  2SQC A;  2XWB B;  1H12 A;  4ZH5 A;  3RX5 A;  4Z4J A;  2AHG A;  1CEM A;  1FT1 B;  4GL3 A;  5M7Y A;  3REN A;  4NEI A;  2BRP A;  2AHF A;  5IL3 A;  1FAE A;  2BBC A;  5IKA A;  1D8D B;  1HXC A;  4J5T A;  1G87 A;  3M75 A;  5IL8 A;  3Q73 B;  2XFG A;  5GW7 A;  5IKH A;  1LD7 B;  4D4B A;  1FT2 B;  1IA6 A;  1N22 A;  4FJQ A;  1EGU A;  1G9G A;  4GTQ B;  1TNU B;  4AYQ A;  1JCR B;  4CE7 A;  2A8Z A;  5ILJ A;  4ZG8 A;  3DSS B;  4LNG B;  1V5D A;  1RQ5 A;  1TNZ B;  1XWQ A;  1HXG A;  4EL8 A;  1IS9 A;  3CU7 A;  3NNB A;  4V1R A;  1KKT A;  5E2J A;  3RRS A;  1N94 B;  2DRS A;  2V3P A;  3M74 A;  4F13 A;  3G6J B;  1H36 A;  1F9D A;  1S63 B;  3W7S A;  2WIN B;  4ZH1 A;  3OXU A;  1N7Q A;  2EAE A;  4KKI A;  1N1Z A;  1SQC A;  1W3Y A;  2NOJ A;  1UG9 A;  1SA5 B;  2VN7 A;  3M72 A;  1X9D A;  2DRR A;  3E7J A;  4Q2B A;  1CB8 A;  2FBA A;  1RWC A;  5JMD A;  1V7W A;  3WIW A;  2E22 A;  4OK2 A;  4QT9 A;  5FO8 B;  5EAT A;  1LXM A;  2JG0 A;  1KFG A;  1FP3 A;  5FO9 B;  2XQW A;  1TN7 B;  5JMF A;  1KZP B;  3WC3 A;  1KSD A;  1J0M A;  1QBQ B;  3M73 A;  1HN0 A;  4L0G A;  5M7I A;  1FBW A;  1RWG A;  3WUX A;  1FBO A;  3ANJ A;  3QXQ A;  1FO3 A;  5AGD A;  3SDT A;  3D3I A;  3M71 A;  2RI8 A;  1LD8 B;  1DCE B;  1KSC A;  4FXK B;  2WDA A;  2ZZR A;  2H6F B;  3S4C A;  1OJO A;  3WKI A;  3M77 A;  1N4R B;  5GZK A;  3DRA B;  3Q7A B;  1N21 A;  2D8L A;  3SDR A;  2DRQ A;  1K72 A;  3WIQ A;  1H14 A;  2FUZ A;  3W7U A;  1ULV A;  2G0D A;  4OJZ A;  1X81 B;  1G6I A;  4MBG B;  2E24 A;  4KTP A;  2ONH A;  1N9A B;  2FV0 A;  4GTP B;  4L6X A;  3ACS A;  1HM3 A;  3QG0 A;  3E32 B;  2GOX A;  5CA3 A;  3QFY A;  2VN4 A;  1TNO B;  4YCR A;  4GTM B;  4Q88 A;  2NVP A;  2RGK A;  3K7X A;  3SFY B;  4XUV A;  3W7W A;  1TN8 B;  3E73 A;  1OJN A;  1H3C A;  3C72 B;  1GXM A;  1MZC B;  3G4D A;  3QWT A;  1JCS B;  3ON6 A;  1TNY B;  5ILZ A;  1KS8 A;  2CQT A;  3Q79 B;  1O6H A;  3DSW B;  3RX7 A;  4BOJ A;  3DSU B;  1LF9 A;  3GLY A;  3A3V A;  3H2W A;  4DI5 A;  2Z07 A;  1GXN A;  1FCE A;  4AYR A;  4DOD A;  4TXT A;  4YDO B;  1UMP A;  2F6D A;  5DHK A;  1GSZ A;  1NI1 B;  1XW2 A;  2WY8 A;  1JCQ B;  1HZF A;  3Q75 B;  3W5N A;  3QT3 A;  4Z4L A;  2BRW A;  5DHI A;  1H3B A;  2GZ6 A;  4MU9 A;  4MMI A;  2AFA A;  3AFJ A;  1H37 A;  5MEH A;  4WVA A;  1KRE A;  1H13 A;  1X1H A;  5IM1 A;  3PZ4 B;  3CIH A;  2WII B;  2I07 B;  2WY7 A;  1O1S B;  1W6J A;  2ONG A;  3M7C A;  1L1Y A;  3GZK A;  1R76 A;  1HM2 A;  1N4Q B;  4M76 A;  3ANK A;  2H6G B;  4OZV A;  1RWA A;  3P2C A;  1GA2 A;  2A73 B;  4ZRQ A;  1DL2 A;  3DSX B;  2DRO A;  2J5C A;  2V8I A;  3M00 A;  3SQC A;  1V5C A;  2CQS A;  3E80 A;  3W7X A;  3VSM A;  5IK9 A;  2V3N A;  4D4D A;  3EQA A;  2H6H B;  3HXB B;  4GTS B;  5C05 A;  5JPN B;  1N4S B;  4CJ1 A;  3RX8 A;  4LIX A;  2P0V A;  5IK6 A;  3M7L A;  3M7B A;  1N24 A;  2BRV X;  1X1J A;  1WU4 A;  1IA7 A;  3HXF B;  2B39 A;  4WU0 A;  3OED A;  3M78 A;  3S4B A;  4E1Y A;  1HXA A;  1KZO B;  3LZ9 A;  2FV1 A;  1XWT A;  3S9V A;  3KLS A;  1N23 A;  3N0F A;  3W7T A;  1NL4 B;  3EZ8 A;  3SDU A;  1F9O A;  2ZBL A;  1DOG A;  1O6Q A;  3GT5 A;  5FOB B;  2FUT A;  3W5M A;  1O5M B;  3H7L A;  5ILI A;  1FPP B;  2EAD A;  1RWF A;  4V1S A;  3RJ3 A;  4GTV B;  5KKB A;  1C82 A;  1N7N A;  1LTX B;  1GHQ A;  1N4P B;  1N1B A;  2V8J A;  1O1R B;  2X03 A;  1S64 B;  3WIR A;  4MMH A;  3E33 B;  5CD2 A;  1C3D A;  1QSJ A;  4RNQ A;  3VW5 A;  4OZW A;  1I8Q A;  1FMI A;  2ZIS B;  5JPM B;  1JS4 A;  4D94 A;  1F9G A;  5EAU A;  2PMV A;  3HXC B;  1F1S A;  2H6I B;  3DST B;  3SFX B;  1CLC A;  1RW9 A;  2QNO A;  2BB5 A;  1N7O A;  4GTR B;  3DSV B;  1H39 A;  1N7P A;  3M7E A;  4TF4 A;  1N20 A;  3QRY A;  3EU8 A;  1HMU A;  3EUV B;  3M76 A;  1X1I A;  2BB6 A;  1TNB B;  2YIK A;  2GH4 A;  4F10 A;  1H3A A;  3D5S A;  5FO7 B;  1HV6 A;  1V7X A;  1GAI A;  1G9J A;  4KKJ A;  2PN5 A;  4WVC A;  4OK4 A;  2JJB A;  2V8K A;  3P5R A;  4CJ0 A;  1SA4 B;  3T33 A;  4DOE A;  3KSL B;  4LNB B;  2D5J A;  3QDE A;  3D5R A;  4D4A A;  4ONT A;  5ILK A;  1FO2 A;  1QAZ A;  3Q78 B;  2G02 A;  4KTR A;  1HMW A;  3PZ2 B;  3M01 A;  3PMM A;  1H54 A;  4JJJ A;  4AYP A;  3HXD B;  1GLM A;  4BOK A;  3RSY A;  1HCU A;  5ILH A;  3P5P A;  3QPF A;  2EAB A;  4EHM B;  1OJM A;  4YDE B;  3N0G A;  1LOH A;  3E30 B;  1UT9 A;  2BED B;  5DGQ A;  1N7R A;  1RWH A;  3H3K A;  3ANI A;  3VXD A;  3TF4 A;  1O79 A;  1QQF A;  2FUQ A;  3A0O A;  5ILD A;  3PZ3 B;  1NXC A;  3SAE A;  2F0Y B;  4L9P B;  5CZL A;  3KQ4 A;  3E6U A;  4ZRP A;  4AYO A; 
#chains in the Genus database with same CATH homology
 2RI9 A;  3PYA A;  2JF4 A;  3Q7F B;  1AYX A;  2OKX A;  4WVB A;  2EAC A;  3EU5 B;  3QSP A;  3QXF A;  4D4C A;  4GTT B;  3S4A A;  2XWJ B;  3QT9 A;  3S4D A;  3WKG A;  4FUS A;  3SDQ A;  4FXG B;  1L2A A;  3QFZ A;  1LF6 A;  1TN6 B;  1TF4 A;  5GY3 A;  1H35 A;  3KSQ B;  2ZIR B;  1AGM A;  3X17 A;  2B4F A;  4C1S A;  3E34 B;  1NC5 A;  2R2L B;  3DPY B;  5DGR A;  2IEJ B;  1KRF A;  2WYN A;  3E37 B;  3WKF A;  4LNV A;  3PZ1 B;  1GXO A;  1N95 B;  1W6K A;  1D8E B;  3K11 A;  1O6R A;  3HXE B;  1KWF A;  1VD5 A;  1WU6 A;  3ACT A;  4GTO B;  1GAH A;  3PYB A;  1WU5 A;  1O1T B;  1WZZ A;  1V7V A;  3SDV A;  3WKH A;  2SQC A;  2XWB B;  1H12 A;  4ZH5 A;  3RX5 A;  4Z4J A;  2AHG A;  1CEM A;  1FT1 B;  4GL3 A;  5M7Y A;  3REN A;  2AHF A;  1FAE A;  2BBC A;  1D8D B;  4J5T A;  1G87 A;  3M75 A;  3Q73 B;  2XFG A;  5GW7 A;  1LD7 B;  4D4B A;  1FT2 B;  1IA6 A;  1G9G A;  4GTQ B;  1TNU B;  4AYQ A;  1JCR B;  4CE7 A;  2A8Z A;  4ZG8 A;  3DSS B;  4LNG B;  1V5D A;  1RQ5 A;  1TNZ B;  1XWQ A;  4EL8 A;  1IS9 A;  3CU7 A;  4V1R A;  1KKT A;  5E2J A;  3RRS A;  1N94 B;  2DRS A;  2V3P A;  3M74 A;  3G6J B;  1H36 A;  1F9D A;  1S63 B;  3W7S A;  2WIN B;  4ZH1 A;  3OXU A;  2EAE A;  4KKI A;  1SQC A;  2NOJ A;  1UG9 A;  1SA5 B;  2VN7 A;  3M72 A;  1X9D A;  2DRR A;  4Q2B A;  2FBA A;  1V7W A;  3WIW A;  4QT9 A;  5FO8 B;  2JG0 A;  1KFG A;  1FP3 A;  5FO9 B;  2XQW A;  1TN7 B;  1KZP B;  3WC3 A;  1KSD A;  1QBQ B;  3M73 A;  4L0G A;  5M7I A;  1FBW A;  3WUX A;  1FBO A;  3QXQ A;  3ANJ A;  1FO3 A;  5AGD A;  3SDT A;  3D3I A;  3M71 A;  2RI8 A;  1LD8 B;  1DCE B;  1KSC A;  4FXK B;  2ZZR A;  2H6F B;  3S4C A;  3WKI A;  3M77 A;  1N4R B;  5GZK A;  3DRA B;  3Q7A B;  2D8L A;  3SDR A;  2DRQ A;  1K72 A;  3WIQ A;  1H14 A;  2FUZ A;  3W7U A;  1ULV A;  2G0D A;  1X81 B;  1G6I A;  4MBG B;  4KTP A;  1N9A B;  2FV0 A;  4GTP B;  4L6X A;  3ACS A;  3QG0 A;  3E32 B;  2GOX A;  5CA3 A;  3QFY A;  2VN4 A;  1TNO B;  4YCR A;  4GTM B;  4Q88 A;  2NVP A;  2RGK A;  3K7X A;  3SFY B;  4XUV A;  3W7W A;  1TN8 B;  3E73 A;  1H3C A;  3C72 B;  1GXM A;  1MZC B;  3QWT A;  1JCS B;  3ON6 A;  1TNY B;  1KS8 A;  2CQT A;  3Q79 B;  1O6H A;  3DSW B;  3RX7 A;  4BOJ A;  3DSU B;  1LF9 A;  3GLY A;  3A3V A;  3H2W A;  2Z07 A;  1GXN A;  1FCE A;  4AYR A;  4DOD A;  4TXT A;  4YDO B;  1UMP A;  2F6D A;  1GSZ A;  1NI1 B;  1XW2 A;  2WY8 A;  1JCQ B;  1HZF A;  3Q75 B;  3W5N A;  3QT3 A;  4Z4L A;  1H3B A;  2GZ6 A;  4MU9 A;  2AFA A;  3AFJ A;  1H37 A;  5MEH A;  4WVA A;  1KRE A;  1H13 A;  3PZ4 B;  3CIH A;  2WII B;  2I07 B;  2WY7 A;  1O1S B;  1W6J A;  3M7C A;  1L1Y A;  3GZK A;  1R76 A;  1N4Q B;  4M76 A;  3ANK A;  2H6G B;  3P2C A;  1GA2 A;  2A73 B;  4ZRQ A;  1DL2 A;  3DSX B;  2DRO A;  2V8I A;  3SQC A;  1V5C A;  2CQS A;  3W7X A;  2V3N A;  4D4D A;  3EQA A;  2H6H B;  3HXB B;  4GTS B;  5JPN B;  1N4S B;  4CJ1 A;  3RX8 A;  4LIX A;  2P0V A;  3M7L A;  3M7B A;  1WU4 A;  1IA7 A;  3HXF B;  2B39 A;  4WU0 A;  3OED A;  3M78 A;  3S4B A;  1KZO B;  2FV1 A;  1XWT A;  3S9V A;  3KLS A;  3W7T A;  1NL4 B;  3EZ8 A;  3SDU A;  1F9O A;  2ZBL A;  1DOG A;  1O6Q A;  3GT5 A;  5FOB B;  3W5M A;  1O5M B;  3H7L A;  1FPP B;  2EAD A;  3RJ3 A;  4V1S A;  4GTV B;  5KKB A;  1LTX B;  1GHQ A;  1N4P B;  2V8J A;  1O1R B;  1S64 B;  3WIR A;  3E33 B;  5CD2 A;  1C3D A;  1QSJ A;  3VW5 A;  2ZIS B;  1FMI A;  5JPM B;  1JS4 A;  4D94 A;  2PMV A;  3HXC B;  2H6I B;  3DST B;  3SFX B;  1CLC A;  2QNO A;  2BB5 A;  4GTR B;  3DSV B;  1H39 A;  3M7E A;  4TF4 A;  3QRY A;  3EU8 A;  3EUV B;  3M76 A;  2BB6 A;  1TNB B;  2YIK A;  2GH4 A;  1H3A A;  3D5S A;  5FO7 B;  1V7X A;  1GAI A;  1G9J A;  4KKJ A;  2PN5 A;  4WVC A;  2JJB A;  2V8K A;  3P5R A;  4CJ0 A;  1SA4 B;  3T33 A;  4DOE A;  3KSL B;  4LNB B;  2D5J A;  3QDE A;  3D5R A;  4D4A A;  4ONT A;  1FO2 A;  3Q78 B;  2G02 A;  4KTR A;  3PZ2 B;  3PMM A;  1H54 A;  4JJJ A;  4AYP A;  3HXD B;  1GLM A;  4BOK A;  3RSY A;  1HCU A;  3P5P A;  3QPF A;  2EAB A;  4EHM B;  4YDE B;  3E30 B;  1UT9 A;  2BED B;  5DGQ A;  3H3K A;  3ANI A;  3VXD A;  3TF4 A;  1O79 A;  1QQF A;  3PZ3 B;  1NXC A;  3SAE A;  2F0Y B;  4L9P B;  5CZL A;  3KQ4 A;  3E6U A;  4ZRP A;  4AYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...