2AHGA

Unsaturated glucuronyl hydrolase mutant d88n with dglca-galnac
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
377
structure length
377
Chain Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHNIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords unsaturated glucuronyl hydrolase
publication title Crystal Structure of Unsaturated Glucuronyl Hydrolase Complexed with Substrate: MOLECULAR INSIGHTS INTO ITS CATALYTIC REACTION MECHANISM
pubmed doi rcsb
source organism Bacillus sp.
total genus 156
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2ahgA00
4WVAA 1AYXA 3H2WA 3ANJA 3RSYA 1KFGA 3ACTA 2YIKA 3RX5A 1VD5A 2Z07A 1AGMA 3T33A 4DOEA 3W5NA 1G6IA 4Z4JA 4L0GA 1ULVA 2A8ZA 3QRYA 3S4CA 1KSCA 3QT9A 2EABA 2JG0A 1DOGA 1FAEA 2AHFA 1IS9A 2FUZA 1H54A 2NVPA 2OKXA 3RX8A 1XWTA 2JF4A 3WKFA 1KWFA 3S4BA 3WIRA 3QWTA 1GAIA 3PMMA 3GZKA 5M7IA 2RI8A 1FBWA 3W7TA 3QXQA 4AYQA 1JS4A 3ANIA 1V5CA 1WU4A 3S4AA 3WC3A 4CE7A 4TF4A 1WZZA 2CQTA 2RI9A 3ANKA 3QFZA 2D5JA 1KSDA 1V7XA 3W7WA 1G9GA 5CA3A 1IA6A 4DODA 4EL8A 1X9DA 1DL2A 1V7WA 2WYNA 1GLMA 3RRSA 1LF9A 1GA2A 4AYOA 3W7UA 1L2AA 4WVBA 3RENA 1KS8A 3W7XA 2FBAA 1H13A 3WKHA 4CJ1A 3RX7A 3QG0A 4AYRA 1K72A 1G9JA 3QDEA 3P2CA 1HCUA 1V5DA 3QFYA 1CEMA 3WIWA 4J5TA 2QNOA 1XW2A 2RGKA 5E2JA 4AYPA 1LF6A 4TXTA 4Q2BA 3WKIA 3CIHA 3GLYA 1H12A 3H3KA 1IA7A 5GW7A 2ZBLA 3EQAA 5DGRA 2D8LA 3D3IA 1KREA 4WVCA 5GY3A 2FV0A 1RQ5A 1CLCA 4XUVA 1G87A 2DRSA 4JJJA 3WKGA 5KKBA 5DGQA 2P0VA 1NC5A 4Q88A 1UG9A 1L1YA 1F9OA 2CQSA 1NXCA 2F6DA 2FV1A 2GZ6A 3AFJA 4FUSA 4KTPA 1FP3A 4L6XA 3W5MA 3QPFA 3ON6A 3VXDA 2ZZRA 2AHGA 1TF4A 3QSPA 4KTRA 3WIQA 2EAEA 2EADA 3QT3A 1KKTA 3QXFA 3TF4A 2DRQA 1XWQA 2EACA 4ZG8A 2DRRA 5CD2A 1UT9A 3ACSA 1KRFA 1FMIA 1H14A 3A3VA 2DROA 1WU6A 2VN7A 3E6UA 3S4DA 3W7SA 1FCEA 1FBOA 3VW5A 3WUXA 1FO2A 5MEHA 1WU5A 3K11A 4ZH5A 2VN4A 5M7YA 4CJ0A 3H7LA 2B4FA 1F9DA 2AFAA 3X17A 1V7VA 1FO3A 1GAHA 2JJBA 4Z4LA 3E73A 3EZ8A 4WU0A 5CZLA 2XFGA 3GT5A 2GH4A
chains in the Genus database with same CATH superfamily
4WVAA 3H2WA 1LTXB 1HMUA 4OZVA 3ACTA 3DRAB 1TNBB 3T33A 3W5NA 4DOEA 4MU9A 1G6IA 1FT2B 4Z4JA 2WCOA 4L0GA 1RWAA 2V3NA 3QRYA 3D5SA 3QT9A 3Q7FB 4F10A 2EABA 2JG0A 1S64B 2SQCA 4GTTB 2NOJA 4LIXA 3GZKA 5M7IA 1QSJA 1UMPA 2WY7A 3HXCB 3SDRA 1JS4A 1DCEB 1OJPA 1JCQB 4OZWA 1C3DA 1H3AA 1N4QB 3ANKA 3M72A 3A0OA 1IA6A 2BRVX 1N7OA 4EL8A 2H6FB 4F13A 1GXNA 2H6GB 1X1JA 4BOJA 3VSMA 1SA4B 3RX7A 2WDAA 3M7BA 4V1SA 2E22A 1HCUA 3DPYB 3WIWA 4J5TA 2RGKA 4AYPA 4BOKA 3SDVA 4V1RA 4ONTA 1MZCB 2BRPA 3H3KA 1IA7A 3EU5B 1O5MB 1H35A 3D3IA 1X81B 3N0GA 5GY3A 2FV0A 3PYBA 4DI5A 4XUVA 2DRSA 4JJJA 5KKBA 2P0VA 2F6DA 2CQSA 2FV1A 4MMHA 4D4BA 1NI1B 4KTPA 3W5MA 3DSSB 5IK9A 4QT9A 2AHGA 3WIQA 2EAEA 3QT3A 3EU8A 4RNQA 1H3CA 5ILHA 1UT9A 2WINB 3ACSA 1H14A 3A3VA 2DROA 3E6UA 3S4DA 3W7SA 1FO2A 3E34B 3Q79B 5M7YA 1N4PB 1GSZA 2V8KA 1V7VA 1GAHA 2R2LB 5EAUA 5EATA 2XFGA 2GH4A 1AYXA 1LXKA 2X03A 1N7RA 3RX5A 1NL4B 2G02A 1O1SB 2XQWA 5IK6A 4D94A 2A8ZA 4KKIA 3S4CA 1KSCA 1X1IA 3KLSA 4GTOB 4MMIA 4L9PB 1IS9A 3RX8A 2JF4A 2BBCA 3WKFA 1O6HA 3SDQA 1FBWA 1LD8B 3QXQA 3W7TA 4D4DA 3S4AA 4CE7A 3M7LA 1WZZA 2RI9A 1O79A 3NFVA 1SA5B 3E7JA 1KSDA 3EUVB 5JPMB 3P5RA 3SFXB 4DODA 1HV6A 1DL2A 2H6HB 1RWCA 2PMVA 3E33B 1GLMA 3RRSA 1LF9A 1TNOB 1H37A 1N7PA 4WVBA 3G6JB 3E30B 3RENA 3K7XA 1KZPB 2ZISB 2WIIB 3NNBA 4D4CA 1K72A 2GOXA 1G9JA 3P2CA 3QFYA 3DSTB 2QNOA 5E2JA 5IM1A 3WKIA 3GLYA 1OJNA 3EQAA 1W6KA 4EHMB 3E80A 1H3BA 3E32B 1JCRB 1N1ZA 1CLCA 3PZ2B 1N1BA 5DGQA 1UG9A 2GZ6A 4LNVA 1FP3A 4L6XA 3M7EA 3VXDA 2BRWA 3QSPA 4KTRA 2EADA 1N7NA 1KKTA 3QXFA 2ONHA 2EACA 4ZG8A 4OJZA 3DSWB 2J5CA 3PYAA 1KRFA 1QQFA 3RJ3A 2Q1FA 5ILDA 3K11A 1N9AB 2VN4A 3H7LA 1JCSB 1FO3A 3KQ4A 3E73A 5CZLA 5ILJA 2V8IA 3GT5A 1F9GA 1N4SB 1RW9A 2H6IB 3ANJA 1FPPB 1H39A 2BB6A 3RSYA 2V8JA 1VD5A 3G4FA 1GXMA 5IKHA 4FNVA 3M74A 5FOBB 1KZOB 3M71A 1HXAA 4GL3A 1DOGA 1FAEA 1D8DB 2AHFA 2FUZA 3Q75B 1H54A 2NVPA 2OKXA 1KWFA 3S4BA 1H36A 3WIRA 4E1YA 3C72B 4D4AA 2RI8A 2XWBB 1GXOA 1V5CA 1WU4A 3WC3A 3DSXB 4TF4A 3M7CA 3OXUA 1TNUB 4LNGB 1V7XA 3P5PA 3W7WA 1G9GA 1N24A 1HXGA 1N94B 4OK2A 2WYNA 3HXDB 1N22A 3SDUA 1GA2A 5ILKA 1L2AA 3W7UA 1KS8A 3VSNA 3PZ3B 2G0DA 3W7XA 2FBAA 1H13A 1C82A 5DHKA 4C1SA 4CJ1A 3E37B 3QG0A 3AFLA 4AYRA 4GTVB 2F0YB 1CEMA 1HMWA 1I8QA 4YCRA 4Q2BA 5ILZA 3CIHA 1H12A 1N20A 4GTMB 4GTRB 3SDTA 5DGRA 1KREA 4WVCA 3SAEA 4NEIA 4FJQA 5ILIA 3KSQB 2BB5A 2ONGA 2PN5A 1O6QA 2I07B 3WKGA 1NC5A 5FO8B 1NXCA 2V3PA 1LD7B 3M76A 1RWGA 1HZFA 5FO9B 3SQCA 4M76A 3HXEB 2E24A 2ZIRB 1XWQA 4FXGB 5CD2A 4ZH1A 1TN8B 3D5RA 1CB8A 3M78A 1FCEA 3CU7A 3VW5A 1N95B 5IL3A 3SFYB 3PZ1B 5MEHA 1WU5A 4GTSB 1O1RB 2B4FA 2XWJB 2AFAA 1HX9A 3M77A 1J0MA 1RWHA 4Z4LA 3EZ8A 4YDEB 1SQCA 1OJMA 2A73B 3HXBB 1KFGA 1HM3A 2YIKA 2Z07A 1O6RA 1AGMA 4GAXA 5IK0A 4KKJA 3Q7AB 5ILYA 1ULVA 3Q78B 1HM2A 1W6JA 1O1TB 3M02A 1XWTA 3M73A 1HXCA 3HXFB 1GAIA 2FUQA 1TNYB 3PMMA 3QWTA 4LNBB 3KSLB 4AYQA 1TN7B 3ANIA 1LXMA 3LZ9A 1N7QA 3N0FA 2CQTA 4YDOB 4FXKB 2WY8A 1QBQB 2D5JA 3QFZA 1W3YA 5CA3A 4GTQB 1HN0A 1X9DA 5AGDA 5FO7B 1V7WA 1N21A 2BEDB 4AYOA 5IKAA 5GZKA 3S9VA 1X1HA 5C05A 3WKHA 2FUTA 3PZ4B 1F1SA 3QDEA 1V5DA 2B39A 1XW2A 1LF6A 4TXTA 3G4DA 4ZRQA 1S63B 5GW7A 2ZBLA 1LOHA 2D8LA 3OEDA 3M01A 1RQ5A 5JPNB 3DSUB 1G87A 3Q73B 1D8EB 4Q88A 1L1YA 1F9OA 5JMDA 3AFJA 4FUSA 3M75A 1TNZB 3QPFA 3ON6A 2ZZRA 1GHQA 1TF4A 4OK4A 5IL8A 1N4RB 5EASA 3TF4A 2DRQA 1OJOA 1N23A 2IEJB 2DRRA 1FMIA 1WU6A 5JMFA 2VN7A 4MBGB 1FBOA 3WUXA 1TN6B 1FT1B 4ZH5A 4GTPB 1EGUA 4CJ0A 3M00A 1F9DA 4ZRPA 5DHIA 1J0NA 3X17A 1R76A 1QAZA 1RWFA 2JJBA 3DSVB 4WU0A
chains in the Genus database with same CATH topology
4WVAA 3H2WA 1LTXB 3ACTA 3DRAB 1TNBB 3T33A 3W5NA 4DOEA 4MU9A 1G6IA 1FT2B 4Z4JA 4L0GA 2V3NA 3QRYA 3D5SA 3QT9A 3Q7FB 2EABA 2JG0A 1S64B 2SQCA 4GTTB 2NOJA 4LIXA 3GZKA 5M7IA 1QSJA 1UMPA 2WY7A 3HXCB 3SDRA 1JS4A 1DCEB 1JCQB 1C3DA 1H3AA 1N4QB 3ANKA 3M72A 1IA6A 4EL8A 2H6FB 1GXNA 2H6GB 4BOJA 1SA4B 3RX7A 3M7BA 4V1SA 1HCUA 3DPYB 3WIWA 4J5TA 2RGKA 4AYPA 4BOKA 3SDVA 4V1RA 4ONTA 1MZCB 3H3KA 1IA7A 3EU5B 1O5MB 1H35A 3D3IA 1X81B 5GY3A 2FV0A 3PYBA 4XUVA 2DRSA 4JJJA 5KKBA 2P0VA 2F6DA 2CQSA 2FV1A 4D4BA 1NI1B 4KTPA 3W5MA 3DSSB 4QT9A 2AHGA 3WIQA 2EAEA 3QT3A 3EU8A 1H3CA 1UT9A 2WINB 3ACSA 1H14A 3A3VA 2DROA 3E6UA 3S4DA 3W7SA 1FO2A 3E34B 3Q79B 5M7YA 1N4PB 1GSZA 2V8KA 1V7VA 1GAHA 2R2LB 2XFGA 2GH4A 1AYXA 3RX5A 1NL4B 2G02A 1O1SB 2XQWA 4D94A 2A8ZA 4KKIA 3S4CA 1KSCA 3KLSA 4GTOB 4L9PB 1IS9A 3RX8A 2JF4A 2BBCA 3WKFA 1O6HA 3SDQA 1FBWA 1LD8B 3QXQA 3W7TA 4D4DA 3S4AA 4CE7A 3M7LA 1WZZA 2RI9A 1O79A 1SA5B 1KSDA 3EUVB 5JPMB 3P5RA 3SFXB 4DODA 1DL2A 2H6HB 2PMVA 3E33B 1GLMA 3RRSA 1LF9A 1TNOB 1H37A 4WVBA 3G6JB 3E30B 3RENA 3K7XA 1KZPB 2ZISB 2WIIB 4D4CA 1K72A 2GOXA 1G9JA 3P2CA 3QFYA 3DSTB 2QNOA 5E2JA 3WKIA 3GLYA 3EQAA 1W6KA 4EHMB 1H3BA 3E32B 1JCRB 1CLCA 3PZ2B 5DGQA 1UG9A 2GZ6A 4LNVA 1FP3A 4L6XA 3M7EA 3VXDA 3QSPA 4KTRA 2EADA 3QXFA 1KKTA 2EACA 4ZG8A 3DSWB 3PYAA 1KRFA 1QQFA 3RJ3A 3K11A 1N9AB 2VN4A 3H7LA 1JCSB 1FO3A 3KQ4A 3E73A 5CZLA 3GT5A 2V8IA 1N4SB 2H6IB 3ANJA 1FPPB 1H39A 2BB6A 3RSYA 2V8JA 1VD5A 1GXMA 5FOBB 3M74A 1KZOB 3M71A 4GL3A 1DOGA 1FAEA 1D8DB 2AHFA 2FUZA 3Q75B 1H54A 2NVPA 2OKXA 1KWFA 3S4BA 1H36A 3WIRA 3C72B 4D4AA 2RI8A 2XWBB 1GXOA 1V5CA 1WU4A 3WC3A 3DSXB 4TF4A 3M7CA 3OXUA 1TNUB 4LNGB 1V7XA 3P5PA 3W7WA 1G9GA 1N94B 2WYNA 3HXDB 3SDUA 1GA2A 3W7UA 1L2AA 1KS8A 3PZ3B 2G0DA 3W7XA 2FBAA 1H13A 4C1SA 4CJ1A 3E37B 3QG0A 4AYRA 4GTVB 2F0YB 1CEMA 4YCRA 4Q2BA 3CIHA 1H12A 4GTMB 4GTRB 3SDTA 5DGRA 1KREA 4WVCA 3SAEA 3KSQB 2BB5A 2PN5A 1O6QA 2I07B 3WKGA 1NC5A 5FO8B 1NXCA 2V3PA 1LD7B 3M76A 5FO9B 1HZFA 3SQCA 4M76A 3HXEB 2ZIRB 1XWQA 4FXGB 5CD2A 4ZH1A 1TN8B 3D5RA 3M78A 1FCEA 3CU7A 3VW5A 1N95B 3SFYB 3PZ1B 5MEHA 1WU5A 4GTSB 1O1RB 2B4FA 2XWJB 2AFAA 3M77A 4Z4LA 3EZ8A 4YDEB 1SQCA 2A73B 3HXBB 1KFGA 2YIKA 2Z07A 1O6RA 1AGMA 4KKJA 3Q7AB 1ULVA 3Q78B 1W6JA 1O1TB 1XWTA 3M73A 3HXFB 1GAIA 3QWTA 1TNYB 3PMMA 4LNBB 3KSLB 4AYQA 1TN7B 3ANIA 2CQTA 4YDOB 4FXKB 2WY8A 3QFZA 1QBQB 2D5JA 5CA3A 4GTQB 1X9DA 5AGDA 5FO7B 1V7WA 2BEDB 4AYOA 5GZKA 3S9VA 3WKHA 3PZ4B 3QDEA 1V5DA 2B39A 1XW2A 1LF6A 4TXTA 4ZRQA 1S63B 5GW7A 2ZBLA 2D8LA 3OEDA 1RQ5A 5JPNB 3DSUB 1G87A 3Q73B 1D8EB 4Q88A 1L1YA 1F9OA 3AFJA 4FUSA 3M75A 1TNZB 3QPFA 3ON6A 2ZZRA 1GHQA 1TF4A 1N4RB 3TF4A 2DRQA 2IEJB 2DRRA 1FMIA 1WU6A 2VN7A 4MBGB 1FBOA 3WUXA 1TN6B 1FT1B 4ZH5A 4GTPB 4CJ0A 4ZRPA 1F9DA 3X17A 1R76A 2JJBA 3DSVB 4WU0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WVA A;  1AYX A;  3H2W A;  3ANJ A;  3RSY A;  1KFG A;  3ACT A;  2YIK A;  3RX5 A;  1VD5 A;  2Z07 A;  1AGM A;  3T33 A;  4DOE A;  3W5N A;  1G6I A;  4Z4J A;  4L0G A;  1ULV A;  2A8Z A;  3QRY A;  3S4C A;  1KSC A;  3QT9 A;  2EAB A;  2JG0 A;  1DOG A;  1FAE A;  2AHF A;  1IS9 A;  2FUZ A;  1H54 A;  2NVP A;  2OKX A;  3RX8 A;  1XWT A;  2JF4 A;  3WKF A;  1KWF A;  3S4B A;  3WIR A;  3QWT A;  1GAI A;  3PMM A;  3GZK A;  5M7I A;  2RI8 A;  1FBW A;  3W7T A;  3QXQ A;  4AYQ A;  1JS4 A;  3ANI A;  1V5C A;  1WU4 A;  3S4A A;  3WC3 A;  4CE7 A;  4TF4 A;  1WZZ A;  2CQT A;  2RI9 A;  3ANK A;  3QFZ A;  2D5J A;  1KSD A;  1V7X A;  3W7W A;  1G9G A;  5CA3 A;  1IA6 A;  4DOD A;  4EL8 A;  1X9D A;  1DL2 A;  1V7W A;  2WYN A;  1GLM A;  3RRS A;  1LF9 A;  1GA2 A;  4AYO A;  3W7U A;  1L2A A;  4WVB A;  3REN A;  1KS8 A;  3W7X A;  2FBA A;  1H13 A;  3WKH A;  4CJ1 A;  3RX7 A;  3QG0 A;  4AYR A;  1K72 A;  1G9J A;  3QDE A;  3P2C A;  1HCU A;  1V5D A;  3QFY A;  1CEM A;  3WIW A;  4J5T A;  2QNO A;  1XW2 A;  2RGK A;  5E2J A;  4AYP A;  1LF6 A;  4TXT A;  4Q2B A;  3WKI A;  3CIH A;  3GLY A;  1H12 A;  3H3K A;  1IA7 A;  5GW7 A;  2ZBL A;  3EQA A;  5DGR A;  2D8L A;  3D3I A;  1KRE A;  4WVC A;  5GY3 A;  2FV0 A;  1RQ5 A;  1CLC A;  4XUV A;  1G87 A;  2DRS A;  4JJJ A;  3WKG A;  5KKB A;  5DGQ A;  2P0V A;  1NC5 A;  4Q88 A;  1UG9 A;  1L1Y A;  1F9O A;  2CQS A;  1NXC A;  2F6D A;  2FV1 A;  2GZ6 A;  3AFJ A;  4FUS A;  4KTP A;  1FP3 A;  4L6X A;  3W5M A;  3QPF A;  3ON6 A;  3VXD A;  2ZZR A;  2AHG A;  1TF4 A;  3QSP A;  4KTR A;  3WIQ A;  2EAE A;  2EAD A;  3QT3 A;  1KKT A;  3QXF A;  3TF4 A;  2DRQ A;  1XWQ A;  2EAC A;  4ZG8 A;  2DRR A;  5CD2 A;  1UT9 A;  3ACS A;  1KRF A;  1FMI A;  1H14 A;  3A3V A;  2DRO A;  1WU6 A;  2VN7 A;  3E6U A;  3S4D A;  3W7S A;  1FCE A;  1FBO A;  3VW5 A;  3WUX A;  1FO2 A;  5MEH A;  1WU5 A;  3K11 A;  4ZH5 A;  2VN4 A;  5M7Y A;  4CJ0 A;  3H7L A;  2B4F A;  1F9D A;  2AFA A;  3X17 A;  1V7V A;  1FO3 A;  1GAH A;  2JJB A;  4Z4L A;  3E73 A;  3EZ8 A;  4WU0 A;  5CZL A;  2XFG A;  3GT5 A;  2GH4 A; 
#chains in the Genus database with same CATH topology
 4WVA A;  3H2W A;  1LTX B;  1HMU A;  4OZV A;  3ACT A;  3DRA B;  1TNB B;  3T33 A;  3W5N A;  4DOE A;  4MU9 A;  1G6I A;  1FT2 B;  4Z4J A;  2WCO A;  4L0G A;  1RWA A;  2V3N A;  3QRY A;  3D5S A;  3QT9 A;  3Q7F B;  4F10 A;  2EAB A;  2JG0 A;  1S64 B;  2SQC A;  4GTT B;  2NOJ A;  4LIX A;  3GZK A;  5M7I A;  1QSJ A;  1UMP A;  2WY7 A;  3HXC B;  3SDR A;  1JS4 A;  1DCE B;  1OJP A;  1JCQ B;  4OZW A;  1C3D A;  1H3A A;  1N4Q B;  3ANK A;  3M72 A;  3A0O A;  1IA6 A;  2BRV X;  1N7O A;  4EL8 A;  2H6F B;  4F13 A;  1GXN A;  2H6G B;  1X1J A;  4BOJ A;  3VSM A;  1SA4 B;  3RX7 A;  2WDA A;  3M7B A;  4V1S A;  2E22 A;  1HCU A;  3DPY B;  3WIW A;  4J5T A;  2RGK A;  4AYP A;  4BOK A;  3SDV A;  4V1R A;  4ONT A;  1MZC B;  2BRP A;  3H3K A;  1IA7 A;  3EU5 B;  1O5M B;  1H35 A;  3D3I A;  1X81 B;  3N0G A;  5GY3 A;  2FV0 A;  3PYB A;  4DI5 A;  4XUV A;  2DRS A;  4JJJ A;  5KKB A;  2P0V A;  2F6D A;  2CQS A;  2FV1 A;  4MMH A;  4D4B A;  1NI1 B;  4KTP A;  3W5M A;  3DSS B;  5IK9 A;  4QT9 A;  2AHG A;  3WIQ A;  2EAE A;  3QT3 A;  3EU8 A;  4RNQ A;  1H3C A;  5ILH A;  1UT9 A;  2WIN B;  3ACS A;  1H14 A;  3A3V A;  2DRO A;  3E6U A;  3S4D A;  3W7S A;  1FO2 A;  3E34 B;  3Q79 B;  5M7Y A;  1N4P B;  1GSZ A;  2V8K A;  1V7V A;  1GAH A;  2R2L B;  5EAU A;  5EAT A;  2XFG A;  2GH4 A;  1AYX A;  1LXK A;  2X03 A;  1N7R A;  3RX5 A;  1NL4 B;  2G02 A;  1O1S B;  2XQW A;  5IK6 A;  4D94 A;  2A8Z A;  4KKI A;  3S4C A;  1KSC A;  1X1I A;  3KLS A;  4GTO B;  4MMI A;  4L9P B;  1IS9 A;  3RX8 A;  2JF4 A;  2BBC A;  3WKF A;  1O6H A;  3SDQ A;  1FBW A;  1LD8 B;  3QXQ A;  3W7T A;  4D4D A;  3S4A A;  4CE7 A;  3M7L A;  1WZZ A;  2RI9 A;  1O79 A;  3NFV A;  1SA5 B;  3E7J A;  1KSD A;  3EUV B;  5JPM B;  3P5R A;  3SFX B;  4DOD A;  1HV6 A;  1DL2 A;  2H6H B;  1RWC A;  2PMV A;  3E33 B;  1GLM A;  3RRS A;  1LF9 A;  1TNO B;  1H37 A;  1N7P A;  4WVB A;  3G6J B;  3E30 B;  3REN A;  3K7X A;  1KZP B;  2ZIS B;  2WII B;  3NNB A;  4D4C A;  1K72 A;  2GOX A;  1G9J A;  3P2C A;  3QFY A;  3DST B;  2QNO A;  5E2J A;  5IM1 A;  3WKI A;  3GLY A;  1OJN A;  3EQA A;  1W6K A;  4EHM B;  3E80 A;  1H3B A;  3E32 B;  1JCR B;  1N1Z A;  1CLC A;  3PZ2 B;  1N1B A;  5DGQ A;  1UG9 A;  2GZ6 A;  4LNV A;  1FP3 A;  4L6X A;  3M7E A;  3VXD A;  2BRW A;  3QSP A;  4KTR A;  2EAD A;  1N7N A;  1KKT A;  3QXF A;  2ONH A;  2EAC A;  4ZG8 A;  4OJZ A;  3DSW B;  2J5C A;  3PYA A;  1KRF A;  1QQF A;  3RJ3 A;  2Q1F A;  5ILD A;  3K11 A;  1N9A B;  2VN4 A;  3H7L A;  1JCS B;  1FO3 A;  3KQ4 A;  3E73 A;  5CZL A;  5ILJ A;  2V8I A;  3GT5 A;  1F9G A;  1N4S B;  1RW9 A;  2H6I B;  3ANJ A;  1FPP B;  1H39 A;  2BB6 A;  3RSY A;  2V8J A;  1VD5 A;  3G4F A;  1GXM A;  5IKH A;  4FNV A;  3M74 A;  5FOB B;  1KZO B;  3M71 A;  1HXA A;  4GL3 A;  1DOG A;  1FAE A;  1D8D B;  2AHF A;  2FUZ A;  3Q75 B;  1H54 A;  2NVP A;  2OKX A;  1KWF A;  3S4B A;  1H36 A;  3WIR A;  4E1Y A;  3C72 B;  4D4A A;  2RI8 A;  2XWB B;  1GXO A;  1V5C A;  1WU4 A;  3WC3 A;  3DSX B;  4TF4 A;  3M7C A;  3OXU A;  1TNU B;  4LNG B;  1V7X A;  3P5P A;  3W7W A;  1G9G A;  1N24 A;  1HXG A;  1N94 B;  4OK2 A;  2WYN A;  3HXD B;  1N22 A;  3SDU A;  1GA2 A;  5ILK A;  1L2A A;  3W7U A;  1KS8 A;  3VSN A;  3PZ3 B;  2G0D A;  3W7X A;  2FBA A;  1H13 A;  1C82 A;  5DHK A;  4C1S A;  4CJ1 A;  3E37 B;  3QG0 A;  3AFL A;  4AYR A;  4GTV B;  2F0Y B;  1CEM A;  1HMW A;  1I8Q A;  4YCR A;  4Q2B A;  5ILZ A;  3CIH A;  1H12 A;  1N20 A;  4GTM B;  4GTR B;  3SDT A;  5DGR A;  1KRE A;  4WVC A;  3SAE A;  4NEI A;  4FJQ A;  5ILI A;  3KSQ B;  2BB5 A;  2ONG A;  2PN5 A;  1O6Q A;  2I07 B;  3WKG A;  1NC5 A;  5FO8 B;  1NXC A;  2V3P A;  1LD7 B;  3M76 A;  1RWG A;  1HZF A;  5FO9 B;  3SQC A;  4M76 A;  3HXE B;  2E24 A;  2ZIR B;  1XWQ A;  4FXG B;  5CD2 A;  4ZH1 A;  1TN8 B;  3D5R A;  1CB8 A;  3M78 A;  1FCE A;  3CU7 A;  3VW5 A;  1N95 B;  5IL3 A;  3SFY B;  3PZ1 B;  5MEH A;  1WU5 A;  4GTS B;  1O1R B;  2B4F A;  2XWJ B;  2AFA A;  1HX9 A;  3M77 A;  1J0M A;  1RWH A;  4Z4L A;  3EZ8 A;  4YDE B;  1SQC A;  1OJM A;  2A73 B;  3HXB B;  1KFG A;  1HM3 A;  2YIK A;  2Z07 A;  1O6R A;  1AGM A;  4GAX A;  5IK0 A;  4KKJ A;  3Q7A B;  5ILY A;  1ULV A;  3Q78 B;  1HM2 A;  1W6J A;  1O1T B;  3M02 A;  1XWT A;  3M73 A;  1HXC A;  3HXF B;  1GAI A;  2FUQ A;  1TNY B;  3PMM A;  3QWT A;  4LNB B;  3KSL B;  4AYQ A;  1TN7 B;  3ANI A;  1LXM A;  3LZ9 A;  1N7Q A;  3N0F A;  2CQT A;  4YDO B;  4FXK B;  2WY8 A;  1QBQ B;  2D5J A;  3QFZ A;  1W3Y A;  5CA3 A;  4GTQ B;  1HN0 A;  1X9D A;  5AGD A;  5FO7 B;  1V7W A;  1N21 A;  2BED B;  4AYO A;  5IKA A;  5GZK A;  3S9V A;  1X1H A;  5C05 A;  3WKH A;  2FUT A;  3PZ4 B;  1F1S A;  3QDE A;  1V5D A;  2B39 A;  1XW2 A;  1LF6 A;  4TXT A;  3G4D A;  4ZRQ A;  1S63 B;  5GW7 A;  2ZBL A;  1LOH A;  2D8L A;  3OED A;  3M01 A;  1RQ5 A;  5JPN B;  3DSU B;  1G87 A;  3Q73 B;  1D8E B;  4Q88 A;  1L1Y A;  1F9O A;  5JMD A;  3AFJ A;  4FUS A;  3M75 A;  1TNZ B;  3QPF A;  3ON6 A;  2ZZR A;  1GHQ A;  1TF4 A;  4OK4 A;  5IL8 A;  1N4R B;  5EAS A;  3TF4 A;  2DRQ A;  1OJO A;  1N23 A;  2IEJ B;  2DRR A;  1FMI A;  1WU6 A;  5JMF A;  2VN7 A;  4MBG B;  1FBO A;  3WUX A;  1TN6 B;  1FT1 B;  4ZH5 A;  4GTP B;  1EGU A;  4CJ0 A;  3M00 A;  1F9D A;  4ZRP A;  5DHI A;  1J0N A;  3X17 A;  1R76 A;  1QAZ A;  1RWF A;  2JJB A;  3DSV B;  4WU0 A; 
#chains in the Genus database with same CATH homology
 4WVA A;  3H2W A;  1LTX B;  3ACT A;  3DRA B;  1TNB B;  3T33 A;  3W5N A;  4DOE A;  4MU9 A;  1G6I A;  1FT2 B;  4Z4J A;  4L0G A;  2V3N A;  3QRY A;  3D5S A;  3QT9 A;  3Q7F B;  2EAB A;  2JG0 A;  1S64 B;  2SQC A;  4GTT B;  2NOJ A;  4LIX A;  3GZK A;  5M7I A;  1QSJ A;  1UMP A;  2WY7 A;  3HXC B;  3SDR A;  1JS4 A;  1DCE B;  1JCQ B;  1C3D A;  1H3A A;  1N4Q B;  3ANK A;  3M72 A;  1IA6 A;  4EL8 A;  2H6F B;  1GXN A;  2H6G B;  4BOJ A;  1SA4 B;  3RX7 A;  3M7B A;  4V1S A;  1HCU A;  3DPY B;  3WIW A;  4J5T A;  2RGK A;  4AYP A;  4BOK A;  3SDV A;  4V1R A;  4ONT A;  1MZC B;  3H3K A;  1IA7 A;  3EU5 B;  1O5M B;  1H35 A;  3D3I A;  1X81 B;  5GY3 A;  2FV0 A;  3PYB A;  4XUV A;  2DRS A;  4JJJ A;  5KKB A;  2P0V A;  2F6D A;  2CQS A;  2FV1 A;  4D4B A;  1NI1 B;  4KTP A;  3W5M A;  3DSS B;  4QT9 A;  2AHG A;  3WIQ A;  2EAE A;  3QT3 A;  3EU8 A;  1H3C A;  1UT9 A;  2WIN B;  3ACS A;  1H14 A;  3A3V A;  2DRO A;  3E6U A;  3S4D A;  3W7S A;  1FO2 A;  3E34 B;  3Q79 B;  5M7Y A;  1N4P B;  1GSZ A;  2V8K A;  1V7V A;  1GAH A;  2R2L B;  2XFG A;  2GH4 A;  1AYX A;  3RX5 A;  1NL4 B;  2G02 A;  1O1S B;  2XQW A;  4D94 A;  2A8Z A;  4KKI A;  3S4C A;  1KSC A;  3KLS A;  4GTO B;  4L9P B;  1IS9 A;  3RX8 A;  2JF4 A;  2BBC A;  3WKF A;  1O6H A;  3SDQ A;  1FBW A;  1LD8 B;  3QXQ A;  3W7T A;  4D4D A;  3S4A A;  4CE7 A;  3M7L A;  1WZZ A;  2RI9 A;  1O79 A;  1SA5 B;  1KSD A;  3EUV B;  5JPM B;  3P5R A;  3SFX B;  4DOD A;  1DL2 A;  2H6H B;  2PMV A;  3E33 B;  1GLM A;  3RRS A;  1LF9 A;  1TNO B;  1H37 A;  4WVB A;  3G6J B;  3E30 B;  3REN A;  3K7X A;  1KZP B;  2ZIS B;  2WII B;  4D4C A;  1K72 A;  2GOX A;  1G9J A;  3P2C A;  3QFY A;  3DST B;  2QNO A;  5E2J A;  3WKI A;  3GLY A;  3EQA A;  1W6K A;  4EHM B;  1H3B A;  3E32 B;  1JCR B;  1CLC A;  3PZ2 B;  5DGQ A;  1UG9 A;  2GZ6 A;  4LNV A;  1FP3 A;  4L6X A;  3M7E A;  3VXD A;  3QSP A;  4KTR A;  2EAD A;  3QXF A;  1KKT A;  2EAC A;  4ZG8 A;  3DSW B;  3PYA A;  1KRF A;  1QQF A;  3RJ3 A;  3K11 A;  1N9A B;  2VN4 A;  3H7L A;  1JCS B;  1FO3 A;  3KQ4 A;  3E73 A;  5CZL A;  3GT5 A;  2V8I A;  1N4S B;  2H6I B;  3ANJ A;  1FPP B;  1H39 A;  2BB6 A;  3RSY A;  2V8J A;  1VD5 A;  1GXM A;  5FOB B;  3M74 A;  1KZO B;  3M71 A;  4GL3 A;  1DOG A;  1FAE A;  1D8D B;  2AHF A;  2FUZ A;  3Q75 B;  1H54 A;  2NVP A;  2OKX A;  1KWF A;  3S4B A;  1H36 A;  3WIR A;  3C72 B;  4D4A A;  2RI8 A;  2XWB B;  1GXO A;  1V5C A;  1WU4 A;  3WC3 A;  3DSX B;  4TF4 A;  3M7C A;  3OXU A;  1TNU B;  4LNG B;  1V7X A;  3P5P A;  3W7W A;  1G9G A;  1N94 B;  2WYN A;  3HXD B;  3SDU A;  1GA2 A;  3W7U A;  1L2A A;  1KS8 A;  3PZ3 B;  2G0D A;  3W7X A;  2FBA A;  1H13 A;  4C1S A;  4CJ1 A;  3E37 B;  3QG0 A;  4AYR A;  4GTV B;  2F0Y B;  1CEM A;  4YCR A;  4Q2B A;  3CIH A;  1H12 A;  4GTM B;  4GTR B;  3SDT A;  5DGR A;  1KRE A;  4WVC A;  3SAE A;  3KSQ B;  2BB5 A;  2PN5 A;  1O6Q A;  2I07 B;  3WKG A;  1NC5 A;  5FO8 B;  1NXC A;  2V3P A;  1LD7 B;  3M76 A;  5FO9 B;  1HZF A;  3SQC A;  4M76 A;  3HXE B;  2ZIR B;  1XWQ A;  4FXG B;  5CD2 A;  4ZH1 A;  1TN8 B;  3D5R A;  3M78 A;  1FCE A;  3CU7 A;  3VW5 A;  1N95 B;  3SFY B;  3PZ1 B;  5MEH A;  1WU5 A;  4GTS B;  1O1R B;  2B4F A;  2XWJ B;  2AFA A;  3M77 A;  4Z4L A;  3EZ8 A;  4YDE B;  1SQC A;  2A73 B;  3HXB B;  1KFG A;  2YIK A;  2Z07 A;  1O6R A;  1AGM A;  4KKJ A;  3Q7A B;  1ULV A;  3Q78 B;  1W6J A;  1O1T B;  1XWT A;  3M73 A;  3HXF B;  1GAI A;  3QWT A;  1TNY B;  3PMM A;  4LNB B;  3KSL B;  4AYQ A;  1TN7 B;  3ANI A;  2CQT A;  4YDO B;  4FXK B;  2WY8 A;  3QFZ A;  1QBQ B;  2D5J A;  5CA3 A;  4GTQ B;  1X9D A;  5AGD A;  5FO7 B;  1V7W A;  2BED B;  4AYO A;  5GZK A;  3S9V A;  3WKH A;  3PZ4 B;  3QDE A;  1V5D A;  2B39 A;  1XW2 A;  1LF6 A;  4TXT A;  4ZRQ A;  1S63 B;  5GW7 A;  2ZBL A;  2D8L A;  3OED A;  1RQ5 A;  5JPN B;  3DSU B;  1G87 A;  3Q73 B;  1D8E B;  4Q88 A;  1L1Y A;  1F9O A;  3AFJ A;  4FUS A;  3M75 A;  1TNZ B;  3QPF A;  3ON6 A;  2ZZR A;  1GHQ A;  1TF4 A;  1N4R B;  3TF4 A;  2DRQ A;  2IEJ B;  2DRR A;  1FMI A;  1WU6 A;  2VN7 A;  4MBG B;  1FBO A;  3WUX A;  1TN6 B;  1FT1 B;  4ZH5 A;  4GTP B;  4CJ0 A;  4ZRP A;  1F9D A;  3X17 A;  1R76 A;  2JJB A;  3DSV B;  4WU0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...