2AHFA

Unsaturated glucuronyl hydrolase mutant d88n
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
377
structure length
377
Chain Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHNIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords unsaturated glucuronyl hydrolase
publication title Crystal Structure of Unsaturated Glucuronyl Hydrolase Complexed with Substrate: MOLECULAR INSIGHTS INTO ITS CATALYTIC REACTION MECHANISM
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 164
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2ahfA00
3AFJA 2ZBLA 4JJJA 1L1YA 2EADA 2FV0A 1UG9A 4KTRA 3WKIA 1RQ5A 1HCUA 4DOEA 4WVAA 3H7LA 2D8LA 3RX7A 3W5NA 3W7UA 1XWTA 4FUSA 2GZ6A 1X9DA 3QXFA 4Q2BA 1TF4A 2GH4A 3QT9A 3GT5A 1GA2A 1XW2A 2VN7A 4TXTA 3W7TA 1V7VA 4AYRA 1FCEA 1CLCA 1KWFA 2FV1A 3D3IA 3QDEA 5DGQA 3S4AA 1AGMA 5GY3A 2NVPA 3RX5A 4KTPA 3ANKA 3P2CA 1F9OA 3X17A 5CA3A 2JG0A 1LF9A 3QWTA 3S4CA 3EZ8A 3RRSA 1KSCA 5DGRA 4AYPA 5KKBA 1JS4A 3TF4A 1K72A 3H2WA 3QFZA 3RX8A 2DROA 1FBOA 2JF4A 2WYNA 1KRFA 2CQSA 2EACA 1WU5A 2FUZA 2A8ZA 3W7WA 1KKTA 1G9GA 2AFAA 3EQAA 3ACTA 2CQTA 3WIRA 1FO3A 1V5DA 1DL2A 3K11A 1H54A 2AHFA 3WKFA 3S4BA 5MEHA 5E2JA 2EABA 4WU0A 1IA6A 3WIQA 1WU6A 3CIHA 3ANIA 2VN4A 4DODA 1FAEA 3WIWA 1GAIA 1V7WA 2Z07A 4ZG8A 5CD2A 3W7SA 4XUVA 1L2AA 2RI9A 3PMMA 1UT9A 1FP3A 1NXCA 3WKHA 1KREA 3ON6A 4TF4A 2YIKA 1DOGA 3S4DA 1GAHA 2EAEA 1H14A 4AYOA 1KFGA 2RGKA 3W5MA 3RENA 2F6DA 2DRQA 3T33A 3QXQA 1VD5A 1IS9A 1WU4A 2QNOA 1KSDA 1FBWA 2FBAA 4EL8A 3A3VA 2P0VA 3E6UA 1H12A 3WKGA 1CEMA 1FO2A 3VW5A 1V5CA 1NC5A 4WVCA 4Z4JA 4L6XA 3ANJA 3GLYA 1FMIA 3QRYA 1AYXA 2B4FA 3QG0A 2D5JA 2OKXA 4ZH5A 3W7XA 1F9DA 2DRRA 3WC3A 1XWQA 1ULVA 4Z4LA 4AYQA 3QSPA 4CJ0A 1G6IA 1KS8A 1LF6A 1IA7A 1V7XA 3QFYA 3QT3A 1WZZA 3QPFA 3GZKA 4J5TA 3ACSA 3VXDA 3WUXA 1H13A 5CZLA 3RSYA 2JJBA 1GLMA 2DRSA 2ZZRA 3E73A 3H3KA 4CJ1A 5M7YA 2RI8A 4Q88A 4CE7A 1G87A 2AHGA 4WVBA 5M7IA 2XFGA 4L0GA 1G9JA 5GW7A
chains in the Genus database with same CATH superfamily
3AFJA 2H6GB 3EUVB 1EGUA 2I07B 1UG9A 3DSWB 1N20A 1RWFA 1N7QA 1HCUA 4DOEA 3H7LA 3RX7A 4D4DA 3W5NA 3M00A 1O6QA 2GZ6A 4E1YA 4Q2BA 1TF4A 3GT5A 1XW2A 1V7VA 3Q7AB 1SA4B 5IM1A 1CLCA 3DSSB 3E37B 2FV1A 3D3IA 2NVPA 2G02A 3RX5A 5ILHA 1N22A 3G4DA 4LNGB 1CB8A 4FXKB 4OK2A 1LF9A 3S4CA 4EHMB 4MMIA 5KKBA 3OEDA 1JS4A 3TF4A 3H2WA 3K7XA 3DSTB 2DROA 1FBOA 4GTTB 2ZISB 4LNVA 1N7RA 2BB6A 2EACA 2AFAA 2WIIB 3ACTA 5ILKA 2E24A 1GHQA 5MEHA 3DSVB 3M74A 2H6FB 1WU6A 3CIHA 3ANIA 5ILDA 4ZRQA 4XUVA 2RI9A 3OXUA 3PMMA 1NXCA 1TNOB 1H3BA 1KREA 1S63B 1TN7B 3G6JB 1H14A 1OJMA 4AYOA 3PYAA 4M76A 3M7BA 2QNOA 1IS9A 1HMWA 3A3VA 2P0VA 5C05A 5GZKA 1V5CA 3G4FA 3E34B 3ANJA 4NEIA 2WY7A 2E22A 4ZRPA 4OZVA 2PMVA 1F9GA 1HMUA 3W7XA 4MU9A 1XWQA 3M75A 4AYQA 1V7XA 3QPFA 3EU5B 3VSMA 4GTOB 1NL4B 1H13A 5CZLA 1GLMA 1O5MB 2ZZRA 3SDUA 4OZWA 3E73A 1MZCB 5M7IA 4GTQB 4C1SA 1G9JA 1DCEB 4D94A 1O1RB 3E33B 2EADA 2ZIRB 5ILZA 4KTRA 1RQ5A 4FNVA 4FJQA 1OJPA 2D8LA 5DHIA 1XWTA 1X9DA 4GTPB 3Q78B 1O1SB 1GA2A 5FO7B 2BRWA 2FUQA 1HXGA 3HXDB 2V8KA 5DGQA 1AGMA 4D4CA 5AGDA 3ANKA 1C82A 1N1BA 3X17A 5EASA 1JCQB 2XWBB 1K72A 3QFZA 3M77A 4GTVB 2JF4A 2WYNA 3Q73B 2FUZA 3AFLA 2A8ZA 2X03A 3EQAA 3M73A 3WIRA 1V5DA 1TN8B 1FT1B 2AHFA 1N95B 1TNZB 2GOXA 1FT2B 3S4BA 3M78A 2SQCA 5E2JA 2EABA 4WU0A 1TNUB 1RWGA 3WIQA 1J0MA 1KZPB 1RWHA 1GAIA 5CD2A 1L2AA 2FUTA 1TNBB 1FP3A 2YIKA 2XQWA 4YCRA 1I8QA 1LXMA 3P5RA 2V8JA 1LD8B 3W5MA 3RENA 3DRAB 2DRQA 3T33A 3QXQA 5FO9B 1WU4A 2BRVX 1O6RA 1KSDA 3EU8A 5JPNB 1FO2A 4YDEB 2H6HB 4KKJA 1LXKA 1R76A 4WVCA 5FOBB 3M01A 1AYXA 2OKXA 2D5JA 3PZ4B 1GXNA 2DRRA 1N4QB 1TN6B 3WC3A 3KSQB 1J0NA 3NFVA 3QSPA 2NOJA 2WCOA 3P5PA 5ILYA 3PYBA 1QAZA 3M76A 1H3AA 3WUXA 2DRSA 5FO8B 1NI1B 3HXFB 1HX9A 3H3KA 4CJ1A 4Q88A 1HM2A 1G87A 4QT9A 4CE7A 2XFGA 4L9PB 2Q1FA 1N4RB 3SQCA 4DI5A 4JJJA 1L1YA 4OJZA 2FV0A 1N7NA 5DHKA 3PZ1B 4RNQA 3W7UA 1FPPB 1H37A 3D5RA 1LD7B 1N1ZA 3N0FA 1X1HA 3QT9A 2VN7A 3E7JA 1OJNA 1KWFA 1H35A 1QSJA 1UMPA 1N94B 3SDTA 3KSLB 5GY3A 1LOHA 1N4PB 3P2CA 4KTPA 3S9VA 2BBCA 5IKHA 5IL3A 5CA3A 3C72B 3DPYB 3RRSA 5DGRA 3SDQA 4AYPA 2R2LB 3M7LA 5JMFA 3M02A 1KRFA 1S64B 2G0DA 4BOKA 1HXCA 4GTMB 1SQCA 4OK4A 1H39A 2F0YB 3HXCB 3RJ3A 1H54A 3E32B 1N23A 2WY8A 1W6KA 2BEDB 5EATA 5IK6A 3Q79B 1IA6A 3HXBB 3SFXB 3M7CA 2VN4A 2WDAA 4DODA 2IEJB 1FAEA 3KQ4A 1LTXB 3SDVA 2Z07A 3SDRA 3DSXB 3PZ3B 1UT9A 1RW9A 4TF4A 4YDOB 2H6IB 5IK0A 5IKAA 3S4DA 1GAHA 2EAEA 4MMHA 1KFGA 1QQFA 2BRPA 2V8IA 3M7EA 3E6UA 1H12A 3VW5A 4Z4JA 4ZH1A 3QRYA 1F9DA 3E30B 4D4BA 1N4SB 1X1IA 1KS8A 1H36A 1IA7A 1JCRB 3SFYB 1N7PA 1H3CA 4KKIA 1O6HA 1C3DA 2J5CA 3ACSA 3RSYA 2JJBA 2V3NA 1RWAA 4GAXA 5IL8A 5M7YA 2RI8A 1HV6A 2AHGA 4L0GA 5GW7A 2ZBLA 5JMDA 3WKIA 4D4AA 2A73B 3M72A 3A0OA 4WVAA 1X1JA 4FUSA 5ILJA 5JPMB 3QXFA 2ONGA 5EAUA 2GH4A 4TXTA 1D8EB 3W7TA 4V1SA 1D8DB 4AYRA 1FCEA 4FXGB 1RWCA 3D5SA 3QDEA 3S4AA 1N9AB 3LZ9A 1F9OA 1N21A 2JG0A 1GSZA 3QWTA 3EZ8A 2BB5A 1GXOA 1KSCA 1F1SA 1GXMA 5IK9A 3RX8A 2CQSA 1WU5A 1HM3A 3W7WA 1KKTA 4LIXA 1QBQB 1G9GA 3N0GA 2CQTA 3SAEA 1FO3A 1DL2A 3K11A 3WKFA 1W6JA 1HZFA 1O79A 3VSNA 1N24A 1N7OA 3WIWA 1V7WA 4ZG8A 3W7SA 1X81B 1O1TB 3WKHA 1HN0A 3ON6A 1W3YA 3DSUB 1DOGA 4MBGB 3M71A 1JCSB 2RGKA 1HXAA 2F6DA 1TNYB 3HXEB 1VD5A 3CU7A 4EL8A 1FBWA 2FBAA 3WKGA 1CEMA 1KZOB 2WINB 1NC5A 3E80A 4L6XA 3GLYA 1FMIA 5ILIA 2B4FA 3Q75B 3QG0A 4F10A 4ZH5A 4GTSB 3Q7FB 1ULVA 4BOJA 4Z4LA 4CJ0A 1G6IA 4F13A 3KLSA 1LF6A 3QFYA 3QT3A 4ONTA 1WZZA 2XWJB 4GTRB 2V3PA 3GZKA 4J5TA 2PN5A 3VXDA 4LNBB 2ONHA 4V1RA 3PZ2B 4GL3A 4WVBA 2B39A 3NNBA 1OJOA 1SA5B
chains in the Genus database with same CATH topology
3AFJA 2H6GB 3EUVB 2I07B 3DSWB 1UG9A 1HCUA 4DOEA 3H7LA 3RX7A 4D4DA 3W5NA 1O6QA 2GZ6A 4Q2BA 1TF4A 3GT5A 1XW2A 1V7VA 3Q7AB 1SA4B 1CLCA 3DSSB 3E37B 2FV1A 3D3IA 2NVPA 2G02A 3RX5A 4LNGB 4FXKB 1LF9A 3S4CA 4EHMB 5KKBA 3OEDA 1JS4A 3TF4A 3H2WA 3K7XA 3DSTB 2DROA 1FBOA 4GTTB 2ZISB 4LNVA 2BB6A 2EACA 2AFAA 2WIIB 3ACTA 1GHQA 5MEHA 3DSVB 3M74A 2H6FB 1WU6A 3CIHA 3ANIA 4ZRQA 4XUVA 2RI9A 3OXUA 3PMMA 1NXCA 1TNOB 1H3BA 1KREA 1S63B 1TN7B 3G6JB 1H14A 4AYOA 3PYAA 4M76A 3M7BA 2QNOA 1IS9A 3A3VA 2P0VA 5GZKA 1V5CA 3E34B 3ANJA 2WY7A 4ZRPA 2PMVA 3W7XA 4MU9A 1XWQA 3M75A 4AYQA 1V7XA 3QPFA 3EU5B 4GTOB 1NL4B 1H13A 5CZLA 1GLMA 1O5MB 2ZZRA 3SDUA 3E73A 1MZCB 5M7IA 4GTQB 4C1SA 1G9JA 1DCEB 4D94A 1O1RB 3E33B 2EADA 2ZIRB 4KTRA 1RQ5A 2D8LA 1XWTA 1X9DA 4GTPB 3Q78B 1O1SB 1GA2A 5FO7B 3HXDB 2V8KA 5DGQA 1AGMA 4D4CA 5AGDA 3ANKA 3X17A 1JCQB 2XWBB 1K72A 3QFZA 3M77A 4GTVB 2JF4A 2WYNA 3Q73B 2FUZA 2A8ZA 3EQAA 3M73A 3WIRA 1V5DA 1TN8B 1FT1B 2AHFA 1N95B 1TNZB 2GOXA 1FT2B 3S4BA 3M78A 2SQCA 5E2JA 2EABA 4WU0A 1TNUB 3WIQA 1KZPB 1GAIA 5CD2A 1L2AA 1TNBB 1FP3A 2YIKA 2XQWA 4YCRA 3P5RA 2V8JA 1LD8B 3W5MA 3RENA 3DRAB 2DRQA 3T33A 3QXQA 5FO9B 1WU4A 1O6RA 1KSDA 3EU8A 5JPNB 1FO2A 4YDEB 2H6HB 4KKJA 4WVCA 1R76A 5FOBB 1AYXA 2OKXA 2D5JA 3PZ4B 1GXNA 2DRRA 1N4QB 1TN6B 3WC3A 3KSQB 3QSPA 2NOJA 3P5PA 3PYBA 3M76A 1H3AA 3WUXA 2DRSA 5FO8B 1NI1B 3HXFB 3H3KA 4CJ1A 4Q88A 4CE7A 1G87A 4QT9A 2XFGA 4L9PB 1N4RB 3SQCA 4JJJA 1L1YA 2FV0A 3PZ1B 3W7UA 1FPPB 1H37A 3D5RA 1LD7B 3QT9A 2VN7A 1KWFA 1H35A 1QSJA 1UMPA 1N94B 3SDTA 3KSLB 5GY3A 1N4PB 3P2CA 4KTPA 3S9VA 2BBCA 5CA3A 3C72B 3DPYB 3RRSA 5DGRA 3SDQA 4AYPA 2R2LB 3M7LA 1KRFA 1S64B 2G0DA 4BOKA 4GTMB 1SQCA 1H39A 2F0YB 3HXCB 3RJ3A 1H54A 3E32B 2WY8A 1W6KA 2BEDB 3SFXB 3Q79B 1IA6A 3HXBB 3M7CA 2VN4A 4DODA 2IEJB 1FAEA 3KQ4A 1LTXB 3SDVA 2Z07A 3SDRA 3DSXB 3PZ3B 1UT9A 4TF4A 4YDOB 2H6IB 3S4DA 1GAHA 2EAEA 1KFGA 1QQFA 2V8IA 3M7EA 3E6UA 1H12A 3VW5A 4Z4JA 4ZH1A 3QRYA 1F9DA 3E30B 4D4BA 1N4SB 1KS8A 1H36A 1IA7A 1JCRB 3SFYB 1H3CA 4KKIA 1O6HA 1C3DA 3ACSA 3RSYA 2JJBA 2V3NA 5M7YA 2RI8A 2AHGA 4L0GA 5GW7A 2ZBLA 3WKIA 4D4AA 2A73B 3M72A 4WVAA 4FUSA 5JPMB 3QXFA 2GH4A 4TXTA 1D8EB 3W7TA 4V1SA 1D8DB 4AYRA 1FCEA 4FXGB 3D5SA 3QDEA 3S4AA 1N9AB 1F9OA 2JG0A 1GSZA 3QWTA 3EZ8A 2BB5A 1GXOA 1KSCA 1GXMA 3RX8A 2CQSA 1WU5A 3W7WA 1KKTA 4LIXA 1QBQB 1G9GA 2CQTA 3SAEA 1FO3A 1DL2A 3K11A 3WKFA 1W6JA 1HZFA 1O79A 3WIWA 1V7WA 4ZG8A 3W7SA 1X81B 1O1TB 3WKHA 3ON6A 3DSUB 1DOGA 4MBGB 3M71A 1JCSB 2RGKA 2F6DA 1TNYB 3HXEB 1VD5A 3CU7A 4EL8A 1FBWA 2FBAA 3WKGA 1CEMA 1KZOB 2WINB 1NC5A 4L6XA 3GLYA 1FMIA 2B4FA 3Q75B 3QG0A 4ZH5A 4GTSB 3Q7FB 1ULVA 4BOJA 4Z4LA 4CJ0A 1G6IA 1LF6A 3KLSA 3QFYA 3QT3A 4ONTA 1WZZA 2XWJB 4GTRB 2V3PA 3GZKA 4J5TA 2PN5A 3VXDA 4LNBB 4V1RA 3PZ2B 4GL3A 4WVBA 2B39A 1SA5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFJ A;  2ZBL A;  4JJJ A;  1L1Y A;  2EAD A;  2FV0 A;  1UG9 A;  4KTR A;  3WKI A;  1RQ5 A;  1HCU A;  4DOE A;  4WVA A;  3H7L A;  2D8L A;  3RX7 A;  3W5N A;  3W7U A;  1XWT A;  4FUS A;  2GZ6 A;  1X9D A;  3QXF A;  4Q2B A;  1TF4 A;  2GH4 A;  3QT9 A;  3GT5 A;  1GA2 A;  1XW2 A;  2VN7 A;  4TXT A;  3W7T A;  1V7V A;  4AYR A;  1FCE A;  1CLC A;  1KWF A;  2FV1 A;  3D3I A;  3QDE A;  5DGQ A;  3S4A A;  1AGM A;  5GY3 A;  2NVP A;  3RX5 A;  4KTP A;  3ANK A;  3P2C A;  1F9O A;  3X17 A;  5CA3 A;  2JG0 A;  1LF9 A;  3QWT A;  3S4C A;  3EZ8 A;  3RRS A;  1KSC A;  5DGR A;  4AYP A;  5KKB A;  1JS4 A;  3TF4 A;  1K72 A;  3H2W A;  3QFZ A;  3RX8 A;  2DRO A;  1FBO A;  2JF4 A;  2WYN A;  1KRF A;  2CQS A;  2EAC A;  1WU5 A;  2FUZ A;  2A8Z A;  3W7W A;  1KKT A;  1G9G A;  2AFA A;  3EQA A;  3ACT A;  2CQT A;  3WIR A;  1FO3 A;  1V5D A;  1DL2 A;  3K11 A;  1H54 A;  2AHF A;  3WKF A;  3S4B A;  5MEH A;  5E2J A;  2EAB A;  4WU0 A;  1IA6 A;  3WIQ A;  1WU6 A;  3CIH A;  3ANI A;  2VN4 A;  4DOD A;  1FAE A;  3WIW A;  1GAI A;  1V7W A;  2Z07 A;  4ZG8 A;  5CD2 A;  3W7S A;  4XUV A;  1L2A A;  2RI9 A;  3PMM A;  1UT9 A;  1FP3 A;  1NXC A;  3WKH A;  1KRE A;  3ON6 A;  4TF4 A;  2YIK A;  1DOG A;  3S4D A;  1GAH A;  2EAE A;  1H14 A;  4AYO A;  1KFG A;  2RGK A;  3W5M A;  3REN A;  2F6D A;  2DRQ A;  3T33 A;  3QXQ A;  1VD5 A;  1IS9 A;  1WU4 A;  2QNO A;  1KSD A;  1FBW A;  2FBA A;  4EL8 A;  3A3V A;  2P0V A;  3E6U A;  1H12 A;  3WKG A;  1CEM A;  1FO2 A;  3VW5 A;  1V5C A;  1NC5 A;  4WVC A;  4Z4J A;  4L6X A;  3ANJ A;  3GLY A;  1FMI A;  3QRY A;  1AYX A;  2B4F A;  3QG0 A;  2D5J A;  2OKX A;  4ZH5 A;  3W7X A;  1F9D A;  2DRR A;  3WC3 A;  1XWQ A;  1ULV A;  4Z4L A;  4AYQ A;  3QSP A;  4CJ0 A;  1G6I A;  1KS8 A;  1LF6 A;  1IA7 A;  1V7X A;  3QFY A;  3QT3 A;  1WZZ A;  3QPF A;  3GZK A;  4J5T A;  3ACS A;  3VXD A;  3WUX A;  1H13 A;  5CZL A;  3RSY A;  2JJB A;  1GLM A;  2DRS A;  2ZZR A;  3E73 A;  3H3K A;  4CJ1 A;  5M7Y A;  2RI8 A;  4Q88 A;  4CE7 A;  1G87 A;  2AHG A;  4WVB A;  5M7I A;  2XFG A;  4L0G A;  1G9J A;  5GW7 A; 
#chains in the Genus database with same CATH topology
 3AFJ A;  2H6G B;  3EUV B;  1EGU A;  2I07 B;  1UG9 A;  3DSW B;  1N20 A;  1RWF A;  1N7Q A;  1HCU A;  4DOE A;  3H7L A;  3RX7 A;  4D4D A;  3W5N A;  3M00 A;  1O6Q A;  2GZ6 A;  4E1Y A;  4Q2B A;  1TF4 A;  3GT5 A;  1XW2 A;  1V7V A;  3Q7A B;  1SA4 B;  5IM1 A;  1CLC A;  3DSS B;  3E37 B;  2FV1 A;  3D3I A;  2NVP A;  2G02 A;  3RX5 A;  5ILH A;  1N22 A;  3G4D A;  4LNG B;  1CB8 A;  4FXK B;  4OK2 A;  1LF9 A;  3S4C A;  4EHM B;  4MMI A;  5KKB A;  3OED A;  1JS4 A;  3TF4 A;  3H2W A;  3K7X A;  3DST B;  2DRO A;  1FBO A;  4GTT B;  2ZIS B;  4LNV A;  1N7R A;  2BB6 A;  2EAC A;  2AFA A;  2WII B;  3ACT A;  5ILK A;  2E24 A;  1GHQ A;  5MEH A;  3DSV B;  3M74 A;  2H6F B;  1WU6 A;  3CIH A;  3ANI A;  5ILD A;  4ZRQ A;  4XUV A;  2RI9 A;  3OXU A;  3PMM A;  1NXC A;  1TNO B;  1H3B A;  1KRE A;  1S63 B;  1TN7 B;  3G6J B;  1H14 A;  1OJM A;  4AYO A;  3PYA A;  4M76 A;  3M7B A;  2QNO A;  1IS9 A;  1HMW A;  3A3V A;  2P0V A;  5C05 A;  5GZK A;  1V5C A;  3G4F A;  3E34 B;  3ANJ A;  4NEI A;  2WY7 A;  2E22 A;  4ZRP A;  4OZV A;  2PMV A;  1F9G A;  1HMU A;  3W7X A;  4MU9 A;  1XWQ A;  3M75 A;  4AYQ A;  1V7X A;  3QPF A;  3EU5 B;  3VSM A;  4GTO B;  1NL4 B;  1H13 A;  5CZL A;  1GLM A;  1O5M B;  2ZZR A;  3SDU A;  4OZW A;  3E73 A;  1MZC B;  5M7I A;  4GTQ B;  4C1S A;  1G9J A;  1DCE B;  4D94 A;  1O1R B;  3E33 B;  2EAD A;  2ZIR B;  5ILZ A;  4KTR A;  1RQ5 A;  4FNV A;  4FJQ A;  1OJP A;  2D8L A;  5DHI A;  1XWT A;  1X9D A;  4GTP B;  3Q78 B;  1O1S B;  1GA2 A;  5FO7 B;  2BRW A;  2FUQ A;  1HXG A;  3HXD B;  2V8K A;  5DGQ A;  1AGM A;  4D4C A;  5AGD A;  3ANK A;  1C82 A;  1N1B A;  3X17 A;  5EAS A;  1JCQ B;  2XWB B;  1K72 A;  3QFZ A;  3M77 A;  4GTV B;  2JF4 A;  2WYN A;  3Q73 B;  2FUZ A;  3AFL A;  2A8Z A;  2X03 A;  3EQA A;  3M73 A;  3WIR A;  1V5D A;  1TN8 B;  1FT1 B;  2AHF A;  1N95 B;  1TNZ B;  2GOX A;  1FT2 B;  3S4B A;  3M78 A;  2SQC A;  5E2J A;  2EAB A;  4WU0 A;  1TNU B;  1RWG A;  3WIQ A;  1J0M A;  1KZP B;  1RWH A;  1GAI A;  5CD2 A;  1L2A A;  2FUT A;  1TNB B;  1FP3 A;  2YIK A;  2XQW A;  4YCR A;  1I8Q A;  1LXM A;  3P5R A;  2V8J A;  1LD8 B;  3W5M A;  3REN A;  3DRA B;  2DRQ A;  3T33 A;  3QXQ A;  5FO9 B;  1WU4 A;  2BRV X;  1O6R A;  1KSD A;  3EU8 A;  5JPN B;  1FO2 A;  4YDE B;  2H6H B;  4KKJ A;  1LXK A;  1R76 A;  4WVC A;  5FOB B;  3M01 A;  1AYX A;  2OKX A;  2D5J A;  3PZ4 B;  1GXN A;  2DRR A;  1N4Q B;  1TN6 B;  3WC3 A;  3KSQ B;  1J0N A;  3NFV A;  3QSP A;  2NOJ A;  2WCO A;  3P5P A;  5ILY A;  3PYB A;  1QAZ A;  3M76 A;  1H3A A;  3WUX A;  2DRS A;  5FO8 B;  1NI1 B;  3HXF B;  1HX9 A;  3H3K A;  4CJ1 A;  4Q88 A;  1HM2 A;  1G87 A;  4QT9 A;  4CE7 A;  2XFG A;  4L9P B;  2Q1F A;  1N4R B;  3SQC A;  4DI5 A;  4JJJ A;  1L1Y A;  4OJZ A;  2FV0 A;  1N7N A;  5DHK A;  3PZ1 B;  4RNQ A;  3W7U A;  1FPP B;  1H37 A;  3D5R A;  1LD7 B;  1N1Z A;  3N0F A;  1X1H A;  3QT9 A;  2VN7 A;  3E7J A;  1OJN A;  1KWF A;  1H35 A;  1QSJ A;  1UMP A;  1N94 B;  3SDT A;  3KSL B;  5GY3 A;  1LOH A;  1N4P B;  3P2C A;  4KTP A;  3S9V A;  2BBC A;  5IKH A;  5IL3 A;  5CA3 A;  3C72 B;  3DPY B;  3RRS A;  5DGR A;  3SDQ A;  4AYP A;  2R2L B;  3M7L A;  5JMF A;  3M02 A;  1KRF A;  1S64 B;  2G0D A;  4BOK A;  1HXC A;  4GTM B;  1SQC A;  4OK4 A;  1H39 A;  2F0Y B;  3HXC B;  3RJ3 A;  1H54 A;  3E32 B;  1N23 A;  2WY8 A;  1W6K A;  2BED B;  5EAT A;  5IK6 A;  3Q79 B;  1IA6 A;  3HXB B;  3SFX B;  3M7C A;  2VN4 A;  2WDA A;  4DOD A;  2IEJ B;  1FAE A;  3KQ4 A;  1LTX B;  3SDV A;  2Z07 A;  3SDR A;  3DSX B;  3PZ3 B;  1UT9 A;  1RW9 A;  4TF4 A;  4YDO B;  2H6I B;  5IK0 A;  5IKA A;  3S4D A;  1GAH A;  2EAE A;  4MMH A;  1KFG A;  1QQF A;  2BRP A;  2V8I A;  3M7E A;  3E6U A;  1H12 A;  3VW5 A;  4Z4J A;  4ZH1 A;  3QRY A;  1F9D A;  3E30 B;  4D4B A;  1N4S B;  1X1I A;  1KS8 A;  1H36 A;  1IA7 A;  1JCR B;  3SFY B;  1N7P A;  1H3C A;  4KKI A;  1O6H A;  1C3D A;  2J5C A;  3ACS A;  3RSY A;  2JJB A;  2V3N A;  1RWA A;  4GAX A;  5IL8 A;  5M7Y A;  2RI8 A;  1HV6 A;  2AHG A;  4L0G A;  5GW7 A;  2ZBL A;  5JMD A;  3WKI A;  4D4A A;  2A73 B;  3M72 A;  3A0O A;  4WVA A;  1X1J A;  4FUS A;  5ILJ A;  5JPM B;  3QXF A;  2ONG A;  5EAU A;  2GH4 A;  4TXT A;  1D8E B;  3W7T A;  4V1S A;  1D8D B;  4AYR A;  1FCE A;  4FXG B;  1RWC A;  3D5S A;  3QDE A;  3S4A A;  1N9A B;  3LZ9 A;  1F9O A;  1N21 A;  2JG0 A;  1GSZ A;  3QWT A;  3EZ8 A;  2BB5 A;  1GXO A;  1KSC A;  1F1S A;  1GXM A;  5IK9 A;  3RX8 A;  2CQS A;  1WU5 A;  1HM3 A;  3W7W A;  1KKT A;  4LIX A;  1QBQ B;  1G9G A;  3N0G A;  2CQT A;  3SAE A;  1FO3 A;  1DL2 A;  3K11 A;  3WKF A;  1W6J A;  1HZF A;  1O79 A;  3VSN A;  1N24 A;  1N7O A;  3WIW A;  1V7W A;  4ZG8 A;  3W7S A;  1X81 B;  1O1T B;  3WKH A;  1HN0 A;  3ON6 A;  1W3Y A;  3DSU B;  1DOG A;  4MBG B;  3M71 A;  1JCS B;  2RGK A;  1HXA A;  2F6D A;  1TNY B;  3HXE B;  1VD5 A;  3CU7 A;  4EL8 A;  1FBW A;  2FBA A;  3WKG A;  1CEM A;  1KZO B;  2WIN B;  1NC5 A;  3E80 A;  4L6X A;  3GLY A;  1FMI A;  5ILI A;  2B4F A;  3Q75 B;  3QG0 A;  4F10 A;  4ZH5 A;  4GTS B;  3Q7F B;  1ULV A;  4BOJ A;  4Z4L A;  4CJ0 A;  1G6I A;  4F13 A;  3KLS A;  1LF6 A;  3QFY A;  3QT3 A;  4ONT A;  1WZZ A;  2XWJ B;  4GTR B;  2V3P A;  3GZK A;  4J5T A;  2PN5 A;  3VXD A;  4LNB B;  2ONH A;  4V1R A;  3PZ2 B;  4GL3 A;  4WVB A;  2B39 A;  3NNB A;  1OJO A;  1SA5 B; 
#chains in the Genus database with same CATH homology
 3AFJ A;  2H6G B;  3EUV B;  2I07 B;  3DSW B;  1UG9 A;  1HCU A;  4DOE A;  3H7L A;  3RX7 A;  4D4D A;  3W5N A;  1O6Q A;  2GZ6 A;  4Q2B A;  1TF4 A;  3GT5 A;  1XW2 A;  1V7V A;  3Q7A B;  1SA4 B;  1CLC A;  3DSS B;  3E37 B;  2FV1 A;  3D3I A;  2NVP A;  2G02 A;  3RX5 A;  4LNG B;  4FXK B;  1LF9 A;  3S4C A;  4EHM B;  5KKB A;  3OED A;  1JS4 A;  3TF4 A;  3H2W A;  3K7X A;  3DST B;  2DRO A;  1FBO A;  4GTT B;  2ZIS B;  4LNV A;  2BB6 A;  2EAC A;  2AFA A;  2WII B;  3ACT A;  1GHQ A;  5MEH A;  3DSV B;  3M74 A;  2H6F B;  1WU6 A;  3CIH A;  3ANI A;  4ZRQ A;  4XUV A;  2RI9 A;  3OXU A;  3PMM A;  1NXC A;  1TNO B;  1H3B A;  1KRE A;  1S63 B;  1TN7 B;  3G6J B;  1H14 A;  4AYO A;  3PYA A;  4M76 A;  3M7B A;  2QNO A;  1IS9 A;  3A3V A;  2P0V A;  5GZK A;  1V5C A;  3E34 B;  3ANJ A;  2WY7 A;  4ZRP A;  2PMV A;  3W7X A;  4MU9 A;  1XWQ A;  3M75 A;  4AYQ A;  1V7X A;  3QPF A;  3EU5 B;  4GTO B;  1NL4 B;  1H13 A;  5CZL A;  1GLM A;  1O5M B;  2ZZR A;  3SDU A;  3E73 A;  1MZC B;  5M7I A;  4GTQ B;  4C1S A;  1G9J A;  1DCE B;  4D94 A;  1O1R B;  3E33 B;  2EAD A;  2ZIR B;  4KTR A;  1RQ5 A;  2D8L A;  1XWT A;  1X9D A;  4GTP B;  3Q78 B;  1O1S B;  1GA2 A;  5FO7 B;  3HXD B;  2V8K A;  5DGQ A;  1AGM A;  4D4C A;  5AGD A;  3ANK A;  3X17 A;  1JCQ B;  2XWB B;  1K72 A;  3QFZ A;  3M77 A;  4GTV B;  2JF4 A;  2WYN A;  3Q73 B;  2FUZ A;  2A8Z A;  3EQA A;  3M73 A;  3WIR A;  1V5D A;  1TN8 B;  1FT1 B;  2AHF A;  1N95 B;  1TNZ B;  2GOX A;  1FT2 B;  3S4B A;  3M78 A;  2SQC A;  5E2J A;  2EAB A;  4WU0 A;  1TNU B;  3WIQ A;  1KZP B;  1GAI A;  5CD2 A;  1L2A A;  1TNB B;  1FP3 A;  2YIK A;  2XQW A;  4YCR A;  3P5R A;  2V8J A;  1LD8 B;  3W5M A;  3REN A;  3DRA B;  2DRQ A;  3T33 A;  3QXQ A;  5FO9 B;  1WU4 A;  1O6R A;  1KSD A;  3EU8 A;  5JPN B;  1FO2 A;  4YDE B;  2H6H B;  4KKJ A;  4WVC A;  1R76 A;  5FOB B;  1AYX A;  2OKX A;  2D5J A;  3PZ4 B;  1GXN A;  2DRR A;  1N4Q B;  1TN6 B;  3WC3 A;  3KSQ B;  3QSP A;  2NOJ A;  3P5P A;  3PYB A;  3M76 A;  1H3A A;  3WUX A;  2DRS A;  5FO8 B;  1NI1 B;  3HXF B;  3H3K A;  4CJ1 A;  4Q88 A;  4CE7 A;  1G87 A;  4QT9 A;  2XFG A;  4L9P B;  1N4R B;  3SQC A;  4JJJ A;  1L1Y A;  2FV0 A;  3PZ1 B;  3W7U A;  1FPP B;  1H37 A;  3D5R A;  1LD7 B;  3QT9 A;  2VN7 A;  1KWF A;  1H35 A;  1QSJ A;  1UMP A;  1N94 B;  3SDT A;  3KSL B;  5GY3 A;  1N4P B;  3P2C A;  4KTP A;  3S9V A;  2BBC A;  5CA3 A;  3C72 B;  3DPY B;  3RRS A;  5DGR A;  3SDQ A;  4AYP A;  2R2L B;  3M7L A;  1KRF A;  1S64 B;  2G0D A;  4BOK A;  4GTM B;  1SQC A;  1H39 A;  2F0Y B;  3HXC B;  3RJ3 A;  1H54 A;  3E32 B;  2WY8 A;  1W6K A;  2BED B;  3SFX B;  3Q79 B;  1IA6 A;  3HXB B;  3M7C A;  2VN4 A;  4DOD A;  2IEJ B;  1FAE A;  3KQ4 A;  1LTX B;  3SDV A;  2Z07 A;  3SDR A;  3DSX B;  3PZ3 B;  1UT9 A;  4TF4 A;  4YDO B;  2H6I B;  3S4D A;  1GAH A;  2EAE A;  1KFG A;  1QQF A;  2V8I A;  3M7E A;  3E6U A;  1H12 A;  3VW5 A;  4Z4J A;  4ZH1 A;  3QRY A;  1F9D A;  3E30 B;  4D4B A;  1N4S B;  1KS8 A;  1H36 A;  1IA7 A;  1JCR B;  3SFY B;  1H3C A;  4KKI A;  1O6H A;  1C3D A;  3ACS A;  3RSY A;  2JJB A;  2V3N A;  5M7Y A;  2RI8 A;  2AHG A;  4L0G A;  5GW7 A;  2ZBL A;  3WKI A;  4D4A A;  2A73 B;  3M72 A;  4WVA A;  4FUS A;  5JPM B;  3QXF A;  2GH4 A;  4TXT A;  1D8E B;  3W7T A;  4V1S A;  1D8D B;  4AYR A;  1FCE A;  4FXG B;  3D5S A;  3QDE A;  3S4A A;  1N9A B;  1F9O A;  2JG0 A;  1GSZ A;  3QWT A;  3EZ8 A;  2BB5 A;  1GXO A;  1KSC A;  1GXM A;  3RX8 A;  2CQS A;  1WU5 A;  3W7W A;  1KKT A;  4LIX A;  1QBQ B;  1G9G A;  2CQT A;  3SAE A;  1FO3 A;  1DL2 A;  3K11 A;  3WKF A;  1W6J A;  1HZF A;  1O79 A;  3WIW A;  1V7W A;  4ZG8 A;  3W7S A;  1X81 B;  1O1T B;  3WKH A;  3ON6 A;  3DSU B;  1DOG A;  4MBG B;  3M71 A;  1JCS B;  2RGK A;  2F6D A;  1TNY B;  3HXE B;  1VD5 A;  3CU7 A;  4EL8 A;  1FBW A;  2FBA A;  3WKG A;  1CEM A;  1KZO B;  2WIN B;  1NC5 A;  4L6X A;  3GLY A;  1FMI A;  2B4F A;  3Q75 B;  3QG0 A;  4ZH5 A;  4GTS B;  3Q7F B;  1ULV A;  4BOJ A;  4Z4L A;  4CJ0 A;  1G6I A;  1LF6 A;  3KLS A;  3QFY A;  3QT3 A;  4ONT A;  1WZZ A;  2XWJ B;  4GTR B;  2V3P A;  3GZK A;  4J5T A;  2PN5 A;  3VXD A;  4LNB B;  4V1R A;  3PZ2 B;  4GL3 A;  4WVB A;  2B39 A;  1SA5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...