2AHFA

Unsaturated glucuronyl hydrolase mutant d88n
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
377
structure length
377
Chain Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHNIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords unsaturated glucuronyl hydrolase
publication title Crystal Structure of Unsaturated Glucuronyl Hydrolase Complexed with Substrate: MOLECULAR INSIGHTS INTO ITS CATALYTIC REACTION MECHANISM
pubmed doi rcsb
source organism Bacillus sp.
total genus 164
structure length 377
sequence length 377
chains with identical sequence B
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2005-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2ahfA00
2ZZRA 1WU6A 5M7IA 2JJBA 3D3IA 3W7WA 4Q88A 1FCEA 1WU5A 4CJ1A 4DODA 1GAIA 4XUVA 1H12A 1KREA 3EZ8A 4KTPA 1G6IA 2EAEA 2B4FA 3RX5A 4CE7A 1FBOA 3H3KA 2VN4A 1AGMA 3QPFA 4Z4JA 3RX7A 2P0VA 1H14A 3S4BA 1KRFA 1WZZA 3T33A 1RQ5A 3WKIA 3CIHA 3W5NA 2CQSA 2QNOA 3K11A 3QFZA 4WVAA 2RGKA 2DROA 3VXDA 3QT9A 3RX8A 2FV0A 1L1YA 3ANIA 5GY3A 1IA7A 2D8LA 1V5DA 1DOGA 1FP3A 4WVCA 2RI9A 1KWFA 3PMMA 3A3VA 2FV1A 2YIKA 1DL2A 2DRQA 5GW7A 3S4DA 1XWTA 3EQAA 3WIRA 2EABA 3QDEA 1KKTA 2XFGA 3ANKA 2FBAA 5M7YA 2Z07A 2EACA 1LF6A 3AFJA 1KSDA 5CD2A 3QG0A 2JG0A 1XW2A 1XWQA 3W7UA 2JF4A 3ACSA 1WU4A 2RI8A 1V7WA 4AYQA 1GLMA 2A8ZA 2DRSA 4TXTA 3W7TA 3E6UA 1HCUA 3S4AA 1NC5A 3RENA 1V5CA 4L0GA 1CLCA 3QRYA 3RRSA 1ULVA 1IA6A 1KFGA 1NXCA 1KSCA 1F9OA 3RSYA 1FMIA 1AYXA 3GT5A 1TF4A 3E73A 4TF4A 1JS4A 4AYRA 4FUSA 4AYPA 4L6XA 1V7VA 5DGQA 1IS9A 3WKHA 1K72A 4KTRA 1H13A 1LF9A 2WYNA 3S4CA 3VW5A 3W7XA 2FUZA 2OKXA 2AFAA 3WKFA 4Q2BA 1V7XA 2NVPA 2ZBLA 1CEMA 1G9GA 3QSPA 3WKGA 4CJ0A 1FO2A 4DOEA 3GLYA 3ON6A 3TF4A 1X9DA 3W5MA 2AHFA 4EL8A 1G87A 3W7SA 5E2JA 2EADA 1FBWA 1UG9A 4WU0A 2AHGA 3QXQA 1L2AA 3QT3A 5MEHA 3GZKA 4ZG8A 5KKBA 4JJJA 1UT9A 2GZ6A 4AYOA 3QXFA 2VN7A 2D5JA 1FAEA 3WIQA 1GA2A 2DRRA 1KS8A 4Z4LA 4WVBA 3P2CA 4J5TA 3X17A 3H2WA 1GAHA 3WUXA 2F6DA 3ACTA 3H7LA 4ZH5A 3WIWA 3ANJA 5DGRA 5CA3A 1G9JA 1VD5A 2CQTA 1FO3A 5CZLA 1F9DA 3QWTA 3QFYA 3WC3A 2GH4A 1H54A
chains in the Genus database with same CATH superfamily
1RW9A 2JJBA 1TN8B 3SAEA 4Q88A 1GSZA 4XUVA 3OEDA 1G6IA 2B4FA 3G4FA 2BBCA 1FBOA 2FUTA 1AGMA 4Z4JA 3M78A 1N9AB 2P0VA 1H14A 1RQ5A 2CQSA 2RGKA 3D5SA 5FO7B 1HV6A 3RX8A 1N7NA 1S63B 3OXUA 2X03A 1IA7A 3G6JB 3N0GA 4OZVA 1KWFA 1DL2A 3WIRA 5M7YA 1KKTA 4LNGB 5GZKA 1QSJA 3PYAA 2JF4A 1N24A 3ACSA 1H39A 2A8ZA 3M01A 3SDVA 5AGDA 4V1RA 3E34B 1TN7B 1F9OA 1FMIA 3GT5A 1TF4A 1LD8B 1O1SB 3E73A 1JS4A 1KZPB 3E7JA 4AYRA 3HXEB 5DGQA 3M75A 1F9GA 4GAXA 1O1TB 5ILZA 5IK0A 4FXGB 1LF9A 4GTPB 1W6KA 4GTQB 3S4CA 2OKXA 5FO8B 3P5PA 1CEMA 4CJ0A 1FO2A 1N4RB 4DI5A 1N7OA 3ON6A 1LOHA 4FXKB 1G87A 3G4DA 2EADA 3QXQA 1L2AA 1GXOA 2XWJB 1CB8A 5MEHA 2V3PA 3SDRA 4JJJA 4E1YA 2H6IB 1N7RA 3KQ4A 3DSXB 3M74A 5EAUA 1FAEA 2DRRA 2IEJB 1FT2B 1GAHA 5ILJA 2WINB 2B39A 3WIWA 1HM2A 3M76A 3PYBA 4KKJA 5CA3A 1VD5A 2CQTA 1N7QA 3EU5B 4C1SA 2GH4A 3D5RA 2BB5A 2ZZRA 3D3IA 1OJOA 4BOKA 2Q1FA 3W7WA 1FCEA 4RNQA 1N23A 4DODA 1H12A 1KREA 4KTPA 1HXGA 1O1RB 3QPFA 1JCSB 5FOBB 1C82A 1HMWA 2G0DA 3S4BA 3EUVB 4MBGB 3A0OA 3CIHA 2QNOA 3K11A 3Q7AB 2J5CA 3SDTA 3VXDA 3QT9A 5DHKA 2FV0A 1L1YA 1J0MA 3ANIA 5GY3A 2G02A 2D8LA 1EGUA 4ZRQA 1FP3A 1LXKA 4WVCA 2BRWA 2RI9A 5IL8A 2H6GB 1JCRB 1QAZA 1H3CA 1NI1B 1XWTA 3EQAA 2EABA 5JPNB 2XFGA 4F13A 2FBAA 4KKIA 2EACA 5CD2A 3Q75B 3W7UA 2FUQA 3M72A 2RI8A 1F1SA 1HXCA 5JMDA 3NFVA 3E30B 3E32B 1KFGA 1NL4B 1FPPB 1N95B 3Q7FB 3RSYA 4GTRB 1AYXA 3SFYB 5ILDA 3E33B 4TF4A 5ILHA 4AYPA 1V7VA 1RWAA 4M76A 1IS9A 1K72A 2V8KA 1HZFA 5ILIA 1GXMA 1KZOB 3M7EA 2WYNA 3VW5A 1H37A 2NVPA 3QSPA 4DOEA 1FT1B 1N1BA 1TNYB 5IM1A 1QBQB 1RWFA 1X9DA 5IK6A 3W5MA 2AHFA 1X1HA 5E2JA 4WU0A 2AHGA 3K7XA 1RWHA 1TNBB 1X1JA 1HXAA 2VN7A 1QQFA 4Z4LA 4WVBA 3P2CA 2WDAA 3C72B 3PZ1B 4J5TA 3X17A 3Q79B 3SDUA 4D4DA 1N7PA 3WUXA 3DPYB 3H7LA 2BB6A 3EU8A 3VSNA 1G9JA 1FO3A 5CZLA 3QWTA 3QFYA 3PMMA 2XQWA 5M7IA 1WU6A 3NNBA 4F10A 2ONGA 1N1ZA 1WU5A 2SQCA 3HXCB 2EAEA 3RX5A 4CE7A 4GTTB 2VN4A 4D4AA 3DSSB 2XWBB 4GTOB 1WZZA 3T33A 3W5NA 1J0NA 1OJMA 1O79A 3PZ4B 1W6JA 5EATA 1DOGA 4EHMB 1TN6B 1R76A 5ILKA 2FV1A 5GW7A 3S4DA 5FO9B 2WIIB 1W3YA 3QDEA 3ANKA 4MMIA 2Z07A 1N4QB 3QG0A 5JPMB 4ZH1A 1WU4A 4MU9A 4GTVB 4TXTA 3W7TA 3E6UA 4QT9A 3S4AA 1NC5A 2E22A 3RRSA 2R2LB 1IA6A 3E80A 4LNBB 2WY7A 3KLSA 1X81B 5IKHA 4L6XA 4LIXA 4D4BA 1MZCB 4MMHA 4OK4A 4KTRA 2NOJA 2BRPA 3W7XA 3WKFA 2AFAA 5IL3A 2ZISB 2E24A 2WY8A 2WCOA 4Q2BA 1G9GA 3WKGA 3TF4A 1D8DB 1N20A 5IKAA 3W7SA 3M77A 3PZ3B 1FBWA 3M00A 1UG9A 2H6HB 1H3BA 4GTMB 5KKBA 1UT9A 2GZ6A 4ONTA 1UMPA 5ILYA 3N0FA 1SA4B 4FNVA 1KS8A 1GHQA 3S9VA 4L9PB 1HX9A 2H6FB 1SA5B 3H2WA 2F6DA 3ACTA 4ZH5A 2V8IA 3ANJA 1TNZB 5DGRA 1N94B 3LZ9A 3WC3A 1HM3A 1HMUA 4CJ1A 2GOXA 1GAIA 2ZIRB 3EZ8A 3H3KA 3KSQB 1N21A 3RX7A 1KRFA 1O6RA 3WKIA 1O6QA 3QFZA 4WVAA 3M73A 4ZRPA 5JMFA 2DROA 3DRAB 4D94A 1RWCA 1V5DA 1O6HA 2F0YB 3A3VA 5IK9A 2YIKA 2DRQA 1RWGA 2V8JA 3DSTB 3M7LA 3VSMA 1N4SB 1LF6A 1I8QA 1KSDA 1LTXB 3AFJA 2JG0A 1XW2A 3SDQA 1XWQA 2PN5A 2PMVA 2ONHA 3M02A 1TNOB 1N4PB 1LXMA 1GLMA 1V7WA 4AYQA 2DRSA 1S64B 4FJQA 2A73B 2BRVX 3DSUB 1HCUA 5C05A 2I07B 1V5CA 3RENA 1HN0A 1CLCA 4L0GA 3QRYA 1DCEB 1ULVA 1NXCA 1KSCA 1X1IA 4FUSA 1H35A 3DSVB 3M71A 3CU7A 3RJ3A 3Q73B 5DHIA 1LD7B 2V3NA 3WKHA 3M7BA 1H13A 3HXBB 2FUZA 1OJNA 3Q78B 1V7XA 1C3DA 4BOJA 2ZBLA 2BEDB 3M7CA 1D8EB 4GL3A 3GLYA 4LNVA 3SFXB 4EL8A 3DSWB 3KSLB 4OJZA 3QT3A 1N22A 3GZKA 4ZG8A 4OK2A 1TNUB 1H3AA 3PZ2B 4YCRA 4OZWA 4V1SA 4YDEB 3HXDB 4AYOA 1OJPA 4YDOB 3QXFA 2D5JA 1JCQB 3WIQA 5EASA 1GA2A 1GXNA 1O5MB 3AFLA 4D4CA 4NEIA 3P5RA 1SQCA 3HXFB 4GTSB 1F9DA 3E37B 3SQCA 1H54A 1H36A
chains in the Genus database with same CATH topology
2JJBA 1TN8B 3SAEA 4Q88A 1GSZA 4XUVA 3OEDA 1G6IA 2B4FA 2BBCA 1FBOA 1AGMA 4Z4JA 3M78A 1N9AB 2P0VA 1H14A 1RQ5A 2CQSA 2RGKA 3D5SA 5FO7B 3RX8A 1S63B 3OXUA 1IA7A 3G6JB 1KWFA 1DL2A 3WIRA 5M7YA 1KKTA 4LNGB 5GZKA 1QSJA 3PYAA 2JF4A 3ACSA 1H39A 2A8ZA 3SDVA 5AGDA 4V1RA 3E34B 1TN7B 1F9OA 1FMIA 3GT5A 1TF4A 1LD8B 1O1SB 3E73A 1JS4A 1KZPB 4AYRA 3HXEB 5DGQA 3M75A 1O1TB 4FXGB 1LF9A 4GTPB 1W6KA 4GTQB 3S4CA 2OKXA 5FO8B 3P5PA 1CEMA 4CJ0A 1FO2A 1N4RB 3ON6A 4FXKB 1G87A 2EADA 3QXQA 1L2AA 1GXOA 2XWJB 5MEHA 2V3PA 3SDRA 4JJJA 2H6IB 3KQ4A 3DSXB 3M74A 1FAEA 2DRRA 2IEJB 1FT2B 1GAHA 2WINB 2B39A 3WIWA 3M76A 3PYBA 4KKJA 5CA3A 1VD5A 2CQTA 3EU5B 4C1SA 2GH4A 3D5RA 2BB5A 2ZZRA 3D3IA 4BOKA 3W7WA 1FCEA 4DODA 1H12A 1KREA 4KTPA 1O1RB 3QPFA 1JCSB 5FOBB 2G0DA 3S4BA 3EUVB 4MBGB 3CIHA 2QNOA 3K11A 3Q7AB 3SDTA 3VXDA 3QT9A 2FV0A 1L1YA 3ANIA 5GY3A 2G02A 2D8LA 4ZRQA 1FP3A 4WVCA 2RI9A 2H6GB 1JCRB 1H3CA 1NI1B 1XWTA 3EQAA 2EABA 5JPNB 2XFGA 2FBAA 4KKIA 2EACA 5CD2A 3Q75B 3W7UA 3M72A 2RI8A 3E30B 3E32B 1KFGA 1NL4B 1FPPB 1N95B 3Q7FB 3RSYA 4GTRB 1AYXA 3SFYB 3E33B 4TF4A 4AYPA 1V7VA 4M76A 1IS9A 1K72A 2V8KA 1HZFA 1GXMA 1KZOB 3M7EA 2WYNA 3VW5A 1H37A 2NVPA 3QSPA 4DOEA 1FT1B 1TNYB 1QBQB 1X9DA 3W5MA 2AHFA 5E2JA 4WU0A 2AHGA 3K7XA 1TNBB 2VN7A 1QQFA 4Z4LA 4WVBA 3P2CA 3C72B 3PZ1B 4J5TA 3X17A 3Q79B 3SDUA 4D4DA 3WUXA 3DPYB 3H7LA 2BB6A 3EU8A 1G9JA 1FO3A 5CZLA 3QWTA 3QFYA 3PMMA 2XQWA 5M7IA 1WU6A 3HXCB 1WU5A 2SQCA 2EAEA 3RX5A 4CE7A 4GTTB 2VN4A 4D4AA 3DSSB 2XWBB 4GTOB 1WZZA 3T33A 3W5NA 1O79A 3PZ4B 1W6JA 1DOGA 4EHMB 1TN6B 1R76A 2FV1A 5GW7A 3S4DA 5FO9B 2WIIB 3QDEA 3ANKA 2Z07A 1N4QB 3QG0A 5JPMB 4ZH1A 1WU4A 4MU9A 4GTVB 4TXTA 3W7TA 3E6UA 4QT9A 3S4AA 1NC5A 3RRSA 2R2LB 1IA6A 4LNBB 2WY7A 3KLSA 1X81B 4L6XA 4LIXA 4D4BA 1MZCB 4KTRA 2NOJA 3W7XA 3WKFA 2AFAA 2ZISB 4Q2BA 2WY8A 1G9GA 3WKGA 3TF4A 1D8DB 3W7SA 3M77A 3PZ3B 1FBWA 1UG9A 2H6HB 1H3BA 4GTMB 5KKBA 1UT9A 2GZ6A 4ONTA 1UMPA 1SA4B 1KS8A 1GHQA 3S9VA 4L9PB 2H6FB 1SA5B 3H2WA 2F6DA 3ACTA 4ZH5A 2V8IA 3ANJA 1TNZB 5DGRA 1N94B 3WC3A 4CJ1A 2GOXA 1GAIA 2ZIRB 3EZ8A 3H3KA 3KSQB 3RX7A 1KRFA 1O6RA 3WKIA 1O6QA 3QFZA 4WVAA 3M73A 4ZRPA 2DROA 3DRAB 4D94A 1V5DA 1O6HA 2F0YB 3A3VA 2YIKA 2DRQA 2V8JA 3DSTB 3M7LA 1LF6A 1N4SB 3AFJA 1KSDA 1LTXB 2JG0A 1XW2A 3SDQA 1XWQA 2PN5A 2PMVA 1TNOB 1N4PB 1V7WA 1GLMA 4AYQA 2DRSA 1S64B 2A73B 3DSUB 1HCUA 2I07B 1V5CA 3RENA 4L0GA 1CLCA 3QRYA 1DCEB 1ULVA 1NXCA 1KSCA 4FUSA 1H35A 3DSVB 3M71A 3CU7A 3RJ3A 3Q73B 1LD7B 2V3NA 3WKHA 3M7BA 1H13A 3HXBB 2FUZA 3Q78B 1V7XA 1C3DA 4BOJA 2ZBLA 2BEDB 3M7CA 1D8EB 4GL3A 3GLYA 4LNVA 3SFXB 4EL8A 3DSWB 3KSLB 3QT3A 3GZKA 4ZG8A 1TNUB 1H3AA 3PZ2B 4YCRA 4V1SA 4YDEB 3HXDB 4AYOA 4YDOB 3QXFA 2D5JA 1JCQB 3WIQA 1GA2A 1GXNA 1O5MB 4D4CA 3P5RA 1SQCA 3HXFB 4GTSB 1F9DA 3E37B 3SQCA 1H54A 1H36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZR A;  1WU6 A;  5M7I A;  2JJB A;  3D3I A;  3W7W A;  4Q88 A;  1FCE A;  1WU5 A;  4CJ1 A;  4DOD A;  1GAI A;  4XUV A;  1H12 A;  1KRE A;  3EZ8 A;  4KTP A;  1G6I A;  2EAE A;  2B4F A;  3RX5 A;  4CE7 A;  1FBO A;  3H3K A;  2VN4 A;  1AGM A;  3QPF A;  4Z4J A;  3RX7 A;  2P0V A;  1H14 A;  3S4B A;  1KRF A;  1WZZ A;  3T33 A;  1RQ5 A;  3WKI A;  3CIH A;  3W5N A;  2CQS A;  2QNO A;  3K11 A;  3QFZ A;  4WVA A;  2RGK A;  2DRO A;  3VXD A;  3QT9 A;  3RX8 A;  2FV0 A;  1L1Y A;  3ANI A;  5GY3 A;  1IA7 A;  2D8L A;  1V5D A;  1DOG A;  1FP3 A;  4WVC A;  2RI9 A;  1KWF A;  3PMM A;  3A3V A;  2FV1 A;  2YIK A;  1DL2 A;  2DRQ A;  5GW7 A;  3S4D A;  1XWT A;  3EQA A;  3WIR A;  2EAB A;  3QDE A;  1KKT A;  2XFG A;  3ANK A;  2FBA A;  5M7Y A;  2Z07 A;  2EAC A;  1LF6 A;  3AFJ A;  1KSD A;  5CD2 A;  3QG0 A;  2JG0 A;  1XW2 A;  1XWQ A;  3W7U A;  2JF4 A;  3ACS A;  1WU4 A;  2RI8 A;  1V7W A;  4AYQ A;  1GLM A;  2A8Z A;  2DRS A;  4TXT A;  3W7T A;  3E6U A;  1HCU A;  3S4A A;  1NC5 A;  3REN A;  1V5C A;  4L0G A;  1CLC A;  3QRY A;  3RRS A;  1ULV A;  1IA6 A;  1KFG A;  1NXC A;  1KSC A;  1F9O A;  3RSY A;  1FMI A;  1AYX A;  3GT5 A;  1TF4 A;  3E73 A;  4TF4 A;  1JS4 A;  4AYR A;  4FUS A;  4AYP A;  4L6X A;  1V7V A;  5DGQ A;  1IS9 A;  3WKH A;  1K72 A;  4KTR A;  1H13 A;  1LF9 A;  2WYN A;  3S4C A;  3VW5 A;  3W7X A;  2FUZ A;  2OKX A;  2AFA A;  3WKF A;  4Q2B A;  1V7X A;  2NVP A;  2ZBL A;  1CEM A;  1G9G A;  3QSP A;  3WKG A;  4CJ0 A;  1FO2 A;  4DOE A;  3GLY A;  3ON6 A;  3TF4 A;  1X9D A;  3W5M A;  2AHF A;  4EL8 A;  1G87 A;  3W7S A;  5E2J A;  2EAD A;  1FBW A;  1UG9 A;  4WU0 A;  2AHG A;  3QXQ A;  1L2A A;  3QT3 A;  5MEH A;  3GZK A;  4ZG8 A;  5KKB A;  4JJJ A;  1UT9 A;  2GZ6 A;  4AYO A;  3QXF A;  2VN7 A;  2D5J A;  1FAE A;  3WIQ A;  1GA2 A;  2DRR A;  1KS8 A;  4Z4L A;  4WVB A;  3P2C A;  4J5T A;  3X17 A;  3H2W A;  1GAH A;  3WUX A;  2F6D A;  3ACT A;  3H7L A;  4ZH5 A;  3WIW A;  3ANJ A;  5DGR A;  5CA3 A;  1G9J A;  1VD5 A;  2CQT A;  1FO3 A;  5CZL A;  1F9D A;  3QWT A;  3QFY A;  3WC3 A;  2GH4 A;  1H54 A; 
#chains in the Genus database with same CATH topology
 1RW9 A;  2JJB A;  1TN8 B;  3SAE A;  4Q88 A;  1GSZ A;  4XUV A;  3OED A;  1G6I A;  2B4F A;  3G4F A;  2BBC A;  1FBO A;  2FUT A;  1AGM A;  4Z4J A;  3M78 A;  1N9A B;  2P0V A;  1H14 A;  1RQ5 A;  2CQS A;  2RGK A;  3D5S A;  5FO7 B;  1HV6 A;  3RX8 A;  1N7N A;  1S63 B;  3OXU A;  2X03 A;  1IA7 A;  3G6J B;  3N0G A;  4OZV A;  1KWF A;  1DL2 A;  3WIR A;  5M7Y A;  1KKT A;  4LNG B;  5GZK A;  1QSJ A;  3PYA A;  2JF4 A;  1N24 A;  3ACS A;  1H39 A;  2A8Z A;  3M01 A;  3SDV A;  5AGD A;  4V1R A;  3E34 B;  1TN7 B;  1F9O A;  1FMI A;  3GT5 A;  1TF4 A;  1LD8 B;  1O1S B;  3E73 A;  1JS4 A;  1KZP B;  3E7J A;  4AYR A;  3HXE B;  5DGQ A;  3M75 A;  1F9G A;  4GAX A;  1O1T B;  5ILZ A;  5IK0 A;  4FXG B;  1LF9 A;  4GTP B;  1W6K A;  4GTQ B;  3S4C A;  2OKX A;  5FO8 B;  3P5P A;  1CEM A;  4CJ0 A;  1FO2 A;  1N4R B;  4DI5 A;  1N7O A;  3ON6 A;  1LOH A;  4FXK B;  1G87 A;  3G4D A;  2EAD A;  3QXQ A;  1L2A A;  1GXO A;  2XWJ B;  1CB8 A;  5MEH A;  2V3P A;  3SDR A;  4JJJ A;  4E1Y A;  2H6I B;  1N7R A;  3KQ4 A;  3DSX B;  3M74 A;  5EAU A;  1FAE A;  2DRR A;  2IEJ B;  1FT2 B;  1GAH A;  5ILJ A;  2WIN B;  2B39 A;  3WIW A;  1HM2 A;  3M76 A;  3PYB A;  4KKJ A;  5CA3 A;  1VD5 A;  2CQT A;  1N7Q A;  3EU5 B;  4C1S A;  2GH4 A;  3D5R A;  2BB5 A;  2ZZR A;  3D3I A;  1OJO A;  4BOK A;  2Q1F A;  3W7W A;  1FCE A;  4RNQ A;  1N23 A;  4DOD A;  1H12 A;  1KRE A;  4KTP A;  1HXG A;  1O1R B;  3QPF A;  1JCS B;  5FOB B;  1C82 A;  1HMW A;  2G0D A;  3S4B A;  3EUV B;  4MBG B;  3A0O A;  3CIH A;  2QNO A;  3K11 A;  3Q7A B;  2J5C A;  3SDT A;  3VXD A;  3QT9 A;  5DHK A;  2FV0 A;  1L1Y A;  1J0M A;  3ANI A;  5GY3 A;  2G02 A;  2D8L A;  1EGU A;  4ZRQ A;  1FP3 A;  1LXK A;  4WVC A;  2BRW A;  2RI9 A;  5IL8 A;  2H6G B;  1JCR B;  1QAZ A;  1H3C A;  1NI1 B;  1XWT A;  3EQA A;  2EAB A;  5JPN B;  2XFG A;  4F13 A;  2FBA A;  4KKI A;  2EAC A;  5CD2 A;  3Q75 B;  3W7U A;  2FUQ A;  3M72 A;  2RI8 A;  1F1S A;  1HXC A;  5JMD A;  3NFV A;  3E30 B;  3E32 B;  1KFG A;  1NL4 B;  1FPP B;  1N95 B;  3Q7F B;  3RSY A;  4GTR B;  1AYX A;  3SFY B;  5ILD A;  3E33 B;  4TF4 A;  5ILH A;  4AYP A;  1V7V A;  1RWA A;  4M76 A;  1IS9 A;  1K72 A;  2V8K A;  1HZF A;  5ILI A;  1GXM A;  1KZO B;  3M7E A;  2WYN A;  3VW5 A;  1H37 A;  2NVP A;  3QSP A;  4DOE A;  1FT1 B;  1N1B A;  1TNY B;  5IM1 A;  1QBQ B;  1RWF A;  1X9D A;  5IK6 A;  3W5M A;  2AHF A;  1X1H A;  5E2J A;  4WU0 A;  2AHG A;  3K7X A;  1RWH A;  1TNB B;  1X1J A;  1HXA A;  2VN7 A;  1QQF A;  4Z4L A;  4WVB A;  3P2C A;  2WDA A;  3C72 B;  3PZ1 B;  4J5T A;  3X17 A;  3Q79 B;  3SDU A;  4D4D A;  1N7P A;  3WUX A;  3DPY B;  3H7L A;  2BB6 A;  3EU8 A;  3VSN A;  1G9J A;  1FO3 A;  5CZL A;  3QWT A;  3QFY A;  3PMM A;  2XQW A;  5M7I A;  1WU6 A;  3NNB A;  4F10 A;  2ONG A;  1N1Z A;  1WU5 A;  2SQC A;  3HXC B;  2EAE A;  3RX5 A;  4CE7 A;  4GTT B;  2VN4 A;  4D4A A;  3DSS B;  2XWB B;  4GTO B;  1WZZ A;  3T33 A;  3W5N A;  1J0N A;  1OJM A;  1O79 A;  3PZ4 B;  1W6J A;  5EAT A;  1DOG A;  4EHM B;  1TN6 B;  1R76 A;  5ILK A;  2FV1 A;  5GW7 A;  3S4D A;  5FO9 B;  2WII B;  1W3Y A;  3QDE A;  3ANK A;  4MMI A;  2Z07 A;  1N4Q B;  3QG0 A;  5JPM B;  4ZH1 A;  1WU4 A;  4MU9 A;  4GTV B;  4TXT A;  3W7T A;  3E6U A;  4QT9 A;  3S4A A;  1NC5 A;  2E22 A;  3RRS A;  2R2L B;  1IA6 A;  3E80 A;  4LNB B;  2WY7 A;  3KLS A;  1X81 B;  5IKH A;  4L6X A;  4LIX A;  4D4B A;  1MZC B;  4MMH A;  4OK4 A;  4KTR A;  2NOJ A;  2BRP A;  3W7X A;  3WKF A;  2AFA A;  5IL3 A;  2ZIS B;  2E24 A;  2WY8 A;  2WCO A;  4Q2B A;  1G9G A;  3WKG A;  3TF4 A;  1D8D B;  1N20 A;  5IKA A;  3W7S A;  3M77 A;  3PZ3 B;  1FBW A;  3M00 A;  1UG9 A;  2H6H B;  1H3B A;  4GTM B;  5KKB A;  1UT9 A;  2GZ6 A;  4ONT A;  1UMP A;  5ILY A;  3N0F A;  1SA4 B;  4FNV A;  1KS8 A;  1GHQ A;  3S9V A;  4L9P B;  1HX9 A;  2H6F B;  1SA5 B;  3H2W A;  2F6D A;  3ACT A;  4ZH5 A;  2V8I A;  3ANJ A;  1TNZ B;  5DGR A;  1N94 B;  3LZ9 A;  3WC3 A;  1HM3 A;  1HMU A;  4CJ1 A;  2GOX A;  1GAI A;  2ZIR B;  3EZ8 A;  3H3K A;  3KSQ B;  1N21 A;  3RX7 A;  1KRF A;  1O6R A;  3WKI A;  1O6Q A;  3QFZ A;  4WVA A;  3M73 A;  4ZRP A;  5JMF A;  2DRO A;  3DRA B;  4D94 A;  1RWC A;  1V5D A;  1O6H A;  2F0Y B;  3A3V A;  5IK9 A;  2YIK A;  2DRQ A;  1RWG A;  2V8J A;  3DST B;  3M7L A;  3VSM A;  1N4S B;  1LF6 A;  1I8Q A;  1KSD A;  1LTX B;  3AFJ A;  2JG0 A;  1XW2 A;  3SDQ A;  1XWQ A;  2PN5 A;  2PMV A;  2ONH A;  3M02 A;  1TNO B;  1N4P B;  1LXM A;  1GLM A;  1V7W A;  4AYQ A;  2DRS A;  1S64 B;  4FJQ A;  2A73 B;  2BRV X;  3DSU B;  1HCU A;  5C05 A;  2I07 B;  1V5C A;  3REN A;  1HN0 A;  1CLC A;  4L0G A;  3QRY A;  1DCE B;  1ULV A;  1NXC A;  1KSC A;  1X1I A;  4FUS A;  1H35 A;  3DSV B;  3M71 A;  3CU7 A;  3RJ3 A;  3Q73 B;  5DHI A;  1LD7 B;  2V3N A;  3WKH A;  3M7B A;  1H13 A;  3HXB B;  2FUZ A;  1OJN A;  3Q78 B;  1V7X A;  1C3D A;  4BOJ A;  2ZBL A;  2BED B;  3M7C A;  1D8E B;  4GL3 A;  3GLY A;  4LNV A;  3SFX B;  4EL8 A;  3DSW B;  3KSL B;  4OJZ A;  3QT3 A;  1N22 A;  3GZK A;  4ZG8 A;  4OK2 A;  1TNU B;  1H3A A;  3PZ2 B;  4YCR A;  4OZW A;  4V1S A;  4YDE B;  3HXD B;  4AYO A;  1OJP A;  4YDO B;  3QXF A;  2D5J A;  1JCQ B;  3WIQ A;  5EAS A;  1GA2 A;  1GXN A;  1O5M B;  3AFL A;  4D4C A;  4NEI A;  3P5R A;  1SQC A;  3HXF B;  4GTS B;  1F9D A;  3E37 B;  3SQC A;  1H54 A;  1H36 A; 
#chains in the Genus database with same CATH homology
 2JJB A;  1TN8 B;  3SAE A;  4Q88 A;  1GSZ A;  4XUV A;  3OED A;  1G6I A;  2B4F A;  2BBC A;  1FBO A;  1AGM A;  4Z4J A;  3M78 A;  1N9A B;  2P0V A;  1H14 A;  1RQ5 A;  2CQS A;  2RGK A;  3D5S A;  5FO7 B;  3RX8 A;  1S63 B;  3OXU A;  1IA7 A;  3G6J B;  1KWF A;  1DL2 A;  3WIR A;  5M7Y A;  1KKT A;  4LNG B;  5GZK A;  1QSJ A;  3PYA A;  2JF4 A;  3ACS A;  1H39 A;  2A8Z A;  3SDV A;  5AGD A;  4V1R A;  3E34 B;  1TN7 B;  1F9O A;  1FMI A;  3GT5 A;  1TF4 A;  1LD8 B;  1O1S B;  3E73 A;  1JS4 A;  1KZP B;  4AYR A;  3HXE B;  5DGQ A;  3M75 A;  1O1T B;  4FXG B;  1LF9 A;  4GTP B;  1W6K A;  4GTQ B;  3S4C A;  2OKX A;  5FO8 B;  3P5P A;  1CEM A;  4CJ0 A;  1FO2 A;  1N4R B;  3ON6 A;  4FXK B;  1G87 A;  2EAD A;  3QXQ A;  1L2A A;  1GXO A;  2XWJ B;  5MEH A;  2V3P A;  3SDR A;  4JJJ A;  2H6I B;  3KQ4 A;  3DSX B;  3M74 A;  1FAE A;  2DRR A;  2IEJ B;  1FT2 B;  1GAH A;  2WIN B;  2B39 A;  3WIW A;  3M76 A;  3PYB A;  4KKJ A;  5CA3 A;  1VD5 A;  2CQT A;  3EU5 B;  4C1S A;  2GH4 A;  3D5R A;  2BB5 A;  2ZZR A;  3D3I A;  4BOK A;  3W7W A;  1FCE A;  4DOD A;  1H12 A;  1KRE A;  4KTP A;  1O1R B;  3QPF A;  1JCS B;  5FOB B;  2G0D A;  3S4B A;  3EUV B;  4MBG B;  3CIH A;  2QNO A;  3K11 A;  3Q7A B;  3SDT A;  3VXD A;  3QT9 A;  2FV0 A;  1L1Y A;  3ANI A;  5GY3 A;  2G02 A;  2D8L A;  4ZRQ A;  1FP3 A;  4WVC A;  2RI9 A;  2H6G B;  1JCR B;  1H3C A;  1NI1 B;  1XWT A;  3EQA A;  2EAB A;  5JPN B;  2XFG A;  2FBA A;  4KKI A;  2EAC A;  5CD2 A;  3Q75 B;  3W7U A;  3M72 A;  2RI8 A;  3E30 B;  3E32 B;  1KFG A;  1NL4 B;  1FPP B;  1N95 B;  3Q7F B;  3RSY A;  4GTR B;  1AYX A;  3SFY B;  3E33 B;  4TF4 A;  4AYP A;  1V7V A;  4M76 A;  1IS9 A;  1K72 A;  2V8K A;  1HZF A;  1GXM A;  1KZO B;  3M7E A;  2WYN A;  3VW5 A;  1H37 A;  2NVP A;  3QSP A;  4DOE A;  1FT1 B;  1TNY B;  1QBQ B;  1X9D A;  3W5M A;  2AHF A;  5E2J A;  4WU0 A;  2AHG A;  3K7X A;  1TNB B;  2VN7 A;  1QQF A;  4Z4L A;  4WVB A;  3P2C A;  3C72 B;  3PZ1 B;  4J5T A;  3X17 A;  3Q79 B;  3SDU A;  4D4D A;  3WUX A;  3DPY B;  3H7L A;  2BB6 A;  3EU8 A;  1G9J A;  1FO3 A;  5CZL A;  3QWT A;  3QFY A;  3PMM A;  2XQW A;  5M7I A;  1WU6 A;  3HXC B;  1WU5 A;  2SQC A;  2EAE A;  3RX5 A;  4CE7 A;  4GTT B;  2VN4 A;  4D4A A;  3DSS B;  2XWB B;  4GTO B;  1WZZ A;  3T33 A;  3W5N A;  1O79 A;  3PZ4 B;  1W6J A;  1DOG A;  4EHM B;  1TN6 B;  1R76 A;  2FV1 A;  5GW7 A;  3S4D A;  5FO9 B;  2WII B;  3QDE A;  3ANK A;  2Z07 A;  1N4Q B;  3QG0 A;  5JPM B;  4ZH1 A;  1WU4 A;  4MU9 A;  4GTV B;  4TXT A;  3W7T A;  3E6U A;  4QT9 A;  3S4A A;  1NC5 A;  3RRS A;  2R2L B;  1IA6 A;  4LNB B;  2WY7 A;  3KLS A;  1X81 B;  4L6X A;  4LIX A;  4D4B A;  1MZC B;  4KTR A;  2NOJ A;  3W7X A;  3WKF A;  2AFA A;  2ZIS B;  4Q2B A;  2WY8 A;  1G9G A;  3WKG A;  3TF4 A;  1D8D B;  3W7S A;  3M77 A;  3PZ3 B;  1FBW A;  1UG9 A;  2H6H B;  1H3B A;  4GTM B;  5KKB A;  1UT9 A;  2GZ6 A;  4ONT A;  1UMP A;  1SA4 B;  1KS8 A;  1GHQ A;  3S9V A;  4L9P B;  2H6F B;  1SA5 B;  3H2W A;  2F6D A;  3ACT A;  4ZH5 A;  2V8I A;  3ANJ A;  1TNZ B;  5DGR A;  1N94 B;  3WC3 A;  4CJ1 A;  2GOX A;  1GAI A;  2ZIR B;  3EZ8 A;  3H3K A;  3KSQ B;  3RX7 A;  1KRF A;  1O6R A;  3WKI A;  1O6Q A;  3QFZ A;  4WVA A;  3M73 A;  4ZRP A;  2DRO A;  3DRA B;  4D94 A;  1V5D A;  1O6H A;  2F0Y B;  3A3V A;  2YIK A;  2DRQ A;  2V8J A;  3DST B;  3M7L A;  1LF6 A;  1N4S B;  3AFJ A;  1KSD A;  1LTX B;  2JG0 A;  1XW2 A;  3SDQ A;  1XWQ A;  2PN5 A;  2PMV A;  1TNO B;  1N4P B;  1V7W A;  1GLM A;  4AYQ A;  2DRS A;  1S64 B;  2A73 B;  3DSU B;  1HCU A;  2I07 B;  1V5C A;  3REN A;  4L0G A;  1CLC A;  3QRY A;  1DCE B;  1ULV A;  1NXC A;  1KSC A;  4FUS A;  1H35 A;  3DSV B;  3M71 A;  3CU7 A;  3RJ3 A;  3Q73 B;  1LD7 B;  2V3N A;  3WKH A;  3M7B A;  1H13 A;  3HXB B;  2FUZ A;  3Q78 B;  1V7X A;  1C3D A;  4BOJ A;  2ZBL A;  2BED B;  3M7C A;  1D8E B;  4GL3 A;  3GLY A;  4LNV A;  3SFX B;  4EL8 A;  3DSW B;  3KSL B;  3QT3 A;  3GZK A;  4ZG8 A;  1TNU B;  1H3A A;  3PZ2 B;  4YCR A;  4V1S A;  4YDE B;  3HXD B;  4AYO A;  4YDO B;  3QXF A;  2D5J A;  1JCQ B;  3WIQ A;  1GA2 A;  1GXN A;  1O5M B;  4D4C A;  3P5R A;  1SQC A;  3HXF B;  4GTS B;  1F9D A;  3E37 B;  3SQC A;  1H54 A;  1H36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...