4D4CA

The catalytic domain, bcgh76, of bacillus circulans aman6 in complex with 1,6-mandmj
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
336
structure length
332
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHQNSDHIVDGNWAGGTYESWSSAAAVQALNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-1,6-MANNANASE
publication title Evidence for a Boat Conformation at the Transition State of Gh76 Alpha-1,6-Mannanases- Key Enzymes in Bacterial and Fungal Mannoprotein Metabolism
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 140
structure length 332
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4d4cA00
2V8IA 2H6FB 2V3PA 4D4CA 4MU9A 1GSZA 1D8EB 2BBCA 1O1RB 1JCRB 3DSXB 3KSLB 3Q78B 1LD8B 1GHQA 1HZFA 2A73B 3OEDA 3E37B 3Q7AB 3EUVB 1GXOA 3DSUB 1H37A 1N9AB 1LD7B 4LNGB 2XWJB 1DCEB 2V8KA 1TNZB 1KZPB 3Q7FB 1D8DB 1JCSB 3K7XA 3RJ3A 1N95B 2WY7A 3DSVB 4LNBB 2PN5A 4GTOB 2ZISB 2PMVA 3Q75B 1TN6B 2F0YB 1O1TB 2R2LB 1TN7B 4GTQB 1H3BA 1TN8B 4L9PB 4LNVA 3SFXB 4D4DA 1FT1B 2G0DA 2BB6A 1W6JA 3KSQB 1S64B 4KKJA 1QSJA 3DSTB 1O5MB 3G6JB 1TNYB 1O6HA 1QBQB 1TNBB 1O6RA 3E30B 4MBGB 2H6HB 1W6KA 3DSSB 3DRAB 1H39A 4KKIA 2IEJB 4YDOB 1H3AA 3PZ1B 1TNUB 2G02A 3Q79B 4V1RA 1FT2B 1S63B 3DSWB 1LTXB 1N4SB 3HXFB 3C72B 3HXCB 4GTRB 1QQFA 1H3CA 1N94B 2SQCA 1NL4B 3HXBB 1R76A 5FO7B 2V3NA 3D5SA 4GTVB 1C3DA 5FO9B 1GXMA 1SA5B 2NOJA 3D5RA 3CU7A 3SFYB 1H36A 2GOXA 4C1SA 4D4AA 4ZRPA 1GXNA 4BOJA 4GTTB 4GTPB 1FPPB 3DPYB 1N4RB 3E33B 4ZRQA 1N4PB 4ONTA 3HXEB 4GTMB 4M76A 3PZ3B 1MZCB 1TNOB 4FXKB 2WINB 5FO8B 1SQCA 3KLSA 4V1SA 1NI1B 1X81B 1KZOB 3PZ2B 2WY8A 2H6GB 2V8JA 3Q73B 4BOKA 2I07B 3KQ4A 3HXDB 4D4BA 1JCQB 4ZH1A 1O79A 1N4QB 2BB5A 2WIIB 2ZIRB 5FOBB 1SA4B 2XQWA 5AGDA 3SQCA 1O6QA 4GTSB 1O1SB 2XWBB 3EU5B 3OXUA 4FXGB 4EHMB 1H35A 2H6IB 5JPNB 3E32B 3PZ4B 1UMPA 5JPMB 4YDEB 2B39A 2BEDB 3E34B 4D94A
chains in the Genus database with same CATH superfamily
1IA6A 1V7WA 3WKHA 3P5RA 4MU9A 1X9DA 5EASA 1N24A 1N7NA 3QDEA 4KKJA 3Q78B 5M7YA 4EL8A 2A73B 5ILDA 3EUVB 1LF6A 4ZH5A 4TXTA 1TNZB 3K7XA 3RJ3A 5JMDA 3DSVB 2VN4A 2PN5A 2ZBLA 2F0YB 1LF9A 5IK6A 1HCUA 5IKHA 1H3BA 2JG0A 3SFXB 2G0DA 5IL8A 5ILYA 2D5JA 2FUZA 1FMIA 1O5MB 5ILHA 4MMHA 1WU5A 1O6RA 3ACTA 4AYRA 3GLYA 2WDAA 4CJ0A 1KSDA 3AFJA 5GZKA 2JF4A 5DGQA 3DRAB 3W7TA 3WKIA 1RWFA 1X1JA 1LTXB 3W7SA 1GAIA 4GTVB 5FO9B 3D5RA 3CU7A 3AFLA 2BRPA 3SDTA 4LIXA 1GXNA 3E33B 4MMIA 1N4PB 1G9JA 3S9VA 3HXEB 1OJMA 1J0NA 5FO8B 2FV0A 3KLSA 3M72A 1X81B 2QNOA 1KZOB 4KTRA 5DGRA 4ZH1A 3QXQA 3WIRA 1G6IA 3M01A 1IA7A 4KTPA 1O79A 4OK4A 3WKGA 2ZIRB 1H12A 3A3VA 3ACSA 3QSPA 1O6QA 2D8LA 3A0OA 2XWBB 3EU5B 3OXUA 4EHMB 5JPNB 2H6IB 1KREA 2EAEA 5JMFA 5DHKA 3N0FA 1XW2A 4YDEB 2BEDB 3SDUA 2VN7A 4Z4JA 4D4CA 2YIKA 2RGKA 1TF4A 2Z07A 1N1BA 2FUTA 1O1RB 3P5PA 3S4BA 1LD8B 3Q7AB 2GZ6A 5GY3A 3DSUB 1H37A 1WU4A 1N9AB 4J5TA 2XWJB 3M76A 3N0GA 3QPFA 1N95B 1I8QA 2WY7A 1RWAA 4OJZA 4GTOB 1FBWA 1F9GA 1KKTA 3E7JA 3ANIA 1C82A 4CJ1A 1TN8B 1N1ZA 4WVCA 3S4CA 4LNVA 3GZKA 3KSQB 3QRYA 3QG0A 1W6JA 1HM3A 1HXCA 3G6JB 3M00A 1RQ5A 2H6HB 1V5DA 1W6KA 3DSSB 3PYAA 4ZG8A 3QFZA 1H3AA 2X03A 4AYOA 3EU8A 3VW5A 1GAHA 3Q79B 2BRVX 1N22A 5C05A 3SDVA 1F9OA 1N94B 3HXBB 3NFVA 1R76A 2E24A 3M77A 4OK2A 5FO7B 1RW9A 1FO3A 1LXMA 1LXKA 2NOJA 5ILKA 1HXGA 1X1IA 1H36A 3ANKA 3VSNA 1J0MA 3G4FA 4D4AA 4ZRPA 2NVPA 1RWCA 4BOJA 3E6UA 4GTPB 1FPPB 4ONTA 3WIWA 2Q1FA 3PZ3B 1MZCB 1KS8A 2EACA 3QWTA 5GW7A 1XWQA 4WVAA 1JCQB 1NXCA 1N4QB 2WIIB 1W3YA 4CE7A 1FO2A 3SQCA 2F6DA 4GTSB 1O1SB 3QFYA 1QAZA 3E32B 5JPMB 5E2JA 2B39A 3E73A 1V7VA 1ULVA 3ON6A 3EQAA 2V8IA 1FAEA 2V3PA 1N7QA 2OKXA 3M7BA 1DOGA 1XWTA 3KSLB 1HZFA 3WC3A 1OJNA 3E37B 4F10A 2FBAA 1LD7B 4LNGB 1EGUA 1DCEB 1H14A 2V8KA 1KZPB 2CQTA 1JCSB 3G4DA 3RSYA 1G9GA 4YCRA 2RI9A 2WCOA 3S4AA 2ZISB 1TN6B 4DOEA 1L1YA 1TN7B 3WIQA 1N20A 1HX9A 1F9DA 4AYPA 2GH4A 4FUSA 3NNBA 4FJQA 1QSJA 1TNYB 1O6HA 1QBQB 1IS9A 3E30B 3M02A 3M75A 3W7UA 1DL2A 4RNQA 1H39A 4DI5A 5ILIA 4YDOB 3SDRA 1N23A 1S63B 3DSWB 1RWHA 1N4SB 3WKFA 1KFGA 4Q2BA 4GTRB 1KRFA 1H3CA 2AHFA 1NL4B 3H3KA 2WYNA 3RX7A 1N7OA 3E80A 1GLMA 2DRQA 1OJOA 3M7CA 1C3DA 2CQSA 2GOXA 4C1SA 4XUVA 4NEIA 1V7XA 3T33A 4GTTB 3DPYB 1G87A 1N4RB 3QXFA 3H2WA 3K11A 4GTMB 4M76A 1H13A 3VSMA 1F1SA 4AYQA 4FXKB 5CD2A 2WINB 4V1SA 1NI1B 4WU0A 5IL3A 3PZ2B 2H6GB 2V8JA 3LZ9A 3EZ8A 3HXDB 3PYBA 4GAXA 5M7IA 2DROA 1SA4B 2XQWA 1RWGA 5AGDA 2B4FA 2AFAA 5KKBA 1AGMA 1OJPA 1VD5A 2ONHA 1UMPA 4Q88A 3P2CA 5MEHA 1FBOA 3M78A 3E34B 4D94A 5EATA 1HXAA 3TF4A 2H6FB 2JJBA 1CB8A 2ONGA 1GSZA 1L2AA 1CEMA 1D8EB 2BBCA 1JCRB 1H54A 3DSXB 4OZVA 1FP3A 1GHQA 3OEDA 1HM2A 3D3IA 1GXOA 3GT5A 3RX5A 2P0VA 3RX8A 1CLCA 3W5MA 4L6XA 3Q7FB 1D8DB 4E1YA 2DRRA 4LNBB 2PMVA 2E22A 3Q75B 2EADA 1O1TB 2R2LB 2AHGA 4GTQB 3CIHA 4L9PB 2A8ZA 4D4DA 1FT1B 2BB6A 3WUXA 1N7RA 3RRSA 1S64B 2J5CA 3DSTB 1TNBB 4JJJA 4TF4A 4MBGB 3S4DA 3W5NA 2RI8A 3SAEA 1WU6A 1HN0A 3H7LA 4KKIA 2IEJB 3PZ1B 1NC5A 1TNUB 1UG9A 2G02A 1UT9A 3PMMA 4V1RA 5IK9A 5ILZA 1FT2B 3HXFB 3C72B 3HXCB 1AYXA 3SDQA 1QQFA 2SQCA 2BRWA 2V3NA 1N7PA 3D5SA 3W7WA 4QT9A 1GXMA 4GL3A 1SA5B 5ILJA 1GA2A 5IM1A 3SFYB 3RENA 4Z4LA 3M7LA 3QT3A 3X17A 1JS4A 1HMWA 1HMUA 2ZZRA 1V5CA 3M74A 4ZRQA 3M71A 1K72A 4L0GA 1WZZA 1TNOB 3VXDA 1LOHA 1SQCA 1KWFA 2XFGA 1X1HA 2FV1A 2WY8A 3QT9A 4BOKA 3M7EA 3Q73B 2I07B 3KQ4A 2EABA 5DHIA 4D4BA 4F13A 1HV6A 5EAUA 4FNVA 2BB5A 5FOBB 1KSCA 5CZLA 4OZWA 1FCEA 4WVBA 3M73A 2DRSA 5IKAA 4FXGB 3W7XA 1H35A 3ANJA 4DODA 5IK0A 5CA3A 3PZ4B 1N21A 2FUQA
chains in the Genus database with same CATH topology
1IA6A 1V7WA 3WKHA 3P5RA 4MU9A 1X9DA 3QDEA 4KKJA 3Q78B 5M7YA 4EL8A 2A73B 3EUVB 1LF6A 4ZH5A 4TXTA 1TNZB 3K7XA 3RJ3A 3DSVB 2VN4A 2PN5A 2ZBLA 2F0YB 1LF9A 1HCUA 1H3BA 2JG0A 3SFXB 2G0DA 2D5JA 2FUZA 1FMIA 1O5MB 1WU5A 1O6RA 3ACTA 4AYRA 3GLYA 4CJ0A 1KSDA 3AFJA 5GZKA 2JF4A 5DGQA 3DRAB 3W7TA 3WKIA 1LTXB 3W7SA 1GAIA 4GTVB 5FO9B 3D5RA 3CU7A 3SDTA 4LIXA 1GXNA 3E33B 1N4PB 1G9JA 3S9VA 3HXEB 5FO8B 3KLSA 2FV0A 3M72A 1X81B 2QNOA 1KZOB 4KTRA 5DGRA 4ZH1A 3QXQA 3WIRA 1G6IA 1IA7A 4KTPA 1O79A 3WKGA 2ZIRB 1H12A 3A3VA 3ACSA 3QSPA 1O6QA 2D8LA 2XWBB 3EU5B 3OXUA 4EHMB 5JPNB 2H6IB 1KREA 2EAEA 1XW2A 4YDEB 2BEDB 3SDUA 2VN7A 4Z4JA 4D4CA 2YIKA 2RGKA 1TF4A 2Z07A 1O1RB 3P5PA 3S4BA 1LD8B 3Q7AB 2GZ6A 5GY3A 3DSUB 1H37A 1WU4A 1N9AB 4J5TA 2XWJB 3M76A 3QPFA 1N95B 2WY7A 4GTOB 1FBWA 1KKTA 3ANIA 4CJ1A 1TN8B 4WVCA 3S4CA 4LNVA 3GZKA 3KSQB 3QRYA 3QG0A 1W6JA 3G6JB 1RQ5A 2H6HB 1V5DA 1W6KA 3DSSB 3PYAA 4ZG8A 3QFZA 1H3AA 4AYOA 3EU8A 3VW5A 1GAHA 3Q79B 3SDVA 1F9OA 1N94B 3HXBB 1R76A 3M77A 5FO7B 1FO3A 2NOJA 3ANKA 1H36A 4D4AA 4ZRPA 2NVPA 4BOJA 3E6UA 4GTPB 1FPPB 4ONTA 3WIWA 3PZ3B 1MZCB 1KS8A 2EACA 3QWTA 5GW7A 1XWQA 4WVAA 1JCQB 1NXCA 1N4QB 2WIIB 4CE7A 1FO2A 3SQCA 2F6DA 4GTSB 1O1SB 3QFYA 3E32B 5JPMB 5E2JA 2B39A 3E73A 1V7VA 1ULVA 3ON6A 3EQAA 2V8IA 1FAEA 2V3PA 2OKXA 3M7BA 1DOGA 1XWTA 3KSLB 1HZFA 3WC3A 3E37B 2FBAA 1LD7B 4LNGB 1H14A 1DCEB 2V8KA 1KZPB 2CQTA 1JCSB 3RSYA 1G9GA 4YCRA 2RI9A 3S4AA 2ZISB 1TN6B 4DOEA 1L1YA 1TN7B 3WIQA 1F9DA 4AYPA 2GH4A 4FUSA 1QSJA 1TNYB 1O6HA 1QBQB 1IS9A 3E30B 3M75A 3W7UA 1DL2A 1H39A 4YDOB 3SDRA 1S63B 3DSWB 3WKFA 1N4SB 1KFGA 4Q2BA 4GTRB 1KRFA 1H3CA 2AHFA 1NL4B 3H3KA 2WYNA 3RX7A 1GLMA 2DRQA 3M7CA 1C3DA 2CQSA 2GOXA 4C1SA 4XUVA 1V7XA 3T33A 4GTTB 3DPYB 1G87A 1N4RB 3QXFA 3H2WA 3K11A 4GTMB 4M76A 1H13A 4AYQA 4FXKB 5CD2A 2WINB 4V1SA 1NI1B 4WU0A 3PZ2B 2H6GB 2V8JA 3EZ8A 3HXDB 3PYBA 5M7IA 2DROA 1SA4B 2XQWA 5AGDA 2B4FA 2AFAA 5KKBA 1AGMA 1VD5A 4Q88A 1UMPA 3P2CA 5MEHA 1FBOA 3M78A 3E34B 4D94A 3TF4A 2H6FB 2JJBA 1GSZA 1L2AA 1CEMA 1D8EB 2BBCA 1JCRB 1H54A 3DSXB 1FP3A 1GHQA 3OEDA 3D3IA 3RX5A 1GXOA 3GT5A 2P0VA 3RX8A 1CLCA 3W5MA 4L6XA 3Q7FB 1D8DB 2DRRA 4LNBB 2PMVA 3Q75B 2EADA 1O1TB 2R2LB 2AHGA 4GTQB 3CIHA 4L9PB 2A8ZA 4D4DA 1FT1B 2BB6A 3WUXA 3RRSA 1S64B 3DSTB 1TNBB 4JJJA 4TF4A 4MBGB 3S4DA 3W5NA 2RI8A 3SAEA 1WU6A 3H7LA 4KKIA 2IEJB 3PZ1B 1NC5A 1TNUB 1UG9A 2G02A 1UT9A 3PMMA 4V1RA 1FT2B 3HXFB 3C72B 3HXCB 1AYXA 3SDQA 1QQFA 2SQCA 2V3NA 3D5SA 3W7WA 4QT9A 1GXMA 4GL3A 1SA5B 1GA2A 3SFYB 3RENA 4Z4LA 3M7LA 3QT3A 3X17A 1JS4A 2ZZRA 1V5CA 3M74A 4ZRQA 3M71A 1K72A 4L0GA 1WZZA 1TNOB 3VXDA 1SQCA 1KWFA 2XFGA 2FV1A 3QT9A 2WY8A 4BOKA 3M7EA 3Q73B 2I07B 3KQ4A 2EABA 4D4BA 2BB5A 5FOBB 1KSCA 5CZLA 1FCEA 4WVBA 3M73A 2DRSA 4FXGB 3W7XA 1H35A 3ANJA 4DODA 5CA3A 3PZ4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8I A;  2H6F B;  2V3P A;  4D4C A;  4MU9 A;  1GSZ A;  1D8E B;  2BBC A;  1O1R B;  1JCR B;  3DSX B;  3KSL B;  3Q78 B;  1LD8 B;  1GHQ A;  1HZF A;  2A73 B;  3OED A;  3E37 B;  3Q7A B;  3EUV B;  1GXO A;  3DSU B;  1H37 A;  1N9A B;  1LD7 B;  4LNG B;  2XWJ B;  1DCE B;  2V8K A;  1TNZ B;  1KZP B;  3Q7F B;  1D8D B;  1JCS B;  3K7X A;  3RJ3 A;  1N95 B;  2WY7 A;  3DSV B;  4LNB B;  2PN5 A;  4GTO B;  2ZIS B;  2PMV A;  3Q75 B;  1TN6 B;  2F0Y B;  1O1T B;  2R2L B;  1TN7 B;  4GTQ B;  1H3B A;  1TN8 B;  4L9P B;  4LNV A;  3SFX B;  4D4D A;  1FT1 B;  2G0D A;  2BB6 A;  1W6J A;  3KSQ B;  1S64 B;  4KKJ A;  1QSJ A;  3DST B;  1O5M B;  3G6J B;  1TNY B;  1O6H A;  1QBQ B;  1TNB B;  1O6R A;  3E30 B;  4MBG B;  2H6H B;  1W6K A;  3DSS B;  3DRA B;  1H39 A;  4KKI A;  2IEJ B;  4YDO B;  1H3A A;  3PZ1 B;  1TNU B;  2G02 A;  3Q79 B;  4V1R A;  1FT2 B;  1S63 B;  3DSW B;  1LTX B;  1N4S B;  3HXF B;  3C72 B;  3HXC B;  4GTR B;  1QQF A;  1H3C A;  1N94 B;  2SQC A;  1NL4 B;  3HXB B;  1R76 A;  5FO7 B;  2V3N A;  3D5S A;  4GTV B;  1C3D A;  5FO9 B;  1GXM A;  1SA5 B;  2NOJ A;  3D5R A;  3CU7 A;  3SFY B;  1H36 A;  2GOX A;  4C1S A;  4D4A A;  4ZRP A;  1GXN A;  4BOJ A;  4GTT B;  4GTP B;  1FPP B;  3DPY B;  1N4R B;  3E33 B;  4ZRQ A;  1N4P B;  4ONT A;  3HXE B;  4GTM B;  4M76 A;  3PZ3 B;  1MZC B;  1TNO B;  4FXK B;  2WIN B;  5FO8 B;  1SQC A;  3KLS A;  4V1S A;  1NI1 B;  1X81 B;  1KZO B;  3PZ2 B;  2WY8 A;  2H6G B;  2V8J A;  3Q73 B;  4BOK A;  2I07 B;  3KQ4 A;  3HXD B;  4D4B A;  1JCQ B;  4ZH1 A;  1O79 A;  1N4Q B;  2BB5 A;  2WII B;  2ZIR B;  5FOB B;  1SA4 B;  2XQW A;  5AGD A;  3SQC A;  1O6Q A;  4GTS B;  1O1S B;  2XWB B;  3EU5 B;  3OXU A;  4FXG B;  4EHM B;  1H35 A;  2H6I B;  5JPN B;  3E32 B;  3PZ4 B;  1UMP A;  5JPM B;  4YDE B;  2B39 A;  2BED B;  3E34 B;  4D94 A; 
#chains in the Genus database with same CATH topology
 1IA6 A;  1V7W A;  3WKH A;  3P5R A;  4MU9 A;  1X9D A;  5EAS A;  1N24 A;  1N7N A;  3QDE A;  4KKJ A;  3Q78 B;  5M7Y A;  4EL8 A;  2A73 B;  5ILD A;  3EUV B;  1LF6 A;  4ZH5 A;  4TXT A;  1TNZ B;  3K7X A;  3RJ3 A;  5JMD A;  3DSV B;  2VN4 A;  2PN5 A;  2ZBL A;  2F0Y B;  1LF9 A;  5IK6 A;  1HCU A;  5IKH A;  1H3B A;  2JG0 A;  3SFX B;  2G0D A;  5IL8 A;  5ILY A;  2D5J A;  2FUZ A;  1FMI A;  1O5M B;  5ILH A;  4MMH A;  1WU5 A;  1O6R A;  3ACT A;  4AYR A;  3GLY A;  2WDA A;  4CJ0 A;  1KSD A;  3AFJ A;  5GZK A;  2JF4 A;  5DGQ A;  3DRA B;  3W7T A;  3WKI A;  1RWF A;  1X1J A;  1LTX B;  3W7S A;  1GAI A;  4GTV B;  5FO9 B;  3D5R A;  3CU7 A;  3AFL A;  2BRP A;  3SDT A;  4LIX A;  1GXN A;  3E33 B;  4MMI A;  1N4P B;  1G9J A;  3S9V A;  3HXE B;  1OJM A;  1J0N A;  5FO8 B;  2FV0 A;  3KLS A;  3M72 A;  1X81 B;  2QNO A;  1KZO B;  4KTR A;  5DGR A;  4ZH1 A;  3QXQ A;  3WIR A;  1G6I A;  3M01 A;  1IA7 A;  4KTP A;  1O79 A;  4OK4 A;  3WKG A;  2ZIR B;  1H12 A;  3A3V A;  3ACS A;  3QSP A;  1O6Q A;  2D8L A;  3A0O A;  2XWB B;  3EU5 B;  3OXU A;  4EHM B;  5JPN B;  2H6I B;  1KRE A;  2EAE A;  5JMF A;  5DHK A;  3N0F A;  1XW2 A;  4YDE B;  2BED B;  3SDU A;  2VN7 A;  4Z4J A;  4D4C A;  2YIK A;  2RGK A;  1TF4 A;  2Z07 A;  1N1B A;  2FUT A;  1O1R B;  3P5P A;  3S4B A;  1LD8 B;  3Q7A B;  2GZ6 A;  5GY3 A;  3DSU B;  1H37 A;  1WU4 A;  1N9A B;  4J5T A;  2XWJ B;  3M76 A;  3N0G A;  3QPF A;  1N95 B;  1I8Q A;  2WY7 A;  1RWA A;  4OJZ A;  4GTO B;  1FBW A;  1F9G A;  1KKT A;  3E7J A;  3ANI A;  1C82 A;  4CJ1 A;  1TN8 B;  1N1Z A;  4WVC A;  3S4C A;  4LNV A;  3GZK A;  3KSQ B;  3QRY A;  3QG0 A;  1W6J A;  1HM3 A;  1HXC A;  3G6J B;  3M00 A;  1RQ5 A;  2H6H B;  1V5D A;  1W6K A;  3DSS B;  3PYA A;  4ZG8 A;  3QFZ A;  1H3A A;  2X03 A;  4AYO A;  3EU8 A;  3VW5 A;  1GAH A;  3Q79 B;  2BRV X;  1N22 A;  5C05 A;  3SDV A;  1F9O A;  1N94 B;  3HXB B;  3NFV A;  1R76 A;  2E24 A;  3M77 A;  4OK2 A;  5FO7 B;  1RW9 A;  1FO3 A;  1LXM A;  1LXK A;  2NOJ A;  5ILK A;  1HXG A;  1X1I A;  1H36 A;  3ANK A;  3VSN A;  1J0M A;  3G4F A;  4D4A A;  4ZRP A;  2NVP A;  1RWC A;  4BOJ A;  3E6U A;  4GTP B;  1FPP B;  4ONT A;  3WIW A;  2Q1F A;  3PZ3 B;  1MZC B;  1KS8 A;  2EAC A;  3QWT A;  5GW7 A;  1XWQ A;  4WVA A;  1JCQ B;  1NXC A;  1N4Q B;  2WII B;  1W3Y A;  4CE7 A;  1FO2 A;  3SQC A;  2F6D A;  4GTS B;  1O1S B;  3QFY A;  1QAZ A;  3E32 B;  5JPM B;  5E2J A;  2B39 A;  3E73 A;  1V7V A;  1ULV A;  3ON6 A;  3EQA A;  2V8I A;  1FAE A;  2V3P A;  1N7Q A;  2OKX A;  3M7B A;  1DOG A;  1XWT A;  3KSL B;  1HZF A;  3WC3 A;  1OJN A;  3E37 B;  4F10 A;  2FBA A;  1LD7 B;  4LNG B;  1EGU A;  1DCE B;  1H14 A;  2V8K A;  1KZP B;  2CQT A;  1JCS B;  3G4D A;  3RSY A;  1G9G A;  4YCR A;  2RI9 A;  2WCO A;  3S4A A;  2ZIS B;  1TN6 B;  4DOE A;  1L1Y A;  1TN7 B;  3WIQ A;  1N20 A;  1HX9 A;  1F9D A;  4AYP A;  2GH4 A;  4FUS A;  3NNB A;  4FJQ A;  1QSJ A;  1TNY B;  1O6H A;  1QBQ B;  1IS9 A;  3E30 B;  3M02 A;  3M75 A;  3W7U A;  1DL2 A;  4RNQ A;  1H39 A;  4DI5 A;  5ILI A;  4YDO B;  3SDR A;  1N23 A;  1S63 B;  3DSW B;  1RWH A;  1N4S B;  3WKF A;  1KFG A;  4Q2B A;  4GTR B;  1KRF A;  1H3C A;  2AHF A;  1NL4 B;  3H3K A;  2WYN A;  3RX7 A;  1N7O A;  3E80 A;  1GLM A;  2DRQ A;  1OJO A;  3M7C A;  1C3D A;  2CQS A;  2GOX A;  4C1S A;  4XUV A;  4NEI A;  1V7X A;  3T33 A;  4GTT B;  3DPY B;  1G87 A;  1N4R B;  3QXF A;  3H2W A;  3K11 A;  4GTM B;  4M76 A;  1H13 A;  3VSM A;  1F1S A;  4AYQ A;  4FXK B;  5CD2 A;  2WIN B;  4V1S A;  1NI1 B;  4WU0 A;  5IL3 A;  3PZ2 B;  2H6G B;  2V8J A;  3LZ9 A;  3EZ8 A;  3HXD B;  3PYB A;  4GAX A;  5M7I A;  2DRO A;  1SA4 B;  2XQW A;  1RWG A;  5AGD A;  2B4F A;  2AFA A;  5KKB A;  1AGM A;  1OJP A;  1VD5 A;  2ONH A;  1UMP A;  4Q88 A;  3P2C A;  5MEH A;  1FBO A;  3M78 A;  3E34 B;  4D94 A;  5EAT A;  1HXA A;  3TF4 A;  2H6F B;  2JJB A;  1CB8 A;  2ONG A;  1GSZ A;  1L2A A;  1CEM A;  1D8E B;  2BBC A;  1JCR B;  1H54 A;  3DSX B;  4OZV A;  1FP3 A;  1GHQ A;  3OED A;  1HM2 A;  3D3I A;  1GXO A;  3GT5 A;  3RX5 A;  2P0V A;  3RX8 A;  1CLC A;  3W5M A;  4L6X A;  3Q7F B;  1D8D B;  4E1Y A;  2DRR A;  4LNB B;  2PMV A;  2E22 A;  3Q75 B;  2EAD A;  1O1T B;  2R2L B;  2AHG A;  4GTQ B;  3CIH A;  4L9P B;  2A8Z A;  4D4D A;  1FT1 B;  2BB6 A;  3WUX A;  1N7R A;  3RRS A;  1S64 B;  2J5C A;  3DST B;  1TNB B;  4JJJ A;  4TF4 A;  4MBG B;  3S4D A;  3W5N A;  2RI8 A;  3SAE A;  1WU6 A;  1HN0 A;  3H7L A;  4KKI A;  2IEJ B;  3PZ1 B;  1NC5 A;  1TNU B;  1UG9 A;  2G02 A;  1UT9 A;  3PMM A;  4V1R A;  5IK9 A;  5ILZ A;  1FT2 B;  3HXF B;  3C72 B;  3HXC B;  1AYX A;  3SDQ A;  1QQF A;  2SQC A;  2BRW A;  2V3N A;  1N7P A;  3D5S A;  3W7W A;  4QT9 A;  1GXM A;  4GL3 A;  1SA5 B;  5ILJ A;  1GA2 A;  5IM1 A;  3SFY B;  3REN A;  4Z4L A;  3M7L A;  3QT3 A;  3X17 A;  1JS4 A;  1HMW A;  1HMU A;  2ZZR A;  1V5C A;  3M74 A;  4ZRQ A;  3M71 A;  1K72 A;  4L0G A;  1WZZ A;  1TNO B;  3VXD A;  1LOH A;  1SQC A;  1KWF A;  2XFG A;  1X1H A;  2FV1 A;  2WY8 A;  3QT9 A;  4BOK A;  3M7E A;  3Q73 B;  2I07 B;  3KQ4 A;  2EAB A;  5DHI A;  4D4B A;  4F13 A;  1HV6 A;  5EAU A;  4FNV A;  2BB5 A;  5FOB B;  1KSC A;  5CZL A;  4OZW A;  1FCE A;  4WVB A;  3M73 A;  2DRS A;  5IKA A;  4FXG B;  3W7X A;  1H35 A;  3ANJ A;  4DOD A;  5IK0 A;  5CA3 A;  3PZ4 B;  1N21 A;  2FUQ A; 
#chains in the Genus database with same CATH homology
 1IA6 A;  1V7W A;  3WKH A;  3P5R A;  4MU9 A;  1X9D A;  3QDE A;  4KKJ A;  3Q78 B;  5M7Y A;  4EL8 A;  2A73 B;  3EUV B;  1LF6 A;  4ZH5 A;  4TXT A;  1TNZ B;  3K7X A;  3RJ3 A;  3DSV B;  2VN4 A;  2PN5 A;  2ZBL A;  2F0Y B;  1LF9 A;  1HCU A;  1H3B A;  2JG0 A;  3SFX B;  2G0D A;  2D5J A;  2FUZ A;  1FMI A;  1O5M B;  1WU5 A;  1O6R A;  3ACT A;  4AYR A;  3GLY A;  4CJ0 A;  1KSD A;  3AFJ A;  5GZK A;  2JF4 A;  5DGQ A;  3DRA B;  3W7T A;  3WKI A;  1LTX B;  3W7S A;  1GAI A;  4GTV B;  5FO9 B;  3D5R A;  3CU7 A;  3SDT A;  4LIX A;  1GXN A;  3E33 B;  1N4P B;  1G9J A;  3S9V A;  3HXE B;  5FO8 B;  3KLS A;  2FV0 A;  3M72 A;  1X81 B;  2QNO A;  1KZO B;  4KTR A;  5DGR A;  4ZH1 A;  3QXQ A;  3WIR A;  1G6I A;  1IA7 A;  4KTP A;  1O79 A;  3WKG A;  2ZIR B;  1H12 A;  3A3V A;  3ACS A;  3QSP A;  1O6Q A;  2D8L A;  2XWB B;  3EU5 B;  3OXU A;  4EHM B;  5JPN B;  2H6I B;  1KRE A;  2EAE A;  1XW2 A;  4YDE B;  2BED B;  3SDU A;  2VN7 A;  4Z4J A;  4D4C A;  2YIK A;  2RGK A;  1TF4 A;  2Z07 A;  1O1R B;  3P5P A;  3S4B A;  1LD8 B;  3Q7A B;  2GZ6 A;  5GY3 A;  3DSU B;  1H37 A;  1WU4 A;  1N9A B;  4J5T A;  2XWJ B;  3M76 A;  3QPF A;  1N95 B;  2WY7 A;  4GTO B;  1FBW A;  1KKT A;  3ANI A;  4CJ1 A;  1TN8 B;  4WVC A;  3S4C A;  4LNV A;  3GZK A;  3KSQ B;  3QRY A;  3QG0 A;  1W6J A;  3G6J B;  1RQ5 A;  2H6H B;  1V5D A;  1W6K A;  3DSS B;  3PYA A;  4ZG8 A;  3QFZ A;  1H3A A;  4AYO A;  3EU8 A;  3VW5 A;  1GAH A;  3Q79 B;  3SDV A;  1F9O A;  1N94 B;  3HXB B;  1R76 A;  3M77 A;  5FO7 B;  1FO3 A;  2NOJ A;  3ANK A;  1H36 A;  4D4A A;  4ZRP A;  2NVP A;  4BOJ A;  3E6U A;  4GTP B;  1FPP B;  4ONT A;  3WIW A;  3PZ3 B;  1MZC B;  1KS8 A;  2EAC A;  3QWT A;  5GW7 A;  1XWQ A;  4WVA A;  1JCQ B;  1NXC A;  1N4Q B;  2WII B;  4CE7 A;  1FO2 A;  3SQC A;  2F6D A;  4GTS B;  1O1S B;  3QFY A;  3E32 B;  5JPM B;  5E2J A;  2B39 A;  3E73 A;  1V7V A;  1ULV A;  3ON6 A;  3EQA A;  2V8I A;  1FAE A;  2V3P A;  2OKX A;  3M7B A;  1DOG A;  1XWT A;  3KSL B;  1HZF A;  3WC3 A;  3E37 B;  2FBA A;  1LD7 B;  4LNG B;  1H14 A;  1DCE B;  2V8K A;  1KZP B;  2CQT A;  1JCS B;  3RSY A;  1G9G A;  4YCR A;  2RI9 A;  3S4A A;  2ZIS B;  1TN6 B;  4DOE A;  1L1Y A;  1TN7 B;  3WIQ A;  1F9D A;  4AYP A;  2GH4 A;  4FUS A;  1QSJ A;  1TNY B;  1O6H A;  1QBQ B;  1IS9 A;  3E30 B;  3M75 A;  3W7U A;  1DL2 A;  1H39 A;  4YDO B;  3SDR A;  1S63 B;  3DSW B;  3WKF A;  1N4S B;  1KFG A;  4Q2B A;  4GTR B;  1KRF A;  1H3C A;  2AHF A;  1NL4 B;  3H3K A;  2WYN A;  3RX7 A;  1GLM A;  2DRQ A;  3M7C A;  1C3D A;  2CQS A;  2GOX A;  4C1S A;  4XUV A;  1V7X A;  3T33 A;  4GTT B;  3DPY B;  1G87 A;  1N4R B;  3QXF A;  3H2W A;  3K11 A;  4GTM B;  4M76 A;  1H13 A;  4AYQ A;  4FXK B;  5CD2 A;  2WIN B;  4V1S A;  1NI1 B;  4WU0 A;  3PZ2 B;  2H6G B;  2V8J A;  3EZ8 A;  3HXD B;  3PYB A;  5M7I A;  2DRO A;  1SA4 B;  2XQW A;  5AGD A;  2B4F A;  2AFA A;  5KKB A;  1AGM A;  1VD5 A;  4Q88 A;  1UMP A;  3P2C A;  5MEH A;  1FBO A;  3M78 A;  3E34 B;  4D94 A;  3TF4 A;  2H6F B;  2JJB A;  1GSZ A;  1L2A A;  1CEM A;  1D8E B;  2BBC A;  1JCR B;  1H54 A;  3DSX B;  1FP3 A;  1GHQ A;  3OED A;  3D3I A;  3RX5 A;  1GXO A;  3GT5 A;  2P0V A;  3RX8 A;  1CLC A;  3W5M A;  4L6X A;  3Q7F B;  1D8D B;  2DRR A;  4LNB B;  2PMV A;  3Q75 B;  2EAD A;  1O1T B;  2R2L B;  2AHG A;  4GTQ B;  3CIH A;  4L9P B;  2A8Z A;  4D4D A;  1FT1 B;  2BB6 A;  3WUX A;  3RRS A;  1S64 B;  3DST B;  1TNB B;  4JJJ A;  4TF4 A;  4MBG B;  3S4D A;  3W5N A;  2RI8 A;  3SAE A;  1WU6 A;  3H7L A;  4KKI A;  2IEJ B;  3PZ1 B;  1NC5 A;  1TNU B;  1UG9 A;  2G02 A;  1UT9 A;  3PMM A;  4V1R A;  1FT2 B;  3HXF B;  3C72 B;  3HXC B;  1AYX A;  3SDQ A;  1QQF A;  2SQC A;  2V3N A;  3D5S A;  3W7W A;  4QT9 A;  1GXM A;  4GL3 A;  1SA5 B;  1GA2 A;  3SFY B;  3REN A;  4Z4L A;  3M7L A;  3QT3 A;  3X17 A;  1JS4 A;  2ZZR A;  1V5C A;  3M74 A;  4ZRQ A;  3M71 A;  1K72 A;  4L0G A;  1WZZ A;  1TNO B;  3VXD A;  1SQC A;  1KWF A;  2XFG A;  2FV1 A;  3QT9 A;  2WY8 A;  4BOK A;  3M7E A;  3Q73 B;  2I07 B;  3KQ4 A;  2EAB A;  4D4B A;  2BB5 A;  5FOB B;  1KSC A;  5CZL A;  1FCE A;  4WVB A;  3M73 A;  2DRS A;  4FXG B;  3W7X A;  1H35 A;  3ANJ A;  4DOD A;  5CA3 A;  3PZ4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...