1HZFA

C4adg fragment of human complement factor c4a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
302
Chain Sequence
SPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWGQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords COMPLEMENT FACTOR C4A
publication title X-ray crystal structure of the C4d fragment of human complement component C4.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 302
sequence length 326
ec nomenclature ec 3.4.21.43: Classical-complement-pathway C3/C5 convertase.
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1hzfA00
2NOJA 4D4BA 1N9AB 1TNBB 3PZ4B 4GTRB 1N4RB 4KKJA 4D4CA 1O6HA 4V1RA 4GTQB 4GTPB 1NL4B 3D5SA 1TNZB 1H37A 2SQCA 1SA5B 1TNUB 3KLSA 5FO9B 1O1TB 3DSSB 3CU7A 2V8IA 3KQ4A 2G02A 3E34B 1GXOA 1N4QB 4D94A 1W6JA 3PZ1B 3RJ3A 4FXGB 4ZH1A 3HXFB 1H3BA 1O1RB 2V3NA 1O6QA 4YDOB 2XQWA 2WINB 3KSLB 4YDEB 1N95B 2H6IB 3E30B 3Q75B 2V8JA 3G6JB 3SFYB 1JCSB 1UMPA 2H6GB 2ZIRB 2B39A 2H6HB 3E33B 3HXCB 1TN7B 4L9PB 3EUVB 1N4PB 2BB5A 1GSZA 1O5MB 1GHQA 1LD8B 4GTOB 4GTTB 3DSXB 3Q79B 3D5RA 1DCEB 1H39A 1X81B 1H3AA 1O1SB 1W6KA 2I07B 3PZ2B 1TN8B 2WY7A 1GXMA 1N94B 1QBQB 2R2LB 4EHMB 1H36A 2IEJB 1N4SB 1R76A 4FXKB 3Q78B 1FPPB 1FT2B 3EU5B 1S63B 4BOJA 1S64B 2ZISB 2A73B 1JCRB 1NI1B 3HXEB 1TN6B 4V1SA 1O6RA 3Q7FB 4GTMB 4D4DA 1KZOB 5JPMB 3E32B 1TNOB 2BBCA 3KSQB 1C3DA 4ZRQA 4MBGB 2PN5A 1D8DB 3C72B 1JCQB 1FT1B 1QQFA 3DSTB 4GTVB 3DPYB 2V3PA 4LNBB 1HZFA 4M76A 3PZ3B 3HXDB 1KZPB 1MZCB 5JPNB 4ONTA 1LD7B 3Q73B 2BEDB 1H35A 2F0YB 4LNGB 2PMVA 3DRAB 4GTSB 1SQCA 3SFXB 4C1SA 5FO7B 3OXUA 3E37B 4ZRPA 5FO8B 4KKIA 1D8EB 2XWJB 2WY8A 2WIIB 3Q7AB 1SA4B 1TNYB 2XWBB 2V8KA 1GXNA 3DSWB 2G0DA 4BOKA 4D4AA 4MU9A 2BB6A 3SQCA 3DSVB 3HXBB 5FOBB 1O79A 2H6FB 1H3CA 1LTXB 4LNVA 3OEDA 2GOXA 1QSJA 3DSUB 3K7XA 5AGDA
chains in the Genus database with same CATH superfamily
4D4BA 5DGRA 2DRRA 4GTRB 1N4RB 5ILYA 4CE7A 4J5TA 4GTPB 3W7SA 1TNZB 3M76A 2D5JA 2FV1A 5CA3A 3M02A 3SDRA 3VSNA 4AYOA 1N4QB 3D3IA 1W6JA 3P5PA 5CZLA 1JS4A 3EZ8A 1FBOA 2WINB 2JF4A 3KSLB 3W7UA 4Z4JA 3E7JA 1UMPA 2H6GB 2AHFA 3S4AA 3M7LA 3HXCB 5GW7A 3RX7A 3ANKA 5IKHA 2VN4A 4FJQA 3RX8A 1O5MB 5ILHA 5ILDA 1CEMA 1LF9A 3Q79B 1N7OA 4EL8A 1GAIA 1N1ZA 1TN8B 2WYNA 2OKXA 1N4SB 3P5RA 1GA2A 3EU5B 1S63B 4BOJA 5JMFA 1KREA 1S64B 2ZISB 1JCRB 3SDVA 1NI1B 1UT9A 1HM2A 4KTRA 3WKIA 4GTMB 1KZOB 5JPMB 5IK6A 1K72A 3RSYA 3KSQB 5EATA 5EASA 4ZRQA 1KWFA 3WIQA 3N0FA 5EAUA 1QQFA 4GTVB 3HXDB 4TXTA 1KZPB 3Q73B 2BRVX 3EU8A 4AYQA 4C1SA 5FO7B 2ZZRA 3E37B 5FO8B 1D8EB 1LF6A 2BRPA 2WY8A 1RWCA 5M7IA 2EABA 3DSWB 1GXNA 3SAEA 4BOKA 4WVAA 4JJJA 4D4AA 2RI9A 2BB6A 3LZ9A 1H13A 3DSVB 3HXBB 1RQ5A 5FOBB 3P2CA 4RNQA 2H6FB 1LTXB 3T33A 4TF4A 4CJ1A 3ANJA 3OEDA 2GOXA 3K7XA 1J0MA 3AFLA 2NOJA 1IA6A 2RGKA 3X17A 2E24A 4D4CA 2JG0A 4V1RA 5M7YA 3QFYA 1NL4B 3W7XA 1FBWA 2CQTA 3WC3A 2A8ZA 3SDTA 1TNUB 4NEIA 4E1YA 3CU7A 5FO9B 4DODA 3KQ4A 5MEHA 5DHIA 4D94A 1KS8A 1O1RB 4YDEB 1X1JA 4MMHA 2D8LA 1HM3A 4F10A 2ZIRB 2H6HB 5C05A 3RX5A 1TN7B 3M74A 1X1IA 3EUVB 1OJMA 3E80A 3QT9A 3EQAA 1DOGA 1LD8B 1W3YA 2E22A 5IL8A 4GTOB 2QNOA 1CLCA 1EGUA 1H3AA 1KRFA 1O1SB 3M78A 3PZ2B 1H12A 1FAEA 1QBQB 3QRYA 1RW9A 3QXQA 3H7LA 1R76A 1N1BA 3S4CA 4DI5A 1FT2B 2GH4A 2A73B 1GAHA 4AYRA 1N24A 3M77A 1KFGA 3PMMA 2JJBA 3GLYA 2DRSA 1N7NA 3S9VA 3N0GA 3DPYB 5DGQA 4LNBB 1HX9A 3A3VA 4OZVA 4OZWA 5ILKA 1L2AA 1MZCB 1RWAA 1KKTA 3RRSA 2BEDB 2YIKA 3DRAB 1H14A 1SQCA 1X1HA 1HXGA 4ZRPA 1V7WA 3NNBA 1V7XA 3Q7AB 1AGMA 2XWBB 2G0DA 3M72A 4DOEA 1J0NA 4MU9A 3SQCA 1N20A 3QDEA 3W5NA 1WU6A 3GT5A 1O79A 1I8QA 1G6IA 5ILIA 1XWQA 5ILJA 1N7QA 1GLMA 3VXDA 1N9AB 1TNBB 3PZ4B 5GZKA 1V7VA 5CD2A 3QFZA 2AFAA 4GTQB 1ULVA 1F9GA 1TF4A 3VW5A 5GY3A 2GZ6A 1N22A 1F1SA 1AYXA 1SA5B 1O1TB 2V8IA 4Z4LA 2G02A 2P0VA 3H3KA 3SDUA 1GXOA 4FXGB 1LOHA 1H3BA 2V3NA 1IS9A 3K11A 1O6QA 1HN0A 1OJNA 1LXMA 1N95B 3E30B 1N21A 3S4DA 5IL3A 3ON6A 3Q75B 3SFYB 1JCSB 4L9PB 3W7TA 2DROA 2EACA 4WVBA 1RWFA 5JMDA 1GSZA 2XFGA 5E2JA 4QT9A 4GAXA 1OJPA 1F9OA 4Q88A 4GL3A 4GTTB 1XWTA 3D5RA 1DCEB 3QT3A 2ONHA 2FUQA 1X81B 1W6KA 2I07B 4FNVA 1GXMA 1N94B 2R2LB 4EHMB 3AFJA 3QG0A 5IK0A 3ANIA 5IM1A 1HMUA 2B4FA 1HV6A 1N7RA 1TN6B 1O6RA 1V5CA 2CQSA 1N7PA 3E32B 1HMWA 2FUZA 1C3DA 1H54A 2EADA 2PN5A 5IKAA 2RI8A 3C72B 3H2WA 1RWHA 1FT1B 4OK4A 3A0OA 1HZFA 2VN7A 4M76A 1NXCA 3PZ3B 3SDQA 4L6XA 4KTPA 3QWTA 4L0GA 1HXCA 1LD7B 3G4DA 5IK9A 1OJOA 1H35A 4LNGB 1RWGA 2PMVA 1X9DA 2FV0A 4KKIA 2XWJB 1SA4B 1TNYB 4YCRA 3CIHA 1G9GA 3WIWA 2DRQA 3QSPA 4Q2BA 2WDAA 4OJZA 1H3CA 4LNVA 3DSUB 2ONGA 3M01A 3WUXA 5DHKA 2Q1FA 1VD5A 4KKJA 1FO3A 1O6HA 3WIRA 3E73A 4WU0A 3S4BA 3M75A 3D5SA 3WKGA 3TF4A 1H37A 2SQCA 3RENA 3KLSA 2J5CA 3DSSB 3VSMA 3E34B 3W7WA 4AYPA 3M73A 1WZZA 4FUSA 3PZ1B 3RJ3A 4ZH1A 3ACSA 3HXFB 1FP3A 1HCUA 4YDOB 2BRWA 2XQWA 2H6IB 5KKBA 1CB8A 2V8JA 3G6JB 2B39A 3E33B 4ZH5A 2NVPA 1FO2A 1N4PB 2BB5A 1GHQA 3M7BA 3M7EA 2FBAA 2WCOA 1KSDA 3DSXB 3M00A 1H39A 1DL2A 1FCEA 4F13A 2WY7A 4ZG8A 3ACTA 1H36A 2IEJB 4FXKB 3Q78B 1QAZA 1FPPB 2FUTA 3E6UA 1UG9A 1LXKA 4WVCA 4LIXA 1IA7A 4CJ0A 1G87A 3HXEB 4V1SA 3Q7FB 4D4DA 4XUVA 1TNOB 2BBCA 3QXFA 3PYBA 2Z07A 4MBGB 1D8DB 2F6DA 3WKFA 1HXAA 1JCQB 3GZKA 3NFVA 1L1YA 3DSTB 3W5MA 2V3PA 1G9JA 3PYAA 2X03A 4ONTA 5JPNB 2F0YB 4GTSB 3SFXB 1NC5A 3OXUA 3M7CA 2ZBLA 2WIIB 1C82A 4OK2A 2V8KA 1KSCA 3G4FA 4MMIA 3QPFA 3WKHA 5ILZA 3M71A 1F9DA 1WU5A 1WU4A 1FMIA 2EAEA 1N23A 1V5DA 1QSJA 1XW2A 2AHGA 5AGDA
chains in the Genus database with same CATH topology
4D4BA 5DGRA 2DRRA 4GTRB 1N4RB 4CE7A 4J5TA 4GTPB 3W7SA 1TNZB 3M76A 2D5JA 2FV1A 5CA3A 3SDRA 4AYOA 1N4QB 3D3IA 1W6JA 3P5PA 5CZLA 1JS4A 3EZ8A 1FBOA 2WINB 2JF4A 3KSLB 3W7UA 4Z4JA 1UMPA 2H6GB 2AHFA 3S4AA 3M7LA 3HXCB 5GW7A 3RX7A 3ANKA 2VN4A 3RX8A 1O5MB 1CEMA 1LF9A 3Q79B 4EL8A 1GAIA 1TN8B 2WYNA 2OKXA 1N4SB 3P5RA 1GA2A 3EU5B 1S63B 4BOJA 1KREA 1S64B 2ZISB 1JCRB 3SDVA 1NI1B 1UT9A 4KTRA 3WKIA 4GTMB 1KZOB 5JPMB 3RSYA 1K72A 3KSQB 4ZRQA 1KWFA 3WIQA 1QQFA 4GTVB 3HXDB 4TXTA 1KZPB 3Q73B 3EU8A 4AYQA 4C1SA 5FO7B 2ZZRA 3E37B 5FO8B 1D8EB 1LF6A 2WY8A 5M7IA 2EABA 3DSWB 1GXNA 3SAEA 4BOKA 4WVAA 4JJJA 4D4AA 2RI9A 2BB6A 1H13A 3DSVB 3HXBB 1RQ5A 5FOBB 3P2CA 2H6FB 1LTXB 3T33A 4TF4A 4CJ1A 3ANJA 3OEDA 2GOXA 3K7XA 2NOJA 1IA6A 2RGKA 3X17A 4D4CA 2JG0A 4V1RA 5M7YA 3QFYA 1NL4B 3W7XA 1FBWA 2CQTA 3WC3A 2A8ZA 3SDTA 1TNUB 5FO9B 3CU7A 4DODA 3KQ4A 5MEHA 4D94A 1KS8A 1O1RB 4YDEB 2D8LA 2ZIRB 2H6HB 3RX5A 1TN7B 3M74A 3EUVB 3QT9A 3EQAA 1DOGA 1LD8B 4GTOB 2QNOA 1CLCA 3M78A 1H3AA 1KRFA 1O1SB 3PZ2B 1H12A 1FAEA 1QBQB 3QRYA 3QXQA 3H7LA 1R76A 3S4CA 1FT2B 2GH4A 2A73B 1GAHA 4AYRA 3M77A 1KFGA 3PMMA 2JJBA 3GLYA 2DRSA 3S9VA 3DPYB 5DGQA 4LNBB 3A3VA 1L2AA 1MZCB 1KKTA 3RRSA 2BEDB 2YIKA 3DRAB 1H14A 1SQCA 4ZRPA 1V7WA 1V7XA 3Q7AB 1AGMA 2XWBB 2G0DA 3M72A 4DOEA 4MU9A 3SQCA 3QDEA 3W5NA 1WU6A 3GT5A 1O79A 1G6IA 1XWQA 1GLMA 3VXDA 1N9AB 1TNBB 3PZ4B 5GZKA 1V7VA 5CD2A 3QFZA 2AFAA 4GTQB 1ULVA 1TF4A 3VW5A 5GY3A 2GZ6A 1AYXA 1SA5B 1O1TB 2V8IA 4Z4LA 2G02A 2P0VA 3H3KA 3SDUA 1GXOA 4FXGB 1H3BA 2V3NA 1IS9A 3K11A 1O6QA 1N95B 3E30B 3S4DA 3ON6A 3Q75B 3SFYB 1JCSB 4L9PB 3W7TA 2DROA 2EACA 4WVBA 1GSZA 2XFGA 5E2JA 4QT9A 1F9OA 4Q88A 4GL3A 4GTTB 1XWTA 3D5RA 1DCEB 3QT3A 1X81B 1W6KA 2I07B 1GXMA 1N94B 2R2LB 4EHMB 3AFJA 3QG0A 3ANIA 2B4FA 1TN6B 1O6RA 1V5CA 2CQSA 3E32B 2FUZA 1C3DA 1H54A 2EADA 2PN5A 2RI8A 3C72B 3H2WA 1FT1B 1HZFA 2VN7A 4M76A 1NXCA 3PZ3B 3SDQA 4L6XA 4KTPA 3QWTA 4L0GA 1LD7B 1H35A 4LNGB 2PMVA 1X9DA 2FV0A 4KKIA 2XWJB 1SA4B 1TNYB 4YCRA 3CIHA 1G9GA 3WIWA 2DRQA 3QSPA 4Q2BA 1H3CA 4LNVA 3DSUB 3WUXA 1VD5A 4KKJA 1FO3A 1O6HA 3WIRA 3E73A 4WU0A 3S4BA 3M75A 3D5SA 3WKGA 3TF4A 1H37A 2SQCA 3RENA 3KLSA 3DSSB 3E34B 3W7WA 4AYPA 3M73A 1WZZA 4FUSA 3PZ1B 3RJ3A 4ZH1A 3ACSA 3HXFB 1FP3A 1HCUA 4YDOB 2XQWA 2H6IB 5KKBA 2V8JA 3G6JB 2B39A 3E33B 4ZH5A 2NVPA 1FO2A 1N4PB 2BB5A 1GHQA 3M7BA 3M7EA 2FBAA 1KSDA 3DSXB 1H39A 1DL2A 1FCEA 2WY7A 4ZG8A 3ACTA 1H36A 2IEJB 4FXKB 3Q78B 1FPPB 3E6UA 1UG9A 4WVCA 4LIXA 1IA7A 4CJ0A 1G87A 3HXEB 4V1SA 3Q7FB 4D4DA 4XUVA 1TNOB 2BBCA 3QXFA 3PYBA 2Z07A 4MBGB 1D8DB 2F6DA 3WKFA 1JCQB 3GZKA 1L1YA 3DSTB 3W5MA 2V3PA 1G9JA 3PYAA 5JPNB 4ONTA 2F0YB 4GTSB 3SFXB 1NC5A 3OXUA 3M7CA 2ZBLA 2WIIB 2V8KA 1KSCA 3QPFA 3WKHA 3M71A 1F9DA 1WU5A 1WU4A 1FMIA 2EAEA 1V5DA 1QSJA 1XW2A 2AHGA 5AGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NOJ A;  4D4B A;  1N9A B;  1TNB B;  3PZ4 B;  4GTR B;  1N4R B;  4KKJ A;  4D4C A;  1O6H A;  4V1R A;  4GTQ B;  4GTP B;  1NL4 B;  3D5S A;  1TNZ B;  1H37 A;  2SQC A;  1SA5 B;  1TNU B;  3KLS A;  5FO9 B;  1O1T B;  3DSS B;  3CU7 A;  2V8I A;  3KQ4 A;  2G02 A;  3E34 B;  1GXO A;  1N4Q B;  4D94 A;  1W6J A;  3PZ1 B;  3RJ3 A;  4FXG B;  4ZH1 A;  3HXF B;  1H3B A;  1O1R B;  2V3N A;  1O6Q A;  4YDO B;  2XQW A;  2WIN B;  3KSL B;  4YDE B;  1N95 B;  2H6I B;  3E30 B;  3Q75 B;  2V8J A;  3G6J B;  3SFY B;  1JCS B;  1UMP A;  2H6G B;  2ZIR B;  2B39 A;  2H6H B;  3E33 B;  3HXC B;  1TN7 B;  4L9P B;  3EUV B;  1N4P B;  2BB5 A;  1GSZ A;  1O5M B;  1GHQ A;  1LD8 B;  4GTO B;  4GTT B;  3DSX B;  3Q79 B;  3D5R A;  1DCE B;  1H39 A;  1X81 B;  1H3A A;  1O1S B;  1W6K A;  2I07 B;  3PZ2 B;  1TN8 B;  2WY7 A;  1GXM A;  1N94 B;  1QBQ B;  2R2L B;  4EHM B;  1H36 A;  2IEJ B;  1N4S B;  1R76 A;  4FXK B;  3Q78 B;  1FPP B;  1FT2 B;  3EU5 B;  1S63 B;  4BOJ A;  1S64 B;  2ZIS B;  2A73 B;  1JCR B;  1NI1 B;  3HXE B;  1TN6 B;  4V1S A;  1O6R A;  3Q7F B;  4GTM B;  4D4D A;  1KZO B;  5JPM B;  3E32 B;  1TNO B;  2BBC A;  3KSQ B;  1C3D A;  4ZRQ A;  4MBG B;  2PN5 A;  1D8D B;  3C72 B;  1JCQ B;  1FT1 B;  1QQF A;  3DST B;  4GTV B;  3DPY B;  2V3P A;  4LNB B;  1HZF A;  4M76 A;  3PZ3 B;  3HXD B;  1KZP B;  1MZC B;  5JPN B;  4ONT A;  1LD7 B;  3Q73 B;  2BED B;  1H35 A;  2F0Y B;  4LNG B;  2PMV A;  3DRA B;  4GTS B;  1SQC A;  3SFX B;  4C1S A;  5FO7 B;  3OXU A;  3E37 B;  4ZRP A;  5FO8 B;  4KKI A;  1D8E B;  2XWJ B;  2WY8 A;  2WII B;  3Q7A B;  1SA4 B;  1TNY B;  2XWB B;  2V8K A;  1GXN A;  3DSW B;  2G0D A;  4BOK A;  4D4A A;  4MU9 A;  2BB6 A;  3SQC A;  3DSV B;  3HXB B;  5FOB B;  1O79 A;  2H6F B;  1H3C A;  1LTX B;  4LNV A;  3OED A;  2GOX A;  1QSJ A;  3DSU B;  3K7X A;  5AGD A; 
#chains in the Genus database with same CATH topology
 4D4B A;  5DGR A;  2DRR A;  4GTR B;  1N4R B;  5ILY A;  4CE7 A;  4J5T A;  4GTP B;  3W7S A;  1TNZ B;  3M76 A;  2D5J A;  2FV1 A;  5CA3 A;  3M02 A;  3SDR A;  3VSN A;  4AYO A;  1N4Q B;  3D3I A;  1W6J A;  3P5P A;  5CZL A;  1JS4 A;  3EZ8 A;  1FBO A;  2WIN B;  2JF4 A;  3KSL B;  3W7U A;  4Z4J A;  3E7J A;  1UMP A;  2H6G B;  2AHF A;  3S4A A;  3M7L A;  3HXC B;  5GW7 A;  3RX7 A;  3ANK A;  5IKH A;  2VN4 A;  4FJQ A;  3RX8 A;  1O5M B;  5ILH A;  5ILD A;  1CEM A;  1LF9 A;  3Q79 B;  1N7O A;  4EL8 A;  1GAI A;  1N1Z A;  1TN8 B;  2WYN A;  2OKX A;  1N4S B;  3P5R A;  1GA2 A;  3EU5 B;  1S63 B;  4BOJ A;  5JMF A;  1KRE A;  1S64 B;  2ZIS B;  1JCR B;  3SDV A;  1NI1 B;  1UT9 A;  1HM2 A;  4KTR A;  3WKI A;  4GTM B;  1KZO B;  5JPM B;  5IK6 A;  1K72 A;  3RSY A;  3KSQ B;  5EAT A;  5EAS A;  4ZRQ A;  1KWF A;  3WIQ A;  3N0F A;  5EAU A;  1QQF A;  4GTV B;  3HXD B;  4TXT A;  1KZP B;  3Q73 B;  2BRV X;  3EU8 A;  4AYQ A;  4C1S A;  5FO7 B;  2ZZR A;  3E37 B;  5FO8 B;  1D8E B;  1LF6 A;  2BRP A;  2WY8 A;  1RWC A;  5M7I A;  2EAB A;  3DSW B;  1GXN A;  3SAE A;  4BOK A;  4WVA A;  4JJJ A;  4D4A A;  2RI9 A;  2BB6 A;  3LZ9 A;  1H13 A;  3DSV B;  3HXB B;  1RQ5 A;  5FOB B;  3P2C A;  4RNQ A;  2H6F B;  1LTX B;  3T33 A;  4TF4 A;  4CJ1 A;  3ANJ A;  3OED A;  2GOX A;  3K7X A;  1J0M A;  3AFL A;  2NOJ A;  1IA6 A;  2RGK A;  3X17 A;  2E24 A;  4D4C A;  2JG0 A;  4V1R A;  5M7Y A;  3QFY A;  1NL4 B;  3W7X A;  1FBW A;  2CQT A;  3WC3 A;  2A8Z A;  3SDT A;  1TNU B;  4NEI A;  4E1Y A;  3CU7 A;  5FO9 B;  4DOD A;  3KQ4 A;  5MEH A;  5DHI A;  4D94 A;  1KS8 A;  1O1R B;  4YDE B;  1X1J A;  4MMH A;  2D8L A;  1HM3 A;  4F10 A;  2ZIR B;  2H6H B;  5C05 A;  3RX5 A;  1TN7 B;  3M74 A;  1X1I A;  3EUV B;  1OJM A;  3E80 A;  3QT9 A;  3EQA A;  1DOG A;  1LD8 B;  1W3Y A;  2E22 A;  5IL8 A;  4GTO B;  2QNO A;  1CLC A;  1EGU A;  1H3A A;  1KRF A;  1O1S B;  3M78 A;  3PZ2 B;  1H12 A;  1FAE A;  1QBQ B;  3QRY A;  1RW9 A;  3QXQ A;  3H7L A;  1R76 A;  1N1B A;  3S4C A;  4DI5 A;  1FT2 B;  2GH4 A;  2A73 B;  1GAH A;  4AYR A;  1N24 A;  3M77 A;  1KFG A;  3PMM A;  2JJB A;  3GLY A;  2DRS A;  1N7N A;  3S9V A;  3N0G A;  3DPY B;  5DGQ A;  4LNB B;  1HX9 A;  3A3V A;  4OZV A;  4OZW A;  5ILK A;  1L2A A;  1MZC B;  1RWA A;  1KKT A;  3RRS A;  2BED B;  2YIK A;  3DRA B;  1H14 A;  1SQC A;  1X1H A;  1HXG A;  4ZRP A;  1V7W A;  3NNB A;  1V7X A;  3Q7A B;  1AGM A;  2XWB B;  2G0D A;  3M72 A;  4DOE A;  1J0N A;  4MU9 A;  3SQC A;  1N20 A;  3QDE A;  3W5N A;  1WU6 A;  3GT5 A;  1O79 A;  1I8Q A;  1G6I A;  5ILI A;  1XWQ A;  5ILJ A;  1N7Q A;  1GLM A;  3VXD A;  1N9A B;  1TNB B;  3PZ4 B;  5GZK A;  1V7V A;  5CD2 A;  3QFZ A;  2AFA A;  4GTQ B;  1ULV A;  1F9G A;  1TF4 A;  3VW5 A;  5GY3 A;  2GZ6 A;  1N22 A;  1F1S A;  1AYX A;  1SA5 B;  1O1T B;  2V8I A;  4Z4L A;  2G02 A;  2P0V A;  3H3K A;  3SDU A;  1GXO A;  4FXG B;  1LOH A;  1H3B A;  2V3N A;  1IS9 A;  3K11 A;  1O6Q A;  1HN0 A;  1OJN A;  1LXM A;  1N95 B;  3E30 B;  1N21 A;  3S4D A;  5IL3 A;  3ON6 A;  3Q75 B;  3SFY B;  1JCS B;  4L9P B;  3W7T A;  2DRO A;  2EAC A;  4WVB A;  1RWF A;  5JMD A;  1GSZ A;  2XFG A;  5E2J A;  4QT9 A;  4GAX A;  1OJP A;  1F9O A;  4Q88 A;  4GL3 A;  4GTT B;  1XWT A;  3D5R A;  1DCE B;  3QT3 A;  2ONH A;  2FUQ A;  1X81 B;  1W6K A;  2I07 B;  4FNV A;  1GXM A;  1N94 B;  2R2L B;  4EHM B;  3AFJ A;  3QG0 A;  5IK0 A;  3ANI A;  5IM1 A;  1HMU A;  2B4F A;  1HV6 A;  1N7R A;  1TN6 B;  1O6R A;  1V5C A;  2CQS A;  1N7P A;  3E32 B;  1HMW A;  2FUZ A;  1C3D A;  1H54 A;  2EAD A;  2PN5 A;  5IKA A;  2RI8 A;  3C72 B;  3H2W A;  1RWH A;  1FT1 B;  4OK4 A;  3A0O A;  1HZF A;  2VN7 A;  4M76 A;  1NXC A;  3PZ3 B;  3SDQ A;  4L6X A;  4KTP A;  3QWT A;  4L0G A;  1HXC A;  1LD7 B;  3G4D A;  5IK9 A;  1OJO A;  1H35 A;  4LNG B;  1RWG A;  2PMV A;  1X9D A;  2FV0 A;  4KKI A;  2XWJ B;  1SA4 B;  1TNY B;  4YCR A;  3CIH A;  1G9G A;  3WIW A;  2DRQ A;  3QSP A;  4Q2B A;  2WDA A;  4OJZ A;  1H3C A;  4LNV A;  3DSU B;  2ONG A;  3M01 A;  3WUX A;  5DHK A;  2Q1F A;  1VD5 A;  4KKJ A;  1FO3 A;  1O6H A;  3WIR A;  3E73 A;  4WU0 A;  3S4B A;  3M75 A;  3D5S A;  3WKG A;  3TF4 A;  1H37 A;  2SQC A;  3REN A;  3KLS A;  2J5C A;  3DSS B;  3VSM A;  3E34 B;  3W7W A;  4AYP A;  3M73 A;  1WZZ A;  4FUS A;  3PZ1 B;  3RJ3 A;  4ZH1 A;  3ACS A;  3HXF B;  1FP3 A;  1HCU A;  4YDO B;  2BRW A;  2XQW A;  2H6I B;  5KKB A;  1CB8 A;  2V8J A;  3G6J B;  2B39 A;  3E33 B;  4ZH5 A;  2NVP A;  1FO2 A;  1N4P B;  2BB5 A;  1GHQ A;  3M7B A;  3M7E A;  2FBA A;  2WCO A;  1KSD A;  3DSX B;  3M00 A;  1H39 A;  1DL2 A;  1FCE A;  4F13 A;  2WY7 A;  4ZG8 A;  3ACT A;  1H36 A;  2IEJ B;  4FXK B;  3Q78 B;  1QAZ A;  1FPP B;  2FUT A;  3E6U A;  1UG9 A;  1LXK A;  4WVC A;  4LIX A;  1IA7 A;  4CJ0 A;  1G87 A;  3HXE B;  4V1S A;  3Q7F B;  4D4D A;  4XUV A;  1TNO B;  2BBC A;  3QXF A;  3PYB A;  2Z07 A;  4MBG B;  1D8D B;  2F6D A;  3WKF A;  1HXA A;  1JCQ B;  3GZK A;  3NFV A;  1L1Y A;  3DST B;  3W5M A;  2V3P A;  1G9J A;  3PYA A;  2X03 A;  4ONT A;  5JPN B;  2F0Y B;  4GTS B;  3SFX B;  1NC5 A;  3OXU A;  3M7C A;  2ZBL A;  2WII B;  1C82 A;  4OK2 A;  2V8K A;  1KSC A;  3G4F A;  4MMI A;  3QPF A;  3WKH A;  5ILZ A;  3M71 A;  1F9D A;  1WU5 A;  1WU4 A;  1FMI A;  2EAE A;  1N23 A;  1V5D A;  1QSJ A;  1XW2 A;  2AHG A;  5AGD A; 
#chains in the Genus database with same CATH homology
 4D4B A;  5DGR A;  2DRR A;  4GTR B;  1N4R B;  4CE7 A;  4J5T A;  4GTP B;  3W7S A;  1TNZ B;  3M76 A;  2D5J A;  2FV1 A;  5CA3 A;  3SDR A;  4AYO A;  1N4Q B;  3D3I A;  1W6J A;  3P5P A;  5CZL A;  1JS4 A;  3EZ8 A;  1FBO A;  2WIN B;  2JF4 A;  3KSL B;  3W7U A;  4Z4J A;  1UMP A;  2H6G B;  2AHF A;  3S4A A;  3M7L A;  3HXC B;  5GW7 A;  3RX7 A;  3ANK A;  2VN4 A;  3RX8 A;  1O5M B;  1CEM A;  1LF9 A;  3Q79 B;  4EL8 A;  1GAI A;  1TN8 B;  2WYN A;  2OKX A;  1N4S B;  3P5R A;  1GA2 A;  3EU5 B;  1S63 B;  4BOJ A;  1KRE A;  1S64 B;  2ZIS B;  1JCR B;  3SDV A;  1NI1 B;  1UT9 A;  4KTR A;  3WKI A;  4GTM B;  1KZO B;  5JPM B;  3RSY A;  1K72 A;  3KSQ B;  4ZRQ A;  1KWF A;  3WIQ A;  1QQF A;  4GTV B;  3HXD B;  4TXT A;  1KZP B;  3Q73 B;  3EU8 A;  4AYQ A;  4C1S A;  5FO7 B;  2ZZR A;  3E37 B;  5FO8 B;  1D8E B;  1LF6 A;  2WY8 A;  5M7I A;  2EAB A;  3DSW B;  1GXN A;  3SAE A;  4BOK A;  4WVA A;  4JJJ A;  4D4A A;  2RI9 A;  2BB6 A;  1H13 A;  3DSV B;  3HXB B;  1RQ5 A;  5FOB B;  3P2C A;  2H6F B;  1LTX B;  3T33 A;  4TF4 A;  4CJ1 A;  3ANJ A;  3OED A;  2GOX A;  3K7X A;  2NOJ A;  1IA6 A;  2RGK A;  3X17 A;  4D4C A;  2JG0 A;  4V1R A;  5M7Y A;  3QFY A;  1NL4 B;  3W7X A;  1FBW A;  2CQT A;  3WC3 A;  2A8Z A;  3SDT A;  1TNU B;  5FO9 B;  3CU7 A;  4DOD A;  3KQ4 A;  5MEH A;  4D94 A;  1KS8 A;  1O1R B;  4YDE B;  2D8L A;  2ZIR B;  2H6H B;  3RX5 A;  1TN7 B;  3M74 A;  3EUV B;  3QT9 A;  3EQA A;  1DOG A;  1LD8 B;  4GTO B;  2QNO A;  1CLC A;  3M78 A;  1H3A A;  1KRF A;  1O1S B;  3PZ2 B;  1H12 A;  1FAE A;  1QBQ B;  3QRY A;  3QXQ A;  3H7L A;  1R76 A;  3S4C A;  1FT2 B;  2GH4 A;  2A73 B;  1GAH A;  4AYR A;  3M77 A;  1KFG A;  3PMM A;  2JJB A;  3GLY A;  2DRS A;  3S9V A;  3DPY B;  5DGQ A;  4LNB B;  3A3V A;  1L2A A;  1MZC B;  1KKT A;  3RRS A;  2BED B;  2YIK A;  3DRA B;  1H14 A;  1SQC A;  4ZRP A;  1V7W A;  1V7X A;  3Q7A B;  1AGM A;  2XWB B;  2G0D A;  3M72 A;  4DOE A;  4MU9 A;  3SQC A;  3QDE A;  3W5N A;  1WU6 A;  3GT5 A;  1O79 A;  1G6I A;  1XWQ A;  1GLM A;  3VXD A;  1N9A B;  1TNB B;  3PZ4 B;  5GZK A;  1V7V A;  5CD2 A;  3QFZ A;  2AFA A;  4GTQ B;  1ULV A;  1TF4 A;  3VW5 A;  5GY3 A;  2GZ6 A;  1AYX A;  1SA5 B;  1O1T B;  2V8I A;  4Z4L A;  2G02 A;  2P0V A;  3H3K A;  3SDU A;  1GXO A;  4FXG B;  1H3B A;  2V3N A;  1IS9 A;  3K11 A;  1O6Q A;  1N95 B;  3E30 B;  3S4D A;  3ON6 A;  3Q75 B;  3SFY B;  1JCS B;  4L9P B;  3W7T A;  2DRO A;  2EAC A;  4WVB A;  1GSZ A;  2XFG A;  5E2J A;  4QT9 A;  1F9O A;  4Q88 A;  4GL3 A;  4GTT B;  1XWT A;  3D5R A;  1DCE B;  3QT3 A;  1X81 B;  1W6K A;  2I07 B;  1GXM A;  1N94 B;  2R2L B;  4EHM B;  3AFJ A;  3QG0 A;  3ANI A;  2B4F A;  1TN6 B;  1O6R A;  1V5C A;  2CQS A;  3E32 B;  2FUZ A;  1C3D A;  1H54 A;  2EAD A;  2PN5 A;  2RI8 A;  3C72 B;  3H2W A;  1FT1 B;  1HZF A;  2VN7 A;  4M76 A;  1NXC A;  3PZ3 B;  3SDQ A;  4L6X A;  4KTP A;  3QWT A;  4L0G A;  1LD7 B;  1H35 A;  4LNG B;  2PMV A;  1X9D A;  2FV0 A;  4KKI A;  2XWJ B;  1SA4 B;  1TNY B;  4YCR A;  3CIH A;  1G9G A;  3WIW A;  2DRQ A;  3QSP A;  4Q2B A;  1H3C A;  4LNV A;  3DSU B;  3WUX A;  1VD5 A;  4KKJ A;  1FO3 A;  1O6H A;  3WIR A;  3E73 A;  4WU0 A;  3S4B A;  3M75 A;  3D5S A;  3WKG A;  3TF4 A;  1H37 A;  2SQC A;  3REN A;  3KLS A;  3DSS B;  3E34 B;  3W7W A;  4AYP A;  3M73 A;  1WZZ A;  4FUS A;  3PZ1 B;  3RJ3 A;  4ZH1 A;  3ACS A;  3HXF B;  1FP3 A;  1HCU A;  4YDO B;  2XQW A;  2H6I B;  5KKB A;  2V8J A;  3G6J B;  2B39 A;  3E33 B;  4ZH5 A;  2NVP A;  1FO2 A;  1N4P B;  2BB5 A;  1GHQ A;  3M7B A;  3M7E A;  2FBA A;  1KSD A;  3DSX B;  1H39 A;  1DL2 A;  1FCE A;  2WY7 A;  4ZG8 A;  3ACT A;  1H36 A;  2IEJ B;  4FXK B;  3Q78 B;  1FPP B;  3E6U A;  1UG9 A;  4WVC A;  4LIX A;  1IA7 A;  4CJ0 A;  1G87 A;  3HXE B;  4V1S A;  3Q7F B;  4D4D A;  4XUV A;  1TNO B;  2BBC A;  3QXF A;  3PYB A;  2Z07 A;  4MBG B;  1D8D B;  2F6D A;  3WKF A;  1JCQ B;  3GZK A;  1L1Y A;  3DST B;  3W5M A;  2V3P A;  1G9J A;  3PYA A;  5JPN B;  4ONT A;  2F0Y B;  4GTS B;  3SFX B;  1NC5 A;  3OXU A;  3M7C A;  2ZBL A;  2WII B;  2V8K A;  1KSC A;  3QPF A;  3WKH A;  3M71 A;  1F9D A;  1WU5 A;  1WU4 A;  1FMI A;  2EAE A;  1V5D A;  1QSJ A;  1XW2 A;  2AHG A;  5AGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...