1HZFA

C4adg fragment of human complement factor c4a
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
302
Chain Sequence
SPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYALTLTKAPADLRGVAHNNLMAMAQETGDNLYWGQAPALWIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR C4A
publication title X-ray crystal structure of the C4d fragment of human complement component C4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 109
structure length 302
sequence length 326
ec nomenclature ec 3.4.21.43: Classical-complement-pathway C3/C5 convertase.
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07678 TED_complement A-macroglobulin TED domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1hzfA00
3SQCA 2V3PA 1LD8B 1N94B 2V8JA 4D94A 4YDOB 3DSVB 3OXUA 1S63B 1QBQB 3K7XA 1H3CA 3E32B 2H6GB 1GXMA 2I07B 2WIIB 4KKIA 1O1RB 4GTQB 4ONTA 1FT2B 1R76A 2R2LB 2ZIRB 3PZ4B 4YDEB 1N4QB 2IEJB 4GTVB 3CU7A 1O1TB 1O79A 2H6HB 3E30B 1GSZA 4C1SA 5FO8B 1SQCA 1GXNA 2WY7A 4LNGB 1N4SB 2G02A 1LTXB 2XQWA 3EUVB 1O6QA 1N9AB 1SA4B 1GXOA 1O6HA 1GHQA 4LNVA 2F0YB 1D8DB 2V8IA 1FT1B 3Q79B 3PZ2B 2H6FB 4D4AA 4BOKA 1H36A 4ZH1A 2PN5A 1C3DA 1NI1B 4GTMB 3SFXB 1H3AA 3KSQB 4FXGB 1FPPB 3HXBB 4GTSB 2V3NA 2BBCA 1N4RB 2BB5A 4GTTB 1D8EB 5FO7B 4GTOB 1W6KA 4D4CA 3G6JB 3Q7AB 1TNUB 3C72B 2ZISB 1JCQB 2GOXA 3KQ4A 1O5MB 1KZPB 3DSWB 3HXEB 3HXFB 3PZ3B 1TN7B 3E37B 3SFYB 1W6JA 1LD7B 1H37A 3E33B 2A73B 2NOJA 3HXCB 3EU5B 1JCSB 2BB6A 2SQCA 3Q73B 1H3BA 3Q78B 4FXKB 1TN8B 1SA5B 3Q75B 3DSUB 4D4BA 3Q7FB 1QSJA 4MBGB 4GTRB 1O6RA 1H35A 4L9PB 1X81B 2XWBB 2WY8A 3D5SA 4EHMB 1TNOB 2G0DA 2PMVA 1DCEB 5JPNB 1UMPA 1TNYB 1MZCB 1HZFA 2B39A 1QQFA 3DRAB 4KKJA 3KLSA 4V1RA 4ZRPA 3DSTB 4V1SA 1N95B 2WINB 4ZRQA 1NL4B 3PZ1B 3DSXB 2XWJB 5AGDA 2V8KA 2H6IB 3HXDB 4D4DA 4BOJA 1H39A 1S64B 3DSSB 3RJ3A 5FOBB 1JCRB 4M76A 4LNBB 1TNBB 3DPYB 1TNZB 3D5RA 3KSLB 3OEDA 4MU9A 5FO9B 1TN6B 4GTPB 3E34B 5JPMB 1KZOB 1N4PB 2BEDB 1O1SB
chains in the Genus database with same CATH superfamily
5EAUA 4WU0A 1LD8B 1W3YA 3OXUA 1S63B 1QBQB 2FV0A 3M72A 4KKIA 3W7UA 2I07B 2WIIB 2R2LB 3X17A 2IEJB 3CU7A 1O1TB 1O79A 1QAZA 1N7RA 2G02A 2XQWA 3EUVB 4AYRA 5ILJA 1O6QA 1N9AB 1SA4B 5ILDA 3EQAA 1GHQA 2ZZRA 2F0YB 3G4FA 2V8IA 3Q79B 4D4AA 1H13A 3WIWA 3QT9A 1WU6A 1WU4A 1C3DA 2Z07A 3KSQB 3QT3A 5IM1A 1DOGA 2BRVX 5IL8A 4FXGB 3HXBB 4GL3A 2NVPA 3E80A 5MEHA 3Q7AB 3SDQA 2AHFA 3M77A 1HXGA 2ZISB 1O5MB 3RENA 1KZPB 2A8ZA 3HXFB 5DHIA 1FMIA 3E37B 3EZ8A 3SDVA 1LD7B 1H37A 1X9DA 4FXKB 2J5CA 1TN8B 2FUTA 1SA5B 4L0GA 3Q7FB 4DI5A 3VSMA 5IKHA 5CD2A 3M74A 4GTRB 3S4CA 1X81B 3ANKA 1ULVA 2G0DA 1DCEB 5JPNB 1UMPA 2E22A 1MZCB 2B39A 2ONGA 4V1RA 4V1SA 4OK4A 1NL4B 3CIHA 3DSXB 1FO2A 5AGDA 1RWGA 3HXDB 4BOJA 5DHKA 4F10A 1TF4A 3DSSB 3N0GA 1G9GA 3RJ3A 3RX8A 3M75A 3PMMA 3QFYA 3D3IA 3KSLB 1J0MA 1TNZB 4GTPB 1L2AA 1RW9A 1N4PB 2BEDB 3ANIA 1XWTA 2V3PA 5C05A 2V8JA 4D94A 4AYQA 1H3CA 1G87A 3VSNA 2H6GB 4WVAA 3PZ4B 5GZKA 3H3KA 3M7LA 5IK0A 4C1SA 4DOEA 5FO8B 3ON6A 2E24A 1X1IA 1F1SA 1N4SB 2RI9A 4LNGB 1V5DA 3RX7A 4LNVA 5IL3A 3A3VA 4NEIA 1GA2A 1CB8A 1X1JA 2H6FB 1KFGA 2AHGA 4GTMB 3S4AA 1AYXA 1FAEA 1V7XA 3AFLA 3RRSA 3QWTA 2DRSA 2EAEA 1OJNA 4GTSB 2XFGA 3M7CA 4GTTB 1N4RB 1D8EB 5FO7B 3E7JA 1W6KA 3GLYA 2FUZA 3WIRA 4DODA 3C72B 1H14A 1J0NA 1JCQB 2WYNA 1HXCA 3KQ4A 1V5CA 1OJPA 3WKIA 3W5NA 3G4DA 4OJZA 4J5TA 2JJBA 1KKTA 5GY3A 2NOJA 3EU5B 1JCSB 2BB6A 4QT9A 2SQCA 3RX5A 3H7LA 4MMIA 4YCRA 2VN4A 1DL2A 1RWFA 1QSJA 5ILYA 4RNQA 2ZBLA 1RQ5A 3D5SA 1IA6A 1TNOB 2PMVA 4AYOA 3M76A 3M78A 1HM2A 1L1YA 1FO3A 1NC5A 3DRAB 4ZH5A 3KLSA 3DSTB 1OJOA 5GW7A 2WINB 3ANJA 1IS9A 3PZ1B 4CE7A 1NXCA 2V8KA 1HMWA 1FP3A 1WU5A 1G9JA 1H54A 1UT9A 5ILKA 2WDAA 5DGRA 5FO9B 3T33A 1TN6B 3W7WA 1N21A 5JPMB 1KWFA 2DRQA 1O1SB 3SQCA 3P5PA 1CLCA 3M00A 1N94B 3DSVB 3E6UA 5CA3A 3K7XA 1OJMA 1GXMA 2EACA 3M7BA 3ACSA 1O1RB 3PYAA 3WKFA 1FT2B 1R76A 5KKBA 5M7IA 2RGKA 2DROA 1V7WA 4GTVB 2X03A 2H6HB 3P5RA 3W7SA 3E30B 1GXNA 2F6DA 1HX9A 3QPFA 4TXTA 2WY7A 1F9GA 1LTXB 4Z4JA 2VN7A 1FBOA 1GXOA 1N1ZA 3QDEA 1CEMA 1XWQA 3LZ9A 1GAHA 1KSDA 3PZ2B 1V7VA 5IK9A 2AFAA 5ILZA 5IK6A 2Q1FA 4BOKA 1H36A 4ZH1A 2PN5A 1NI1B 3WIQA 2EADA 3H2WA 3WC3A 1N7QA 4KTPA 1FPPB 5E2JA 5JMFA 1N7NA 2V3NA 2BBCA 2BB5A 5DGQA 3M71A 3GZKA 3RSYA 3G6JB 3WUXA 2BRWA 1TNUB 3SDRA 5ILIA 1G6IA 3K11A 3A0OA 1UG9A 1N1BA 3VW5A 2D5JA 3WKGA 3SFYB 3QXQA 3M73A 1C82A 2A73B 3QSPA 5CZLA 1FCEA 3HXCB 4EL8A 1HXAA 1N23A 1HN0A 1LF6A 2FV1A 3Q75B 1LF9A 4OZWA 1RWAA 2CQTA 4MBGB 3W7XA 3P2CA 1O6RA 1H35A 4L9PB 4CJ1A 4EHMB 1N20A 3QXFA 4OZVA 4OK2A 1AGMA 1HZFA 2WCOA 1QQFA 4Q88A 1RWCA 3QRYA 4KKJA 2QNOA 4GAXA 2XWJB 1VD5A 2H6IB 4WVCA 2P0VA 2EABA 5FOBB 1XW2A 1GLMA 4M76A 1TNBB 2FUQA 3DPYB 3OEDA 2GH4A 3NFVA 4MU9A 1HV6A 1KZOB 1GSZA 3S9VA 1KS8A 1EGUA 1F9DA 1GAIA 1N7OA 4YDOB 5JMDA 3E32B 4F13A 4ONTA 2ZIRB 4YDEB 1N4QB 4JJJA 1HMUA 1HCUA 3N0FA 1SQCA 2FBAA 4ZG8A 3QFZA 4XUVA 5EATA 3SAEA 4L6XA 1H12A 1KREA 3WKHA 1F9OA 1LOHA 1LXKA 1O6HA 1D8DB 2B4FA 1FT1B 3QG0A 4AYPA 2BRPA 3SDUA 1JS4A 1KRFA 1KSCA 3SDTA 3SFXB 1H3AA 1N24A 3E73A 5EASA 1IA7A 4KTRA 1N7PA 3M7EA 4MMHA 2CQSA 1WZZA 3W7TA 2ONHA 4TF4A 4FJQA 2DRRA 3AFJA 4GTOB 4D4CA 3W5MA 4FNVA 3PYBA 2GOXA 2JG0A 3DSWB 3HXEB 3PZ3B 4Q2BA 1TN7B 1W6JA 3S4BA 2JF4A 3E33B 1LXMA 3EU8A 3ACTA 1H3BA 3Q73B 2RI8A 3Q78B 4E1YA 3DSUB 4D4BA 4WVBA 1K72A 3NNBA 4Z4LA 2XWBB 2WY8A 2OKXA 3GT5A 1I8QA 1TNYB 5IKAA 1HM3A 4ZRPA 2YIKA 1N95B 1X1HA 4ZRQA 3VXDA 1RWHA 2D8LA 4D4DA 1H39A 5ILHA 1S64B 4FUSA 3TF4A 1FBWA 1JCRB 4LNBB 2GZ6A 4CJ0A 5M7YA 3D5RA 3E34B 3S4DA 3M01A 3M02A 1N22A 4LIXA 4GTQB
chains in the Genus database with same CATH topology
4WU0A 1LD8B 3OXUA 1S63B 1QBQB 2FV0A 3M72A 4KKIA 3W7UA 2I07B 2WIIB 2R2LB 3X17A 2IEJB 3CU7A 1O1TB 1O79A 2G02A 2XQWA 3EUVB 4AYRA 1O6QA 1N9AB 1SA4B 3EQAA 1GHQA 2ZZRA 2F0YB 2V8IA 3Q79B 4D4AA 1H13A 3WIWA 3QT9A 1WU6A 1WU4A 1C3DA 2Z07A 3KSQB 3QT3A 1DOGA 4FXGB 3HXBB 4GL3A 2NVPA 5MEHA 3Q7AB 3SDQA 2AHFA 3M77A 2ZISB 1O5MB 3RENA 1KZPB 2A8ZA 3HXFB 1FMIA 3E37B 3EZ8A 3SDVA 1LD7B 1H37A 1X9DA 4FXKB 1TN8B 1SA5B 4L0GA 3Q7FB 5CD2A 3M74A 4GTRB 3S4CA 1X81B 3ANKA 1ULVA 2G0DA 1DCEB 5JPNB 1UMPA 1MZCB 2B39A 4V1RA 4V1SA 1NL4B 3CIHA 3DSXB 1FO2A 5AGDA 3HXDB 4BOJA 1TF4A 3DSSB 3RJ3A 1G9GA 3RX8A 3M75A 3PMMA 3QFYA 3D3IA 3KSLB 1TNZB 4GTPB 1L2AA 1N4PB 2BEDB 3ANIA 1XWTA 2V3PA 2V8JA 4D94A 4AYQA 1H3CA 1G87A 2H6GB 4WVAA 3PZ4B 5GZKA 3H3KA 3M7LA 4C1SA 4DOEA 5FO8B 3ON6A 4LNGB 1N4SB 2RI9A 1V5DA 3RX7A 4LNVA 3A3VA 1GA2A 2H6FB 1KFGA 2AHGA 4GTMB 3S4AA 1AYXA 1FAEA 1V7XA 3RRSA 3QWTA 2DRSA 2EAEA 4GTSB 2XFGA 3M7CA 4GTTB 1N4RB 1D8EB 5FO7B 1W6KA 3GLYA 2FUZA 3WIRA 4DODA 3C72B 1H14A 1JCQB 2WYNA 3KQ4A 1V5CA 3WKIA 3W5NA 4J5TA 2JJBA 1KKTA 5GY3A 2NOJA 3EU5B 1JCSB 2BB6A 4QT9A 2SQCA 3RX5A 3H7LA 4YCRA 2VN4A 1DL2A 1QSJA 2ZBLA 1RQ5A 3D5SA 1IA6A 1TNOB 2PMVA 4AYOA 3M76A 3M78A 1L1YA 1FO3A 1NC5A 3DRAB 4ZH5A 3KLSA 3DSTB 5GW7A 2WINB 3ANJA 1IS9A 3PZ1B 4CE7A 1NXCA 2V8KA 1FP3A 1WU5A 1G9JA 1H54A 1UT9A 5DGRA 5FO9B 3T33A 1TN6B 3W7WA 5JPMB 1KWFA 2DRQA 1O1SB 3SQCA 3P5PA 1CLCA 1N94B 3DSVB 3E6UA 5CA3A 3K7XA 1GXMA 2EACA 3M7BA 3ACSA 1O1RB 3PYAA 3WKFA 1FT2B 1R76A 5KKBA 5M7IA 2RGKA 2DROA 1V7WA 4GTVB 2H6HB 3P5RA 3W7SA 3E30B 1GXNA 2F6DA 4TXTA 3QPFA 2WY7A 1LTXB 4Z4JA 2VN7A 1FBOA 1GXOA 3QDEA 1CEMA 1XWQA 1GAHA 1KSDA 3PZ2B 1V7VA 2AFAA 4BOKA 1H36A 4ZH1A 2PN5A 1NI1B 3WIQA 2EADA 3H2WA 3WC3A 4KTPA 1FPPB 5E2JA 2V3NA 2BBCA 2BB5A 5DGQA 3M71A 3GZKA 3RSYA 3G6JB 3WUXA 1TNUB 3SDRA 1G6IA 3K11A 1UG9A 3VW5A 2D5JA 3WKGA 3SFYB 3QXQA 3M73A 2A73B 3QSPA 5CZLA 1FCEA 3HXCB 4EL8A 1LF6A 2FV1A 3Q75B 1LF9A 2CQTA 4MBGB 3W7XA 3P2CA 1O6RA 1H35A 4L9PB 4CJ1A 4EHMB 3QXFA 1AGMA 1HZFA 1QQFA 4Q88A 3QRYA 4KKJA 2QNOA 2XWJB 1VD5A 2H6IB 4WVCA 2P0VA 2EABA 5FOBB 1XW2A 1GLMA 4M76A 1TNBB 3DPYB 3OEDA 2GH4A 4MU9A 1KZOB 1GSZA 3S9VA 1KS8A 1F9DA 1GAIA 4YDOB 3E32B 4ONTA 2ZIRB 4YDEB 1N4QB 4JJJA 1HCUA 1SQCA 2FBAA 4ZG8A 3QFZA 4XUVA 3SAEA 4L6XA 1H12A 1KREA 3WKHA 1F9OA 1O6HA 1D8DB 2B4FA 1FT1B 3QG0A 4AYPA 3SDUA 1JS4A 1KRFA 1KSCA 3SDTA 3SFXB 1H3AA 3E73A 1IA7A 4KTRA 3M7EA 2CQSA 1WZZA 3W7TA 4TF4A 2DRRA 3AFJA 4GTOB 4D4CA 3W5MA 3PYBA 2GOXA 2JG0A 3DSWB 3HXEB 3PZ3B 4Q2BA 1TN7B 1W6JA 3S4BA 2JF4A 3E33B 3EU8A 3ACTA 1H3BA 3Q73B 2RI8A 3Q78B 3DSUB 4D4BA 4WVBA 1K72A 4Z4LA 2XWBB 2WY8A 2OKXA 3GT5A 1TNYB 4ZRPA 2YIKA 1N95B 4ZRQA 3VXDA 2D8LA 4D4DA 1H39A 1S64B 4FUSA 3TF4A 1FBWA 1JCRB 4LNBB 2GZ6A 4CJ0A 5M7YA 3D5RA 3E34B 3S4DA 4LIXA 4GTQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQC A;  2V3P A;  1LD8 B;  1N94 B;  2V8J A;  4D94 A;  4YDO B;  3DSV B;  3OXU A;  1S63 B;  1QBQ B;  3K7X A;  1H3C A;  3E32 B;  2H6G B;  1GXM A;  2I07 B;  2WII B;  4KKI A;  1O1R B;  4GTQ B;  4ONT A;  1FT2 B;  1R76 A;  2R2L B;  2ZIR B;  3PZ4 B;  4YDE B;  1N4Q B;  2IEJ B;  4GTV B;  3CU7 A;  1O1T B;  1O79 A;  2H6H B;  3E30 B;  1GSZ A;  4C1S A;  5FO8 B;  1SQC A;  1GXN A;  2WY7 A;  4LNG B;  1N4S B;  2G02 A;  1LTX B;  2XQW A;  3EUV B;  1O6Q A;  1N9A B;  1SA4 B;  1GXO A;  1O6H A;  1GHQ A;  4LNV A;  2F0Y B;  1D8D B;  2V8I A;  1FT1 B;  3Q79 B;  3PZ2 B;  2H6F B;  4D4A A;  4BOK A;  1H36 A;  4ZH1 A;  2PN5 A;  1C3D A;  1NI1 B;  4GTM B;  3SFX B;  1H3A A;  3KSQ B;  4FXG B;  1FPP B;  3HXB B;  4GTS B;  2V3N A;  2BBC A;  1N4R B;  2BB5 A;  4GTT B;  1D8E B;  5FO7 B;  4GTO B;  1W6K A;  4D4C A;  3G6J B;  3Q7A B;  1TNU B;  3C72 B;  2ZIS B;  1JCQ B;  2GOX A;  3KQ4 A;  1O5M B;  1KZP B;  3DSW B;  3HXE B;  3HXF B;  3PZ3 B;  1TN7 B;  3E37 B;  3SFY B;  1W6J A;  1LD7 B;  1H37 A;  3E33 B;  2A73 B;  2NOJ A;  3HXC B;  3EU5 B;  1JCS B;  2BB6 A;  2SQC A;  3Q73 B;  1H3B A;  3Q78 B;  4FXK B;  1TN8 B;  1SA5 B;  3Q75 B;  3DSU B;  4D4B A;  3Q7F B;  1QSJ A;  4MBG B;  4GTR B;  1O6R A;  1H35 A;  4L9P B;  1X81 B;  2XWB B;  2WY8 A;  3D5S A;  4EHM B;  1TNO B;  2G0D A;  2PMV A;  1DCE B;  5JPN B;  1UMP A;  1TNY B;  1MZC B;  1HZF A;  2B39 A;  1QQF A;  3DRA B;  4KKJ A;  3KLS A;  4V1R A;  4ZRP A;  3DST B;  4V1S A;  1N95 B;  2WIN B;  4ZRQ A;  1NL4 B;  3PZ1 B;  3DSX B;  2XWJ B;  5AGD A;  2V8K A;  2H6I B;  3HXD B;  4D4D A;  4BOJ A;  1H39 A;  1S64 B;  3DSS B;  3RJ3 A;  5FOB B;  1JCR B;  4M76 A;  4LNB B;  1TNB B;  3DPY B;  1TNZ B;  3D5R A;  3KSL B;  3OED A;  4MU9 A;  5FO9 B;  1TN6 B;  4GTP B;  3E34 B;  5JPM B;  1KZO B;  1N4P B;  2BED B;  1O1S B; 
#chains in the Genus database with same CATH topology
 5EAU A;  4WU0 A;  1LD8 B;  1W3Y A;  3OXU A;  1S63 B;  1QBQ B;  2FV0 A;  3M72 A;  4KKI A;  3W7U A;  2I07 B;  2WII B;  2R2L B;  3X17 A;  2IEJ B;  3CU7 A;  1O1T B;  1O79 A;  1QAZ A;  1N7R A;  2G02 A;  2XQW A;  3EUV B;  4AYR A;  5ILJ A;  1O6Q A;  1N9A B;  1SA4 B;  5ILD A;  3EQA A;  1GHQ A;  2ZZR A;  2F0Y B;  3G4F A;  2V8I A;  3Q79 B;  4D4A A;  1H13 A;  3WIW A;  3QT9 A;  1WU6 A;  1WU4 A;  1C3D A;  2Z07 A;  3KSQ B;  3QT3 A;  5IM1 A;  1DOG A;  2BRV X;  5IL8 A;  4FXG B;  3HXB B;  4GL3 A;  2NVP A;  3E80 A;  5MEH A;  3Q7A B;  3SDQ A;  2AHF A;  3M77 A;  1HXG A;  2ZIS B;  1O5M B;  3REN A;  1KZP B;  2A8Z A;  3HXF B;  5DHI A;  1FMI A;  3E37 B;  3EZ8 A;  3SDV A;  1LD7 B;  1H37 A;  1X9D A;  4FXK B;  2J5C A;  1TN8 B;  2FUT A;  1SA5 B;  4L0G A;  3Q7F B;  4DI5 A;  3VSM A;  5IKH A;  5CD2 A;  3M74 A;  4GTR B;  3S4C A;  1X81 B;  3ANK A;  1ULV A;  2G0D A;  1DCE B;  5JPN B;  1UMP A;  2E22 A;  1MZC B;  2B39 A;  2ONG A;  4V1R A;  4V1S A;  4OK4 A;  1NL4 B;  3CIH A;  3DSX B;  1FO2 A;  5AGD A;  1RWG A;  3HXD B;  4BOJ A;  5DHK A;  4F10 A;  1TF4 A;  3DSS B;  3N0G A;  1G9G A;  3RJ3 A;  3RX8 A;  3M75 A;  3PMM A;  3QFY A;  3D3I A;  3KSL B;  1J0M A;  1TNZ B;  4GTP B;  1L2A A;  1RW9 A;  1N4P B;  2BED B;  3ANI A;  1XWT A;  2V3P A;  5C05 A;  2V8J A;  4D94 A;  4AYQ A;  1H3C A;  1G87 A;  3VSN A;  2H6G B;  4WVA A;  3PZ4 B;  5GZK A;  3H3K A;  3M7L A;  5IK0 A;  4C1S A;  4DOE A;  5FO8 B;  3ON6 A;  2E24 A;  1X1I A;  1F1S A;  1N4S B;  2RI9 A;  4LNG B;  1V5D A;  3RX7 A;  4LNV A;  5IL3 A;  3A3V A;  4NEI A;  1GA2 A;  1CB8 A;  1X1J A;  2H6F B;  1KFG A;  2AHG A;  4GTM B;  3S4A A;  1AYX A;  1FAE A;  1V7X A;  3AFL A;  3RRS A;  3QWT A;  2DRS A;  2EAE A;  1OJN A;  4GTS B;  2XFG A;  3M7C A;  4GTT B;  1N4R B;  1D8E B;  5FO7 B;  3E7J A;  1W6K A;  3GLY A;  2FUZ A;  3WIR A;  4DOD A;  3C72 B;  1H14 A;  1J0N A;  1JCQ B;  2WYN A;  1HXC A;  3KQ4 A;  1V5C A;  1OJP A;  3WKI A;  3W5N A;  3G4D A;  4OJZ A;  4J5T A;  2JJB A;  1KKT A;  5GY3 A;  2NOJ A;  3EU5 B;  1JCS B;  2BB6 A;  4QT9 A;  2SQC A;  3RX5 A;  3H7L A;  4MMI A;  4YCR A;  2VN4 A;  1DL2 A;  1RWF A;  1QSJ A;  5ILY A;  4RNQ A;  2ZBL A;  1RQ5 A;  3D5S A;  1IA6 A;  1TNO B;  2PMV A;  4AYO A;  3M76 A;  3M78 A;  1HM2 A;  1L1Y A;  1FO3 A;  1NC5 A;  3DRA B;  4ZH5 A;  3KLS A;  3DST B;  1OJO A;  5GW7 A;  2WIN B;  3ANJ A;  1IS9 A;  3PZ1 B;  4CE7 A;  1NXC A;  2V8K A;  1HMW A;  1FP3 A;  1WU5 A;  1G9J A;  1H54 A;  1UT9 A;  5ILK A;  2WDA A;  5DGR A;  5FO9 B;  3T33 A;  1TN6 B;  3W7W A;  1N21 A;  5JPM B;  1KWF A;  2DRQ A;  1O1S B;  3SQC A;  3P5P A;  1CLC A;  3M00 A;  1N94 B;  3DSV B;  3E6U A;  5CA3 A;  3K7X A;  1OJM A;  1GXM A;  2EAC A;  3M7B A;  3ACS A;  1O1R B;  3PYA A;  3WKF A;  1FT2 B;  1R76 A;  5KKB A;  5M7I A;  2RGK A;  2DRO A;  1V7W A;  4GTV B;  2X03 A;  2H6H B;  3P5R A;  3W7S A;  3E30 B;  1GXN A;  2F6D A;  1HX9 A;  3QPF A;  4TXT A;  2WY7 A;  1F9G A;  1LTX B;  4Z4J A;  2VN7 A;  1FBO A;  1GXO A;  1N1Z A;  3QDE A;  1CEM A;  1XWQ A;  3LZ9 A;  1GAH A;  1KSD A;  3PZ2 B;  1V7V A;  5IK9 A;  2AFA A;  5ILZ A;  5IK6 A;  2Q1F A;  4BOK A;  1H36 A;  4ZH1 A;  2PN5 A;  1NI1 B;  3WIQ A;  2EAD A;  3H2W A;  3WC3 A;  1N7Q A;  4KTP A;  1FPP B;  5E2J A;  5JMF A;  1N7N A;  2V3N A;  2BBC A;  2BB5 A;  5DGQ A;  3M71 A;  3GZK A;  3RSY A;  3G6J B;  3WUX A;  2BRW A;  1TNU B;  3SDR A;  5ILI A;  1G6I A;  3K11 A;  3A0O A;  1UG9 A;  1N1B A;  3VW5 A;  2D5J A;  3WKG A;  3SFY B;  3QXQ A;  3M73 A;  1C82 A;  2A73 B;  3QSP A;  5CZL A;  1FCE A;  3HXC B;  4EL8 A;  1HXA A;  1N23 A;  1HN0 A;  1LF6 A;  2FV1 A;  3Q75 B;  1LF9 A;  4OZW A;  1RWA A;  2CQT A;  4MBG B;  3W7X A;  3P2C A;  1O6R A;  1H35 A;  4L9P B;  4CJ1 A;  4EHM B;  1N20 A;  3QXF A;  4OZV A;  4OK2 A;  1AGM A;  1HZF A;  2WCO A;  1QQF A;  4Q88 A;  1RWC A;  3QRY A;  4KKJ A;  2QNO A;  4GAX A;  2XWJ B;  1VD5 A;  2H6I B;  4WVC A;  2P0V A;  2EAB A;  5FOB B;  1XW2 A;  1GLM A;  4M76 A;  1TNB B;  2FUQ A;  3DPY B;  3OED A;  2GH4 A;  3NFV A;  4MU9 A;  1HV6 A;  1KZO B;  1GSZ A;  3S9V A;  1KS8 A;  1EGU A;  1F9D A;  1GAI A;  1N7O A;  4YDO B;  5JMD A;  3E32 B;  4F13 A;  4ONT A;  2ZIR B;  4YDE B;  1N4Q B;  4JJJ A;  1HMU A;  1HCU A;  3N0F A;  1SQC A;  2FBA A;  4ZG8 A;  3QFZ A;  4XUV A;  5EAT A;  3SAE A;  4L6X A;  1H12 A;  1KRE A;  3WKH A;  1F9O A;  1LOH A;  1LXK A;  1O6H A;  1D8D B;  2B4F A;  1FT1 B;  3QG0 A;  4AYP A;  2BRP A;  3SDU A;  1JS4 A;  1KRF A;  1KSC A;  3SDT A;  3SFX B;  1H3A A;  1N24 A;  3E73 A;  5EAS A;  1IA7 A;  4KTR A;  1N7P A;  3M7E A;  4MMH A;  2CQS A;  1WZZ A;  3W7T A;  2ONH A;  4TF4 A;  4FJQ A;  2DRR A;  3AFJ A;  4GTO B;  4D4C A;  3W5M A;  4FNV A;  3PYB A;  2GOX A;  2JG0 A;  3DSW B;  3HXE B;  3PZ3 B;  4Q2B A;  1TN7 B;  1W6J A;  3S4B A;  2JF4 A;  3E33 B;  1LXM A;  3EU8 A;  3ACT A;  1H3B A;  3Q73 B;  2RI8 A;  3Q78 B;  4E1Y A;  3DSU B;  4D4B A;  4WVB A;  1K72 A;  3NNB A;  4Z4L A;  2XWB B;  2WY8 A;  2OKX A;  3GT5 A;  1I8Q A;  1TNY B;  5IKA A;  1HM3 A;  4ZRP A;  2YIK A;  1N95 B;  1X1H A;  4ZRQ A;  3VXD A;  1RWH A;  2D8L A;  4D4D A;  1H39 A;  5ILH A;  1S64 B;  4FUS A;  3TF4 A;  1FBW A;  1JCR B;  4LNB B;  2GZ6 A;  4CJ0 A;  5M7Y A;  3D5R A;  3E34 B;  3S4D A;  3M01 A;  3M02 A;  1N22 A;  4LIX A;  4GTQ B; 
#chains in the Genus database with same CATH homology
 4WU0 A;  1LD8 B;  3OXU A;  1S63 B;  1QBQ B;  2FV0 A;  3M72 A;  4KKI A;  3W7U A;  2I07 B;  2WII B;  2R2L B;  3X17 A;  2IEJ B;  3CU7 A;  1O1T B;  1O79 A;  2G02 A;  2XQW A;  3EUV B;  4AYR A;  1O6Q A;  1N9A B;  1SA4 B;  3EQA A;  1GHQ A;  2ZZR A;  2F0Y B;  2V8I A;  3Q79 B;  4D4A A;  1H13 A;  3WIW A;  3QT9 A;  1WU6 A;  1WU4 A;  1C3D A;  2Z07 A;  3KSQ B;  3QT3 A;  1DOG A;  4FXG B;  3HXB B;  4GL3 A;  2NVP A;  5MEH A;  3Q7A B;  3SDQ A;  2AHF A;  3M77 A;  2ZIS B;  1O5M B;  3REN A;  1KZP B;  2A8Z A;  3HXF B;  1FMI A;  3E37 B;  3EZ8 A;  3SDV A;  1LD7 B;  1H37 A;  1X9D A;  4FXK B;  1TN8 B;  1SA5 B;  4L0G A;  3Q7F B;  5CD2 A;  3M74 A;  4GTR B;  3S4C A;  1X81 B;  3ANK A;  1ULV A;  2G0D A;  1DCE B;  5JPN B;  1UMP A;  1MZC B;  2B39 A;  4V1R A;  4V1S A;  1NL4 B;  3CIH A;  3DSX B;  1FO2 A;  5AGD A;  3HXD B;  4BOJ A;  1TF4 A;  3DSS B;  3RJ3 A;  1G9G A;  3RX8 A;  3M75 A;  3PMM A;  3QFY A;  3D3I A;  3KSL B;  1TNZ B;  4GTP B;  1L2A A;  1N4P B;  2BED B;  3ANI A;  1XWT A;  2V3P A;  2V8J A;  4D94 A;  4AYQ A;  1H3C A;  1G87 A;  2H6G B;  4WVA A;  3PZ4 B;  5GZK A;  3H3K A;  3M7L A;  4C1S A;  4DOE A;  5FO8 B;  3ON6 A;  4LNG B;  1N4S B;  2RI9 A;  1V5D A;  3RX7 A;  4LNV A;  3A3V A;  1GA2 A;  2H6F B;  1KFG A;  2AHG A;  4GTM B;  3S4A A;  1AYX A;  1FAE A;  1V7X A;  3RRS A;  3QWT A;  2DRS A;  2EAE A;  4GTS B;  2XFG A;  3M7C A;  4GTT B;  1N4R B;  1D8E B;  5FO7 B;  1W6K A;  3GLY A;  2FUZ A;  3WIR A;  4DOD A;  3C72 B;  1H14 A;  1JCQ B;  2WYN A;  3KQ4 A;  1V5C A;  3WKI A;  3W5N A;  4J5T A;  2JJB A;  1KKT A;  5GY3 A;  2NOJ A;  3EU5 B;  1JCS B;  2BB6 A;  4QT9 A;  2SQC A;  3RX5 A;  3H7L A;  4YCR A;  2VN4 A;  1DL2 A;  1QSJ A;  2ZBL A;  1RQ5 A;  3D5S A;  1IA6 A;  1TNO B;  2PMV A;  4AYO A;  3M76 A;  3M78 A;  1L1Y A;  1FO3 A;  1NC5 A;  3DRA B;  4ZH5 A;  3KLS A;  3DST B;  5GW7 A;  2WIN B;  3ANJ A;  1IS9 A;  3PZ1 B;  4CE7 A;  1NXC A;  2V8K A;  1FP3 A;  1WU5 A;  1G9J A;  1H54 A;  1UT9 A;  5DGR A;  5FO9 B;  3T33 A;  1TN6 B;  3W7W A;  5JPM B;  1KWF A;  2DRQ A;  1O1S B;  3SQC A;  3P5P A;  1CLC A;  1N94 B;  3DSV B;  3E6U A;  5CA3 A;  3K7X A;  1GXM A;  2EAC A;  3M7B A;  3ACS A;  1O1R B;  3PYA A;  3WKF A;  1FT2 B;  1R76 A;  5KKB A;  5M7I A;  2RGK A;  2DRO A;  1V7W A;  4GTV B;  2H6H B;  3P5R A;  3W7S A;  3E30 B;  1GXN A;  2F6D A;  4TXT A;  3QPF A;  2WY7 A;  1LTX B;  4Z4J A;  2VN7 A;  1FBO A;  1GXO A;  3QDE A;  1CEM A;  1XWQ A;  1GAH A;  1KSD A;  3PZ2 B;  1V7V A;  2AFA A;  4BOK A;  1H36 A;  4ZH1 A;  2PN5 A;  1NI1 B;  3WIQ A;  2EAD A;  3H2W A;  3WC3 A;  4KTP A;  1FPP B;  5E2J A;  2V3N A;  2BBC A;  2BB5 A;  5DGQ A;  3M71 A;  3GZK A;  3RSY A;  3G6J B;  3WUX A;  1TNU B;  3SDR A;  1G6I A;  3K11 A;  1UG9 A;  3VW5 A;  2D5J A;  3WKG A;  3SFY B;  3QXQ A;  3M73 A;  2A73 B;  3QSP A;  5CZL A;  1FCE A;  3HXC B;  4EL8 A;  1LF6 A;  2FV1 A;  3Q75 B;  1LF9 A;  2CQT A;  4MBG B;  3W7X A;  3P2C A;  1O6R A;  1H35 A;  4L9P B;  4CJ1 A;  4EHM B;  3QXF A;  1AGM A;  1HZF A;  1QQF A;  4Q88 A;  3QRY A;  4KKJ A;  2QNO A;  2XWJ B;  1VD5 A;  2H6I B;  4WVC A;  2P0V A;  2EAB A;  5FOB B;  1XW2 A;  1GLM A;  4M76 A;  1TNB B;  3DPY B;  3OED A;  2GH4 A;  4MU9 A;  1KZO B;  1GSZ A;  3S9V A;  1KS8 A;  1F9D A;  1GAI A;  4YDO B;  3E32 B;  4ONT A;  2ZIR B;  4YDE B;  1N4Q B;  4JJJ A;  1HCU A;  1SQC A;  2FBA A;  4ZG8 A;  3QFZ A;  4XUV A;  3SAE A;  4L6X A;  1H12 A;  1KRE A;  3WKH A;  1F9O A;  1O6H A;  1D8D B;  2B4F A;  1FT1 B;  3QG0 A;  4AYP A;  3SDU A;  1JS4 A;  1KRF A;  1KSC A;  3SDT A;  3SFX B;  1H3A A;  3E73 A;  1IA7 A;  4KTR A;  3M7E A;  2CQS A;  1WZZ A;  3W7T A;  4TF4 A;  2DRR A;  3AFJ A;  4GTO B;  4D4C A;  3W5M A;  3PYB A;  2GOX A;  2JG0 A;  3DSW B;  3HXE B;  3PZ3 B;  4Q2B A;  1TN7 B;  1W6J A;  3S4B A;  2JF4 A;  3E33 B;  3EU8 A;  3ACT A;  1H3B A;  3Q73 B;  2RI8 A;  3Q78 B;  3DSU B;  4D4B A;  4WVB A;  1K72 A;  4Z4L A;  2XWB B;  2WY8 A;  2OKX A;  3GT5 A;  1TNY B;  4ZRP A;  2YIK A;  1N95 B;  4ZRQ A;  3VXD A;  2D8L A;  4D4D A;  1H39 A;  1S64 B;  4FUS A;  3TF4 A;  1FBW A;  1JCR B;  4LNB B;  2GZ6 A;  4CJ0 A;  5M7Y A;  3D5R A;  3E34 B;  3S4D A;  4LIX A;  4GTQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...