4D4CA

The catalytic domain, bcgh76, of bacillus circulans aman6 in complex with 1,6-mandmj
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
336
structure length
332
Chain Sequence
SDGDTAMKAFNDTFWDPNAKMFWKDSKREKHQDFWVEAELWELVMDAYQHTSDPALKAELKTQIDDVYDGTVAKYGQDWTNNPFNDDIMWWAMGSARAYQITGNPRYLEAARDHFDFVYDTQWDEEFANGGIWWLNSDHNTKNACINFPAAQAALYLYDITKDEHYLNAATKIFRWGKTMLTDGNGKVFDRIEIEHGAVPDATHYNQGTYIGSAVGLYKATGNAVYLDDAVKAAKFTKNHLVDSNGVLNYEGPNGDLKGGKTILMRNLAHLQKTLDETGQYPEFSAEFDEWLAFNIEMAWSHQNSDHIVDGNWAGGTYESWSSAAAVQALNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-1,6-MANNANASE
publication title Evidence for a Boat Conformation at the Transition State of Gh76 Alpha-1,6-Mannanases- Key Enzymes in Bacterial and Fungal Mannoprotein Metabolism
pubmed doi rcsb
source organism Bacillus circulans
total genus 140
structure length 332
sequence length 336
chains with identical sequence B
ec nomenclature ec 3.2.1.101: Mannan endo-1,6-alpha-mannosidase.
pdb deposition date 2014-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4d4cA00
2G0DA 3KLSA 3SFXB 3K7XA 1O1TB 3OXUA 1W6KA 1S63B 1KZPB 4MBGB 1JCQB 4GTSB 1N4QB 1H3CA 1GSZA 3G6JB 5FO7B 1H3BA 2ZIRB 4EHMB 5FOBB 1JCRB 1N4SB 1D8DB 4LNBB 2V8IA 4D94A 2XQWA 1HZFA 1SQCA 1LD7B 3CU7A 1X81B 1TNZB 2XWJB 1TNUB 1FT1B 3DSUB 2V8KA 4ZRQA 2H6HB 1O79A 1N9AB 1N95B 1LD8B 2G02A 1S64B 3DSSB 3Q7AB 1FT2B 3DPYB 1D8EB 1H35A 1QBQB 2BBCA 1N94B 4LNGB 4LNVA 1LTXB 1NL4B 4ZH1A 2A73B 1KZOB 3EU5B 3Q75B 4GTQB 5AGDA 3DSWB 3RJ3A 4GTPB 4D4CA 2ZISB 3HXEB 4FXGB 1TNOB 3HXCB 1UMPA 4KKIA 4D4DA 4M76A 1TN8B 4L9PB 1H37A 4V1RA 2XWBB 1MZCB 1O5MB 3OEDA 5JPNB 2R2LB 1C3DA 2GOXA 2WIIB 2B39A 2H6IB 3Q7FB 1JCSB 3D5SA 3Q78B 5FO9B 1GXNA 1H36A 2V3NA 2WY7A 1GXOA 3Q79B 1TNBB 1O1SB 1SA5B 4ZRPA 1W6JA 2H6FB 4ONTA 1N4RB 3PZ3B 1SA4B 5JPMB 1O6QA 2IEJB 4YDOB 2BEDB 3E37B 1TN7B 2BB5A 4KKJA 1GXMA 4GTTB 4BOKA 3E32B 3D5RA 2PN5A 1O6HA 1H3AA 3DSXB 3DRAB 2PMVA 3HXFB 2SQCA 3PZ4B 3SQCA 1GHQA 3E33B 1QSJA 4MU9A 3DSVB 1H39A 3SFYB 2WY8A 2V8JA 4FXKB 3PZ2B 1TN6B 1TNYB 1O1RB 2H6GB 4GTOB 2WINB 1O6RA 3EUVB 4GTRB 2BB6A 3HXDB 2V3PA 4C1SA 1NI1B 3Q73B 3HXBB 2F0YB 1N4PB 4BOJA 1QQFA 2I07B 3E30B 3KSLB 4V1SA 3C72B 1FPPB 1R76A 2NOJA 4D4BA 4D4AA 3DSTB 1DCEB 4GTMB 3E34B 4GTVB 3KQ4A 5FO8B 3KSQB 3PZ1B 4YDEB
chains in the Genus database with same CATH superfamily
5M7YA 1OJNA 1GAHA 4L0GA 1XW2A 3M73A 3AFLA 1N4QB 1N23A 1G9GA 1GSZA 1N22A 1KS8A 5EASA 3S4AA 1H3BA 5IK9A 5FOBB 4WVCA 2E24A 2J5CA 2V8IA 4AYOA 4FNVA 1HZFA 2FUQA 1L1YA 3DSUB 4Z4JA 5DHKA 2H6HB 3QG0A 2VN7A 1LD8B 3QPFA 4MMIA 3M7BA 3N0FA 1H35A 2JF4A 3S4DA 3H7LA 5EAUA 5AGDA 3RJ3A 4GTQB 1RWFA 5ILZA 4D4CA 1HM3A 2XFGA 1N21A 3OEDA 5JPNB 3P5RA 1RWGA 2R2LB 2RI9A 4TF4A 2WCOA 3M74A 3EQAA 1JCSB 3D5SA 3Q78B 4RNQA 2V3NA 1N7QA 4FJQA 1XWQA 1W6JA 4DODA 3A0OA 1OJOA 2CQTA 1G87A 1SA4B 5JPMB 1O6QA 1DL2A 2IEJB 2OKXA 1N7RA 5CZLA 1EGUA 5ILJA 1TN7B 3EU8A 1GXMA 4GTTB 3E32B 2PN5A 4YCRA 3S9VA 3SQCA 3QDEA 2Z07A 3DSVB 1H39A 5GY3A 3PZ2B 1O1RB 2D5JA 2WINB 1G9JA 3EZ8A 4XUVA 3H3KA 1O6RA 1FP3A 2X03A 3HXDB 2BRPA 4C1SA 4EL8A 1NI1B 3QT3A 1I8QA 1UG9A 3ANJA 1HV6A 1GA2A 3SDTA 1QQFA 4OZWA 4V1SA 1L2AA 3VXDA 4FUSA 5DHIA 2AFAA 2NOJA 1V7WA 3M75A 4YDEB 2G0DA 1LXKA 3K7XA 1O1TB 3OXUA 1N7OA 1RWAA 5DGRA 4WVAA 3W5NA 3LZ9A 4LIXA 1N7NA 3G4DA 1GAIA 3G6JB 2VN4A 1JS4A 3P2CA 2GZ6A 1N24A 1F9DA 1HMUA 4LNBB 4TXTA 4WU0A 2NVPA 2AHGA 3CIHA 5MEHA 3W5MA 1X81B 1TNZB 2XWJB 3M71A 1FT1B 1LXMA 1N9AB 4OZVA 1ULVA 2G02A 5KKBA 3VSNA 2JJBA 4CJ0A 3M02A 1N94B 1HXAA 3Q75B 2FUZA 1RWCA 3DSWB 4CJ1A 3AFJA 1TF4A 2ZISB 5IKAA 4FXGB 1TNOB 3HXCB 1IA6A 3NFVA 4D4DA 4E1YA 2JG0A 2B4FA 5IKHA 4M76A 3QSPA 5CD2A 2GOXA 2H6IB 4MMHA 1CLCA 5ILDA 1GXOA 3W7SA 3QFZA 4ONTA 1AYXA 2BRVX 5EATA 1RWHA 1N7PA 3T33A 1VD5A 2BEDB 1V7XA 1O6HA 1RQ5A 3QXFA 3HXFB 1HXCA 2SQCA 3PZ4B 1KSCA 3WKIA 1QSJA 3RX7A 3SFYB 1TNYB 1FMIA 5M7IA 3WKGA 3H2WA 2BB6A 2V3PA 2F0YB 2I07B 3E30B 3P5PA 3ANIA 3G4FA 5IL3A 3WIQA 3DSTB 1DCEB 4GTMB 1H14A 3M01A 1J0MA 3PZ1B 1KKTA 3VSMA 3K11A 2EADA 2ONHA 4WVBA 4MBGB 1H13A 1JCQB 4GTSB 1H3CA 1HN0A 4EHMB 1N1BA 5CA3A 3M00A 2DROA 5ILKA 1SQCA 1LD7B 3SDUA 1TNUB 3WKFA 1FBOA 2V8KA 3M7LA 2EAEA 4OK2A 1F9OA 3QWTA 1W3YA 5IM1A 1S64B 5IK0A 3PYBA 3DPYB 3ACTA 1QBQB 4LNVA 3W7XA 1KZOB 1C82A 3EU5B 1GLMA 4GTPB 4NEIA 2CQSA 2A8ZA 4Q88A 3ACSA 2Q1FA 1FCEA 4L9PB 1H37A 4V1RA 4ZG8A 4ZH5A 2XWBB 3M7EA 1MZCB 1QAZA 5IL8A 3ANKA 2B39A 3Q7FB 5FO9B 1GXNA 1RW9A 3SDRA 3M78A 1H36A 1KREA 3Q79B 2QNOA 1SA5B 2F6DA 4ZRPA 2EABA 4KTPA 1HXGA 3M76A 3GT5A 3PZ3B 1FO2A 1XWTA 1WU6A 2BB5A 4KKJA 3SDQA 1LF6A 3RENA 1H3AA 3D3IA 3DSXB 3S4BA 3E33B 3ON6A 4MU9A 1HCUA 1HX9A 5E2JA 3PYAA 5ILHA 3M7CA 2V8JA 4FXKB 1N1ZA 1TN6B 2WDAA 3QFYA 3M77A 2H6GB 4GTOB 3X17A 4CE7A 3S4CA 3RX8A 2ZBLA 3Q73B 3HXBB 1N4PB 4F10A 1G6IA 2WYNA 1X9DA 3E73A 4GAXA 3WIRA 3C72B 1R76A 1KRFA 3TF4A 4D4AA 3E34B 4GTVB 1KFGA 3KQ4A 1V7VA 2DRQA 3KSQB 2DRSA 3KLSA 1F1SA 3SFXB 3PMMA 3GLYA 4OJZA 1W6KA 1S63B 3QXQA 3RSYA 1X1IA 1KZPB 1DOGA 3QRYA 5DGQA 3WKHA 1FAEA 1OJPA 5FO7B 1HMWA 2ZIRB 1N20A 1JCRB 1N4SB 1D8DB 3NNBA 1J0NA 2E22A 4D94A 2XQWA 3W7WA 1WU5A 1NXCA 3CU7A 4AYRA 4ZRQA 1O79A 3W7UA 2BRWA 5ILIA 1N95B 5JMDA 2FV1A 1NC5A 1IS9A 3DSSB 3Q7AB 3N0GA 4L6XA 1FT2B 1D8EB 3M72A 4Q2BA 1IA7A 4AYQA 2BBCA 2FUTA 4LNGB 1X1JA 1LTXB 1NL4B 4ZH1A 2A73B 4QT9A 3E7JA 3HXEB 1X1HA 2FV0A 1UMPA 4KKIA 4OK4A 3GZKA 1TN8B 5IK6A 5ILYA 5GZKA 1O5MB 2D8LA 3RRSA 5JMFA 1C3DA 4KTRA 2YIKA 3E80A 3WC3A 2WIIB 2ZZRA 2AHFA 2WY7A 1TNBB 1O1SB 2GH4A 5C05A 2H6FB 3WUXA 1N4RB 2RGKA 4AYPA 4YDOB 1UT9A 3SDVA 1V5CA 3E37B 2P0VA 2RI8A 1FO3A 2DRRA 4J5TA 1HM2A 4BOKA 3D5RA 3W7TA 1K72A 1CEMA 2ONGA 2PMVA 1KWFA 3DRAB 3SAEA 4Z4LA 4GL3A 1GHQA 1V5DA 4JJJA 1H54A 2WY8A 3E6UA 3QT9A 3EUVB 4GTRB 3VW5A 3A3VA 4BOJA 4DI5A 2EACA 1OJMA 3KSLB 3RX5A 3WIWA 1H12A 5GW7A 1FPPB 4DOEA 2FBAA 1KSDA 1FBWA 1LOHA 1WU4A 1LF9A 1F9GA 4D4BA 1AGMA 1WZZA 5FO8B 4F13A 1CB8A
chains in the Genus database with same CATH topology
5M7YA 1GAHA 4L0GA 1XW2A 3M73A 1N4QB 1G9GA 1GSZA 3S4AA 1KS8A 1H3BA 5FOBB 4WVCA 2V8IA 4AYOA 1HZFA 1L1YA 3DSUB 4Z4JA 2H6HB 3QG0A 2VN7A 1LD8B 3QPFA 3M7BA 1H35A 2JF4A 3S4DA 3H7LA 5AGDA 3RJ3A 4GTQB 4D4CA 2XFGA 3OEDA 5JPNB 3P5RA 2R2LB 2RI9A 4TF4A 3M74A 3EQAA 1JCSB 3D5SA 3Q78B 2V3NA 1XWQA 1W6JA 4DODA 2CQTA 1G87A 1SA4B 5JPMB 1O6QA 1DL2A 2IEJB 2OKXA 5CZLA 1TN7B 3EU8A 1GXMA 4GTTB 3E32B 2PN5A 4YCRA 3S9VA 3SQCA 3QDEA 2Z07A 3DSVB 1H39A 5GY3A 3PZ2B 1O1RB 2D5JA 2WINB 1G9JA 3EZ8A 4XUVA 3H3KA 1O6RA 1FP3A 3HXDB 4C1SA 4EL8A 1NI1B 3QT3A 1UG9A 3ANJA 1GA2A 3SDTA 1QQFA 4V1SA 1L2AA 3VXDA 4FUSA 2AFAA 2NOJA 1V7WA 3M75A 4YDEB 2G0DA 3K7XA 1O1TB 3OXUA 5DGRA 4WVAA 3W5NA 4LIXA 1GAIA 3G6JB 2VN4A 1JS4A 3P2CA 2GZ6A 1F9DA 4LNBB 4TXTA 4WU0A 2NVPA 2AHGA 3CIHA 5MEHA 3W5MA 1X81B 1TNZB 2XWJB 3M71A 1FT1B 1N9AB 1ULVA 2G02A 5KKBA 2JJBA 4CJ0A 1N94B 3Q75B 2FUZA 3DSWB 4CJ1A 3AFJA 1TF4A 2ZISB 4FXGB 1TNOB 3HXCB 1IA6A 4D4DA 2JG0A 2B4FA 4M76A 3QSPA 5CD2A 2GOXA 2H6IB 1CLCA 1GXOA 3W7SA 3QFZA 4ONTA 1AYXA 3T33A 1VD5A 2BEDB 1V7XA 1O6HA 1RQ5A 3QXFA 3HXFB 2SQCA 3PZ4B 1KSCA 3WKIA 1QSJA 3RX7A 3SFYB 1TNYB 1FMIA 5M7IA 3WKGA 3H2WA 2BB6A 2V3PA 2F0YB 2I07B 3E30B 3P5PA 3ANIA 3WIQA 3DSTB 1DCEB 4GTMB 1H14A 3PZ1B 1KKTA 3K11A 2EADA 4WVBA 4MBGB 1H13A 1JCQB 4GTSB 1H3CA 4EHMB 5CA3A 2DROA 1SQCA 1LD7B 3SDUA 1TNUB 3WKFA 1FBOA 2V8KA 3M7LA 2EAEA 1F9OA 3QWTA 1S64B 3PYBA 3DPYB 3ACTA 1QBQB 4LNVA 3W7XA 1KZOB 3EU5B 1GLMA 4GTPB 2CQSA 2A8ZA 4Q88A 3ACSA 1FCEA 4L9PB 1H37A 4V1RA 4ZG8A 4ZH5A 2XWBB 3M7EA 1MZCB 3ANKA 2B39A 3Q7FB 5FO9B 1GXNA 3SDRA 3M78A 1H36A 1KREA 3Q79B 2QNOA 1SA5B 2F6DA 4ZRPA 2EABA 4KTPA 3M76A 3GT5A 3PZ3B 1FO2A 1XWTA 1WU6A 2BB5A 4KKJA 3SDQA 1LF6A 3RENA 1H3AA 3D3IA 3DSXB 3S4BA 3E33B 3ON6A 4MU9A 1HCUA 5E2JA 3PYAA 3M7CA 4FXKB 2V8JA 1TN6B 3QFYA 3M77A 2H6GB 4GTOB 3X17A 4CE7A 3S4CA 3RX8A 2ZBLA 3Q73B 3HXBB 1N4PB 1G6IA 2WYNA 1X9DA 3E73A 3WIRA 3C72B 1R76A 1KRFA 3TF4A 4D4AA 3E34B 4GTVB 1KFGA 3KQ4A 1V7VA 2DRQA 3KSQB 2DRSA 3KLSA 3SFXB 3PMMA 3GLYA 1W6KA 1S63B 3QXQA 3RSYA 1KZPB 1DOGA 3QRYA 5DGQA 3WKHA 1FAEA 5FO7B 2ZIRB 1JCRB 1N4SB 1D8DB 3W7WA 4D94A 2XQWA 1WU5A 1NXCA 3CU7A 4AYRA 4ZRQA 1O79A 3W7UA 1N95B 2FV1A 1NC5A 1IS9A 3DSSB 3Q7AB 4L6XA 1FT2B 1D8EB 3M72A 4Q2BA 1IA7A 4AYQA 2BBCA 4LNGB 1LTXB 1NL4B 4ZH1A 2A73B 4QT9A 3HXEB 2FV0A 1UMPA 4KKIA 3GZKA 1TN8B 5GZKA 1O5MB 2D8LA 3RRSA 1C3DA 4KTRA 2YIKA 3WC3A 2WIIB 2ZZRA 2AHFA 2WY7A 1TNBB 1O1SB 2GH4A 2H6FB 3WUXA 1N4RB 2RGKA 4AYPA 4YDOB 1UT9A 3SDVA 1V5CA 3E37B 2P0VA 2RI8A 1FO3A 2DRRA 4J5TA 4BOKA 3D5RA 3W7TA 1K72A 1CEMA 2PMVA 3DRAB 1KWFA 3SAEA 4Z4LA 4GL3A 1GHQA 1V5DA 4JJJA 1H54A 2WY8A 3E6UA 3QT9A 3EUVB 4GTRB 3VW5A 3A3VA 4BOJA 2EACA 3KSLB 3RX5A 3WIWA 1H12A 5GW7A 1FPPB 4DOEA 2FBAA 1KSDA 1FBWA 1WU4A 1LF9A 4D4BA 1AGMA 1WZZA 5FO8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G0D A;  3KLS A;  3SFX B;  3K7X A;  1O1T B;  3OXU A;  1W6K A;  1S63 B;  1KZP B;  4MBG B;  1JCQ B;  4GTS B;  1N4Q B;  1H3C A;  1GSZ A;  3G6J B;  5FO7 B;  1H3B A;  2ZIR B;  4EHM B;  5FOB B;  1JCR B;  1N4S B;  1D8D B;  4LNB B;  2V8I A;  4D94 A;  2XQW A;  1HZF A;  1SQC A;  1LD7 B;  3CU7 A;  1X81 B;  1TNZ B;  2XWJ B;  1TNU B;  1FT1 B;  3DSU B;  2V8K A;  4ZRQ A;  2H6H B;  1O79 A;  1N9A B;  1N95 B;  1LD8 B;  2G02 A;  1S64 B;  3DSS B;  3Q7A B;  1FT2 B;  3DPY B;  1D8E B;  1H35 A;  1QBQ B;  2BBC A;  1N94 B;  4LNG B;  4LNV A;  1LTX B;  1NL4 B;  4ZH1 A;  2A73 B;  1KZO B;  3EU5 B;  3Q75 B;  4GTQ B;  5AGD A;  3DSW B;  3RJ3 A;  4GTP B;  4D4C A;  2ZIS B;  3HXE B;  4FXG B;  1TNO B;  3HXC B;  1UMP A;  4KKI A;  4D4D A;  4M76 A;  1TN8 B;  4L9P B;  1H37 A;  4V1R A;  2XWB B;  1MZC B;  1O5M B;  3OED A;  5JPN B;  2R2L B;  1C3D A;  2GOX A;  2WII B;  2B39 A;  2H6I B;  3Q7F B;  1JCS B;  3D5S A;  3Q78 B;  5FO9 B;  1GXN A;  1H36 A;  2V3N A;  2WY7 A;  1GXO A;  3Q79 B;  1TNB B;  1O1S B;  1SA5 B;  4ZRP A;  1W6J A;  2H6F B;  4ONT A;  1N4R B;  3PZ3 B;  1SA4 B;  5JPM B;  1O6Q A;  2IEJ B;  4YDO B;  2BED B;  3E37 B;  1TN7 B;  2BB5 A;  4KKJ A;  1GXM A;  4GTT B;  4BOK A;  3E32 B;  3D5R A;  2PN5 A;  1O6H A;  1H3A A;  3DSX B;  3DRA B;  2PMV A;  3HXF B;  2SQC A;  3PZ4 B;  3SQC A;  1GHQ A;  3E33 B;  1QSJ A;  4MU9 A;  3DSV B;  1H39 A;  3SFY B;  2WY8 A;  2V8J A;  4FXK B;  3PZ2 B;  1TN6 B;  1TNY B;  1O1R B;  2H6G B;  4GTO B;  2WIN B;  1O6R A;  3EUV B;  4GTR B;  2BB6 A;  3HXD B;  2V3P A;  4C1S A;  1NI1 B;  3Q73 B;  3HXB B;  2F0Y B;  1N4P B;  4BOJ A;  1QQF A;  2I07 B;  3E30 B;  3KSL B;  4V1S A;  3C72 B;  1FPP B;  1R76 A;  2NOJ A;  4D4B A;  4D4A A;  3DST B;  1DCE B;  4GTM B;  3E34 B;  4GTV B;  3KQ4 A;  5FO8 B;  3KSQ B;  3PZ1 B;  4YDE B; 
#chains in the Genus database with same CATH topology
 5M7Y A;  1OJN A;  1GAH A;  4L0G A;  1XW2 A;  3M73 A;  3AFL A;  1N4Q B;  1N23 A;  1G9G A;  1GSZ A;  1N22 A;  1KS8 A;  5EAS A;  3S4A A;  1H3B A;  5IK9 A;  5FOB B;  4WVC A;  2E24 A;  2J5C A;  2V8I A;  4AYO A;  4FNV A;  1HZF A;  2FUQ A;  1L1Y A;  3DSU B;  4Z4J A;  5DHK A;  2H6H B;  3QG0 A;  2VN7 A;  1LD8 B;  3QPF A;  4MMI A;  3M7B A;  3N0F A;  1H35 A;  2JF4 A;  3S4D A;  3H7L A;  5EAU A;  5AGD A;  3RJ3 A;  4GTQ B;  1RWF A;  5ILZ A;  4D4C A;  1HM3 A;  2XFG A;  1N21 A;  3OED A;  5JPN B;  3P5R A;  1RWG A;  2R2L B;  2RI9 A;  4TF4 A;  2WCO A;  3M74 A;  3EQA A;  1JCS B;  3D5S A;  3Q78 B;  4RNQ A;  2V3N A;  1N7Q A;  4FJQ A;  1XWQ A;  1W6J A;  4DOD A;  3A0O A;  1OJO A;  2CQT A;  1G87 A;  1SA4 B;  5JPM B;  1O6Q A;  1DL2 A;  2IEJ B;  2OKX A;  1N7R A;  5CZL A;  1EGU A;  5ILJ A;  1TN7 B;  3EU8 A;  1GXM A;  4GTT B;  3E32 B;  2PN5 A;  4YCR A;  3S9V A;  3SQC A;  3QDE A;  2Z07 A;  3DSV B;  1H39 A;  5GY3 A;  3PZ2 B;  1O1R B;  2D5J A;  2WIN B;  1G9J A;  3EZ8 A;  4XUV A;  3H3K A;  1O6R A;  1FP3 A;  2X03 A;  3HXD B;  2BRP A;  4C1S A;  4EL8 A;  1NI1 B;  3QT3 A;  1I8Q A;  1UG9 A;  3ANJ A;  1HV6 A;  1GA2 A;  3SDT A;  1QQF A;  4OZW A;  4V1S A;  1L2A A;  3VXD A;  4FUS A;  5DHI A;  2AFA A;  2NOJ A;  1V7W A;  3M75 A;  4YDE B;  2G0D A;  1LXK A;  3K7X A;  1O1T B;  3OXU A;  1N7O A;  1RWA A;  5DGR A;  4WVA A;  3W5N A;  3LZ9 A;  4LIX A;  1N7N A;  3G4D A;  1GAI A;  3G6J B;  2VN4 A;  1JS4 A;  3P2C A;  2GZ6 A;  1N24 A;  1F9D A;  1HMU A;  4LNB B;  4TXT A;  4WU0 A;  2NVP A;  2AHG A;  3CIH A;  5MEH A;  3W5M A;  1X81 B;  1TNZ B;  2XWJ B;  3M71 A;  1FT1 B;  1LXM A;  1N9A B;  4OZV A;  1ULV A;  2G02 A;  5KKB A;  3VSN A;  2JJB A;  4CJ0 A;  3M02 A;  1N94 B;  1HXA A;  3Q75 B;  2FUZ A;  1RWC A;  3DSW B;  4CJ1 A;  3AFJ A;  1TF4 A;  2ZIS B;  5IKA A;  4FXG B;  1TNO B;  3HXC B;  1IA6 A;  3NFV A;  4D4D A;  4E1Y A;  2JG0 A;  2B4F A;  5IKH A;  4M76 A;  3QSP A;  5CD2 A;  2GOX A;  2H6I B;  4MMH A;  1CLC A;  5ILD A;  1GXO A;  3W7S A;  3QFZ A;  4ONT A;  1AYX A;  2BRV X;  5EAT A;  1RWH A;  1N7P A;  3T33 A;  1VD5 A;  2BED B;  1V7X A;  1O6H A;  1RQ5 A;  3QXF A;  3HXF B;  1HXC A;  2SQC A;  3PZ4 B;  1KSC A;  3WKI A;  1QSJ A;  3RX7 A;  3SFY B;  1TNY B;  1FMI A;  5M7I A;  3WKG A;  3H2W A;  2BB6 A;  2V3P A;  2F0Y B;  2I07 B;  3E30 B;  3P5P A;  3ANI A;  3G4F A;  5IL3 A;  3WIQ A;  3DST B;  1DCE B;  4GTM B;  1H14 A;  3M01 A;  1J0M A;  3PZ1 B;  1KKT A;  3VSM A;  3K11 A;  2EAD A;  2ONH A;  4WVB A;  4MBG B;  1H13 A;  1JCQ B;  4GTS B;  1H3C A;  1HN0 A;  4EHM B;  1N1B A;  5CA3 A;  3M00 A;  2DRO A;  5ILK A;  1SQC A;  1LD7 B;  3SDU A;  1TNU B;  3WKF A;  1FBO A;  2V8K A;  3M7L A;  2EAE A;  4OK2 A;  1F9O A;  3QWT A;  1W3Y A;  5IM1 A;  1S64 B;  5IK0 A;  3PYB A;  3DPY B;  3ACT A;  1QBQ B;  4LNV A;  3W7X A;  1KZO B;  1C82 A;  3EU5 B;  1GLM A;  4GTP B;  4NEI A;  2CQS A;  2A8Z A;  4Q88 A;  3ACS A;  2Q1F A;  1FCE A;  4L9P B;  1H37 A;  4V1R A;  4ZG8 A;  4ZH5 A;  2XWB B;  3M7E A;  1MZC B;  1QAZ A;  5IL8 A;  3ANK A;  2B39 A;  3Q7F B;  5FO9 B;  1GXN A;  1RW9 A;  3SDR A;  3M78 A;  1H36 A;  1KRE A;  3Q79 B;  2QNO A;  1SA5 B;  2F6D A;  4ZRP A;  2EAB A;  4KTP A;  1HXG A;  3M76 A;  3GT5 A;  3PZ3 B;  1FO2 A;  1XWT A;  1WU6 A;  2BB5 A;  4KKJ A;  3SDQ A;  1LF6 A;  3REN A;  1H3A A;  3D3I A;  3DSX B;  3S4B A;  3E33 B;  3ON6 A;  4MU9 A;  1HCU A;  1HX9 A;  5E2J A;  3PYA A;  5ILH A;  3M7C A;  2V8J A;  4FXK B;  1N1Z A;  1TN6 B;  2WDA A;  3QFY A;  3M77 A;  2H6G B;  4GTO B;  3X17 A;  4CE7 A;  3S4C A;  3RX8 A;  2ZBL A;  3Q73 B;  3HXB B;  1N4P B;  4F10 A;  1G6I A;  2WYN A;  1X9D A;  3E73 A;  4GAX A;  3WIR A;  3C72 B;  1R76 A;  1KRF A;  3TF4 A;  4D4A A;  3E34 B;  4GTV B;  1KFG A;  3KQ4 A;  1V7V A;  2DRQ A;  3KSQ B;  2DRS A;  3KLS A;  1F1S A;  3SFX B;  3PMM A;  3GLY A;  4OJZ A;  1W6K A;  1S63 B;  3QXQ A;  3RSY A;  1X1I A;  1KZP B;  1DOG A;  3QRY A;  5DGQ A;  3WKH A;  1FAE A;  1OJP A;  5FO7 B;  1HMW A;  2ZIR B;  1N20 A;  1JCR B;  1N4S B;  1D8D B;  3NNB A;  1J0N A;  2E22 A;  4D94 A;  2XQW A;  3W7W A;  1WU5 A;  1NXC A;  3CU7 A;  4AYR A;  4ZRQ A;  1O79 A;  3W7U A;  2BRW A;  5ILI A;  1N95 B;  5JMD A;  2FV1 A;  1NC5 A;  1IS9 A;  3DSS B;  3Q7A B;  3N0G A;  4L6X A;  1FT2 B;  1D8E B;  3M72 A;  4Q2B A;  1IA7 A;  4AYQ A;  2BBC A;  2FUT A;  4LNG B;  1X1J A;  1LTX B;  1NL4 B;  4ZH1 A;  2A73 B;  4QT9 A;  3E7J A;  3HXE B;  1X1H A;  2FV0 A;  1UMP A;  4KKI A;  4OK4 A;  3GZK A;  1TN8 B;  5IK6 A;  5ILY A;  5GZK A;  1O5M B;  2D8L A;  3RRS A;  5JMF A;  1C3D A;  4KTR A;  2YIK A;  3E80 A;  3WC3 A;  2WII B;  2ZZR A;  2AHF A;  2WY7 A;  1TNB B;  1O1S B;  2GH4 A;  5C05 A;  2H6F B;  3WUX A;  1N4R B;  2RGK A;  4AYP A;  4YDO B;  1UT9 A;  3SDV A;  1V5C A;  3E37 B;  2P0V A;  2RI8 A;  1FO3 A;  2DRR A;  4J5T A;  1HM2 A;  4BOK A;  3D5R A;  3W7T A;  1K72 A;  1CEM A;  2ONG A;  2PMV A;  1KWF A;  3DRA B;  3SAE A;  4Z4L A;  4GL3 A;  1GHQ A;  1V5D A;  4JJJ A;  1H54 A;  2WY8 A;  3E6U A;  3QT9 A;  3EUV B;  4GTR B;  3VW5 A;  3A3V A;  4BOJ A;  4DI5 A;  2EAC A;  1OJM A;  3KSL B;  3RX5 A;  3WIW A;  1H12 A;  5GW7 A;  1FPP B;  4DOE A;  2FBA A;  1KSD A;  1FBW A;  1LOH A;  1WU4 A;  1LF9 A;  1F9G A;  4D4B A;  1AGM A;  1WZZ A;  5FO8 B;  4F13 A;  1CB8 A; 
#chains in the Genus database with same CATH homology
 5M7Y A;  1GAH A;  4L0G A;  1XW2 A;  3M73 A;  1N4Q B;  1G9G A;  1GSZ A;  3S4A A;  1KS8 A;  1H3B A;  5FOB B;  4WVC A;  2V8I A;  4AYO A;  1HZF A;  1L1Y A;  3DSU B;  4Z4J A;  2H6H B;  3QG0 A;  2VN7 A;  1LD8 B;  3QPF A;  3M7B A;  1H35 A;  2JF4 A;  3S4D A;  3H7L A;  5AGD A;  3RJ3 A;  4GTQ B;  4D4C A;  2XFG A;  3OED A;  5JPN B;  3P5R A;  2R2L B;  2RI9 A;  4TF4 A;  3M74 A;  3EQA A;  1JCS B;  3D5S A;  3Q78 B;  2V3N A;  1XWQ A;  1W6J A;  4DOD A;  2CQT A;  1G87 A;  1SA4 B;  5JPM B;  1O6Q A;  1DL2 A;  2IEJ B;  2OKX A;  5CZL A;  1TN7 B;  3EU8 A;  1GXM A;  4GTT B;  3E32 B;  2PN5 A;  4YCR A;  3S9V A;  3SQC A;  3QDE A;  2Z07 A;  3DSV B;  1H39 A;  5GY3 A;  3PZ2 B;  1O1R B;  2D5J A;  2WIN B;  1G9J A;  3EZ8 A;  4XUV A;  3H3K A;  1O6R A;  1FP3 A;  3HXD B;  4C1S A;  4EL8 A;  1NI1 B;  3QT3 A;  1UG9 A;  3ANJ A;  1GA2 A;  3SDT A;  1QQF A;  4V1S A;  1L2A A;  3VXD A;  4FUS A;  2AFA A;  2NOJ A;  1V7W A;  3M75 A;  4YDE B;  2G0D A;  3K7X A;  1O1T B;  3OXU A;  5DGR A;  4WVA A;  3W5N A;  4LIX A;  1GAI A;  3G6J B;  2VN4 A;  1JS4 A;  3P2C A;  2GZ6 A;  1F9D A;  4LNB B;  4TXT A;  4WU0 A;  2NVP A;  2AHG A;  3CIH A;  5MEH A;  3W5M A;  1X81 B;  1TNZ B;  2XWJ B;  3M71 A;  1FT1 B;  1N9A B;  1ULV A;  2G02 A;  5KKB A;  2JJB A;  4CJ0 A;  1N94 B;  3Q75 B;  2FUZ A;  3DSW B;  4CJ1 A;  3AFJ A;  1TF4 A;  2ZIS B;  4FXG B;  1TNO B;  3HXC B;  1IA6 A;  4D4D A;  2JG0 A;  2B4F A;  4M76 A;  3QSP A;  5CD2 A;  2GOX A;  2H6I B;  1CLC A;  1GXO A;  3W7S A;  3QFZ A;  4ONT A;  1AYX A;  3T33 A;  1VD5 A;  2BED B;  1V7X A;  1O6H A;  1RQ5 A;  3QXF A;  3HXF B;  2SQC A;  3PZ4 B;  1KSC A;  3WKI A;  1QSJ A;  3RX7 A;  3SFY B;  1TNY B;  1FMI A;  5M7I A;  3WKG A;  3H2W A;  2BB6 A;  2V3P A;  2F0Y B;  2I07 B;  3E30 B;  3P5P A;  3ANI A;  3WIQ A;  3DST B;  1DCE B;  4GTM B;  1H14 A;  3PZ1 B;  1KKT A;  3K11 A;  2EAD A;  4WVB A;  4MBG B;  1H13 A;  1JCQ B;  4GTS B;  1H3C A;  4EHM B;  5CA3 A;  2DRO A;  1SQC A;  1LD7 B;  3SDU A;  1TNU B;  3WKF A;  1FBO A;  2V8K A;  3M7L A;  2EAE A;  1F9O A;  3QWT A;  1S64 B;  3PYB A;  3DPY B;  3ACT A;  1QBQ B;  4LNV A;  3W7X A;  1KZO B;  3EU5 B;  1GLM A;  4GTP B;  2CQS A;  2A8Z A;  4Q88 A;  3ACS A;  1FCE A;  4L9P B;  1H37 A;  4V1R A;  4ZG8 A;  4ZH5 A;  2XWB B;  3M7E A;  1MZC B;  3ANK A;  2B39 A;  3Q7F B;  5FO9 B;  1GXN A;  3SDR A;  3M78 A;  1H36 A;  1KRE A;  3Q79 B;  2QNO A;  1SA5 B;  2F6D A;  4ZRP A;  2EAB A;  4KTP A;  3M76 A;  3GT5 A;  3PZ3 B;  1FO2 A;  1XWT A;  1WU6 A;  2BB5 A;  4KKJ A;  3SDQ A;  1LF6 A;  3REN A;  1H3A A;  3D3I A;  3DSX B;  3S4B A;  3E33 B;  3ON6 A;  4MU9 A;  1HCU A;  5E2J A;  3PYA A;  3M7C A;  4FXK B;  2V8J A;  1TN6 B;  3QFY A;  3M77 A;  2H6G B;  4GTO B;  3X17 A;  4CE7 A;  3S4C A;  3RX8 A;  2ZBL A;  3Q73 B;  3HXB B;  1N4P B;  1G6I A;  2WYN A;  1X9D A;  3E73 A;  3WIR A;  3C72 B;  1R76 A;  1KRF A;  3TF4 A;  4D4A A;  3E34 B;  4GTV B;  1KFG A;  3KQ4 A;  1V7V A;  2DRQ A;  3KSQ B;  2DRS A;  3KLS A;  3SFX B;  3PMM A;  3GLY A;  1W6K A;  1S63 B;  3QXQ A;  3RSY A;  1KZP B;  1DOG A;  3QRY A;  5DGQ A;  3WKH A;  1FAE A;  5FO7 B;  2ZIR B;  1JCR B;  1N4S B;  1D8D B;  3W7W A;  4D94 A;  2XQW A;  1WU5 A;  1NXC A;  3CU7 A;  4AYR A;  4ZRQ A;  1O79 A;  3W7U A;  1N95 B;  2FV1 A;  1NC5 A;  1IS9 A;  3DSS B;  3Q7A B;  4L6X A;  1FT2 B;  1D8E B;  3M72 A;  4Q2B A;  1IA7 A;  4AYQ A;  2BBC A;  4LNG B;  1LTX B;  1NL4 B;  4ZH1 A;  2A73 B;  4QT9 A;  3HXE B;  2FV0 A;  1UMP A;  4KKI A;  3GZK A;  1TN8 B;  5GZK A;  1O5M B;  2D8L A;  3RRS A;  1C3D A;  4KTR A;  2YIK A;  3WC3 A;  2WII B;  2ZZR A;  2AHF A;  2WY7 A;  1TNB B;  1O1S B;  2GH4 A;  2H6F B;  3WUX A;  1N4R B;  2RGK A;  4AYP A;  4YDO B;  1UT9 A;  3SDV A;  1V5C A;  3E37 B;  2P0V A;  2RI8 A;  1FO3 A;  2DRR A;  4J5T A;  4BOK A;  3D5R A;  3W7T A;  1K72 A;  1CEM A;  2PMV A;  3DRA B;  1KWF A;  3SAE A;  4Z4L A;  4GL3 A;  1GHQ A;  1V5D A;  4JJJ A;  1H54 A;  2WY8 A;  3E6U A;  3QT9 A;  3EUV B;  4GTR B;  3VW5 A;  3A3V A;  4BOJ A;  2EAC A;  3KSL B;  3RX5 A;  3WIW A;  1H12 A;  5GW7 A;  1FPP B;  4DOE A;  2FBA A;  1KSD A;  1FBW A;  1WU4 A;  1LF9 A;  4D4B A;  1AGM A;  1WZZ A;  5FO8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...