2FUZA

Ugl hexagonal crystal structure without glycine and dtt molecules
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
377
structure length
377
Chain Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Unsaturated glucuronyl hydrolase
publication title Substrate recognition by unsaturated glucuronyl hydrolase from Bacillus sp. GL1
pubmed doi rcsb
source organism Bacillus sp.
total genus 158
structure length 377
sequence length 377
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2006-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2fuzA00
4CE7A 3TF4A 4TF4A 3RRSA 2AHFA 2RGKA 1V7WA 4Q88A 4WU0A 3H2WA 1KS8A 4AYQA 3W7XA 3W7UA 3W5MA 3RX5A 2VN4A 3S4DA 3RX8A 1KREA 4JJJA 2DRRA 4KTPA 3RSYA 1G87A 1H14A 4AYOA 3E6UA 3WKIA 1NC5A 3S4AA 3VXDA 2JF4A 1WU6A 1GLMA 1V7VA 1AYXA 2F6DA 5DGRA 2DRQA 3ACSA 1G9GA 3X17A 2AFAA 3EZ8A 1V5CA 4WVCA 2QNOA 3PMMA 1FBWA 3A3VA 3QFZA 1JS4A 1IS9A 2GZ6A 4L0GA 1AGMA 3RX7A 3WIWA 1V7XA 1H13A 2AHGA 1WU5A 2RI8A 4ZG8A 2VN7A 2RI9A 2YIKA 1ULVA 1XWTA 4WVAA 2D5JA 3EQAA 2FV1A 3ON6A 5GW7A 3T33A 1UT9A 5GY3A 2EAEA 1WZZA 3QXFA 2Z07A 1KKTA 4KTRA 3W7SA 3WKGA 3S4BA 3W7WA 3K11A 1G9JA 3WKHA 2CQSA 1CLCA 1DL2A 4AYPA 1NXCA 1KFGA 3P2CA 1GA2A 3ANIA 1L1YA 1F9OA 2B4FA 3QRYA 3QG0A 5DGQA 4AYRA 3AFJA 2XFGA 4CJ1A 5CD2A 1UG9A 2FUZA 1V5DA 4XUVA 2FV0A 4EL8A 2JG0A 3QSPA 1LF9A 2CQTA 3QDEA 2DROA 1IA6A 1FO2A 3ANKA 3GT5A 3S4CA 1LF6A 1GAIA 2A8ZA 5M7IA 3QT3A 3QFYA 1G6IA 1K72A 1H12A 4ZH5A 1F9DA 1L2AA 3ANJA 1CEMA 3QT9A 4Q2BA 3H3KA 4CJ0A 4Z4LA 1XW2A 3WKFA 2P0VA 1FP3A 3QXQA 3WIRA 2EADA 1FCEA 2ZZRA 5E2JA 3WIQA 1FAEA 2EACA 5MEHA 1KRFA 2JJBA 1KSDA 1VD5A 3W7TA 1TF4A 3WC3A 1FMIA 3E73A 2NVPA 1HCUA 3H7LA 5M7YA 3QPFA 3W5NA 3GLYA 1FO3A 1GAHA 4TXTA 3ACTA 4WVBA 3RENA 4J5TA 3D3IA 2ZBLA 2FBAA 2D8LA 5CA3A 2WYNA 3GZKA 1IA7A 1KSCA 4DOEA 3CIHA 1XWQA 4Z4JA 2EABA 1WU4A 1X9DA 1H54A 2GH4A 5CZLA 1RQ5A 5KKBA 4DODA 1DOGA 4L6XA 3WUXA 2OKXA 1FBOA 1KWFA 3VW5A 4FUSA 2DRSA 3QWTA
chains in the Genus database with same CATH superfamily
2BRWA 1N95B 2RGKA 4Q88A 4WU0A 5C05A 4D4CA 3G4FA 3W7XA 5FO8B 2XWBB 3PZ4B 1OJOA 4KTPA 3RSYA 4YDOB 2JF4A 4LIXA 1WU6A 1V7VA 3M76A 4ZRQA 1HXGA 1AYXA 1D8EB 1HM2A 5IK6A 4C1SA 3A3VA 1JS4A 1IS9A 4KKJA 1S64B 1N7NA 1H13A 1TNZB 2AHGA 1UMPA 2RI8A 3S9VA 2VN7A 3E30B 2RI9A 4BOKA 2YIKA 1XWTA 1N21A 1X1IA 3C72B 3M75A 5GW7A 2FUQA 5FOBB 1H37A 1O1RB 1KKTA 1GXMA 3WKGA 3W7WA 1I8QA 2CQSA 1CLCA 3SDVA 4GTRB 1GA2A 2R2LB 1L1YA 5DGQA 2XFGA 2BRVX 1V5DA 2WINB 3CU7A 1H3CA 1TN8B 2DROA 5DHIA 1GXNA 2V8IA 2A8ZA 4MMIA 3QT3A 1K72A 2E24A 1F9DA 1N4SB 3Q79B 4GTPB 4D4DA 4CJ0A 1XW2A 5ILYA 2P0VA 1KZPB 4M76A 2SQCA 4MU9A 1S63B 3N0GA 1OJPA 4LNBB 2H6FB 5IK9A 1FMIA 2WIIB 5M7YA 3GLYA 1FO3A 4TXTA 3ACTA 1QQFA 3EUVB 3D3IA 2ZBLA 2FBAA 3P5PA 3PZ1B 2WYNA 3GZKA 1KSCA 4DOEA 1XWQA 2EABA 1X9DA 2GH4A 1RQ5A 1N4PB 2H6GB 5ILJA 1KWFA 2DRSA 1F1SA 4GTSB 1RWAA 3HXEB 2F0YB 5JMDA 2V3PA 4OK2A 4QT9A 3RX5A 5GZKA 3S4DA 1KREA 3E32B 2DRRA 1G87A 1H14A 4AYOA 3E6UA 1H3AA 2WDAA 3OEDA 3E80A 4OJZA 2F6DA 5DGRA 2DRQA 4OK4A 2IEJB 1RWHA 3X17A 1O1SB 4V1RA 1HM3A 3DSUB 1V5CA 5CZLA 4L0GA 3SFYB 3M72A 1TN7B 2A73B 1TNYB 4ZG8A 2WY8A 4FXKB 1QSJA 1ULVA 2Q1FA 4GL3A 3EQAA 2FV1A 3ON6A 3PYAA 5GY3A 3HXFB 5FO9B 1CB8A 1SA4B 1GSZA 3S4BA 5JPNB 1HMWA 3WKHA 2G0DA 3P2CA 1LOHA 3ANIA 3RJ3A 1F9OA 2B4FA 5CD2A 1QBQB 1OJMA 1X81B 2BEDB 2JG0A 1LF9A 1RWGA 3QDEA 3SAEA 1FO2A 3GT5A 3S4CA 1H12A 4YDEB 3ANJA 3QT9A 4D4AA 3E7JA 3M78A 1HMUA 3WKFA 1FP3A 3QXQA 2V8KA 2XWJB 2ZZRA 5E2JA 3WIQA 2EACA 5MEHA 1KRFA 3EU5B 1KSDA 1NL4B 3LZ9A 1X1HA 5DHKA 3QPFA 3HXBB 1F9GA 1N23A 1J0NA 1O6RA 1GAHA 1TNBB 4ONTA 4WVBA 3M73A 3D5RA 1LD7B 5CA3A 2B39A 3M01A 1JCRB 3OXUA 3CIHA 1WU4A 5KKBA 4L6XA 3WUXA 5EAUA 4FUSA 3SFXB 3QWTA 3VSNA 3M77A 1EGUA 3H2WA 4AYQA 3G6JB 2I07B 1N1ZA 3M74A 3M71A 4GAXA 3RX8A 2BBCA 4GTVB 3M7LA 3DSSB 3SDRA 3Q7FB 1HXAA 1HZFA 3EU8A 3KSLB 4NEIA 4WVCA 3QFZA 3WIWA 4FXGB 3RX7A 3PZ2B 4ZRPA 1V7XA 3VSMA 2BRPA 1HV6A 3HXCB 2ONHA 1O79A 4WVAA 4LNVA 2J5CA 2D5JA 2V8JA 2G02A 1O5MB 1WZZA 5ILDA 3QXFA 4FJQA 2Z07A 4D4BA 1JCQB 3DPYB 4LNGB 1HN0A 3E34B 3K11A 1G9JA 3SDUA 1N7QA 4AYPA 1KFGA 3SQCA 2WY7A 3QRYA 3QG0A 3AFJA 1C3DA 5EASA 1UG9A 4OZVA 3Q73B 4OZWA 1LXMA 1IA6A 1GXOA 2ZIRB 3ANKA 5M7IA 4GTQB 5IKAA 3M00A 5IKHA 3SDTA 1GHQA 2ZISB 3QFYA 4GTTB 3DRAB 4MMHA 4ZH5A 1CEMA 3N0FA 3A0OA 3H3KA 2PMVA 1N24A 4GTMB 1N4RB 2GOXA 3KSQB 1W3YA 1J0MA 3WIRA 1FCEA 1FAEA 1D8DB 1H35A 1DCEB 2JJBA 1VD5A 5IK0A 1FT1B 1TN6B 3W7TA 4YCRA 2NVPA 1X1JA 2E22A 3H7LA 2H6HB 5FO7B 4D94A 1N22A 1W6JA 3KLSA 1N7RA 4J5TA 5JMFA 1IA7A 1TNUB 3AFLA 4Z4JA 3E37B 1LXKA 1H54A 1R76A 3M02A 2X03A 4RNQA 1N4QB 3Q75B 3PYBA 3SDQA 3G4DA 3M7BA 3VW5A 1OJNA 4CE7A 3TF4A 4TF4A 3P5RA 3RRSA 2AHFA 1RWFA 1V7WA 2BB5A 1KS8A 5IL3A 3W7UA 3W5MA 5ILIA 1N7OA 2VN4A 1TNOB 4JJJA 5ILKA 1MZCB 1O1TB 3WKIA 1NC5A 3M7EA 4MBGB 3S4AA 3VXDA 1GLMA 4DI5A 1KZOB 1SA5B 1N7PA 3ACSA 1G9GA 1N9AB 5ILHA 2AFAA 3EZ8A 5ILZA 3WC3A 2QNOA 3DSTB 1FBWA 3PMMA 2GZ6A 2H6IB 1AGMA 1WU5A 3NFVA 3K7XA 1H3BA 4V1SA 2NOJA 3DSVB 2FUTA 3T33A 2BB6A 3Q7AB 2EAEA 5JPMB 1H39A 1SQCA 2V3NA 4FNVA 4GTOB 4KTRA 3W7SA 2XQWA 1DL2A 1HXCA 1NXCA 3M7CA 4ZH1A 5AGDA 4AYRA 4CJ1A 2FUZA 3Q78B 1H36A 4XUVA 2FV0A 4EL8A 3QSPA 2CQTA 2WCOA 1LTXB 2PN5A 1LF6A 3PZ3B 1GAIA 3NNBA 1G6IA 1JCSB 1L2AA 3KQ4A 4Q2BA 4F13A 4Z4LA 1RWCA 1O6QA 2EADA 4BOJA 2ONGA 1N94B 1TF4A 3E73A 4E1YA 1FT2B 1RW9A 1HCUA 3E33B 3DSXB 5IL8A 3W5NA 1O6HA 4L9PB 1LD8B 1HX9A 1C82A 1FPPB 3RENA 4EHMB 2D8LA 4F10A 5IM1A 4KKIA 3DSWB 3D5SA 5EATA 1N20A 1N1BA 1W6KA 1NI1B 3HXDB 1QAZA 4DODA 1DOGA 2OKXA 1FBOA 1UT9A
chains in the Genus database with same CATH topology
1N95B 2RGKA 4Q88A 4WU0A 4D4CA 3W7XA 5FO8B 2XWBB 3PZ4B 4KTPA 3RSYA 4YDOB 2JF4A 4LIXA 1WU6A 1V7VA 3M76A 4ZRQA 1AYXA 1D8EB 4C1SA 3A3VA 1JS4A 1IS9A 4KKJA 1S64B 1H13A 1TNZB 2AHGA 1UMPA 2RI8A 3S9VA 2VN7A 3E30B 2RI9A 4BOKA 2YIKA 1XWTA 3C72B 3M75A 5GW7A 5FOBB 1H37A 1O1RB 1KKTA 1GXMA 3WKGA 3W7WA 2CQSA 1CLCA 3SDVA 4GTRB 1GA2A 2R2LB 1L1YA 5DGQA 2XFGA 1V5DA 2WINB 3CU7A 1H3CA 1TN8B 2DROA 1GXNA 2V8IA 2A8ZA 3QT3A 1K72A 1F9DA 1N4SB 3Q79B 4GTPB 4D4DA 4CJ0A 1XW2A 2P0VA 1KZPB 4M76A 2SQCA 4MU9A 1S63B 4LNBB 2H6FB 1FMIA 2WIIB 5M7YA 3GLYA 1FO3A 4TXTA 3ACTA 1QQFA 3EUVB 3D3IA 2ZBLA 3P5PA 2FBAA 3PZ1B 2WYNA 3GZKA 1KSCA 4DOEA 1XWQA 2EABA 1X9DA 2GH4A 1RQ5A 1N4PB 2H6GB 1KWFA 2DRSA 4GTSB 3HXEB 2F0YB 2V3PA 4QT9A 3RX5A 5GZKA 3S4DA 1KREA 3E32B 2DRRA 1G87A 1H14A 4AYOA 3E6UA 1H3AA 3OEDA 2F6DA 5DGRA 2DRQA 2IEJB 3X17A 1O1SB 4V1RA 3DSUB 1V5CA 5CZLA 4L0GA 3SFYB 3M72A 1TN7B 2A73B 1TNYB 4ZG8A 2WY8A 4FXKB 1QSJA 1ULVA 4GL3A 3EQAA 2FV1A 3ON6A 3PYAA 5GY3A 3HXFB 5FO9B 1SA4B 1GSZA 3S4BA 5JPNB 3WKHA 2G0DA 3P2CA 3ANIA 3RJ3A 1F9OA 2B4FA 5CD2A 1QBQB 1X81B 2BEDB 2JG0A 1LF9A 3QDEA 3SAEA 1FO2A 3GT5A 3S4CA 1H12A 4YDEB 3ANJA 3QT9A 4D4AA 3M78A 3WKFA 1FP3A 3QXQA 2V8KA 2XWJB 2ZZRA 5E2JA 3WIQA 2EACA 5MEHA 1KRFA 3EU5B 1KSDA 1NL4B 3QPFA 3HXBB 1O6RA 1GAHA 1TNBB 4ONTA 4WVBA 3M73A 3D5RA 1LD7B 5CA3A 2B39A 3OXUA 1JCRB 3CIHA 1WU4A 5KKBA 4L6XA 3WUXA 4FUSA 3SFXB 3QWTA 3M77A 3H2WA 4AYQA 3G6JB 2I07B 3M74A 3M71A 3RX8A 2BBCA 4GTVB 3M7LA 3DSSB 3SDRA 3Q7FB 1HZFA 3EU8A 3KSLB 4WVCA 3QFZA 3WIWA 4FXGB 3RX7A 3PZ2B 4ZRPA 1V7XA 3HXCB 1O79A 4WVAA 4LNVA 2D5JA 2V8JA 2G02A 1O5MB 1WZZA 3QXFA 2Z07A 4D4BA 1JCQB 3DPYB 4LNGB 3E34B 3K11A 1G9JA 3SDUA 4AYPA 1KFGA 3SQCA 2WY7A 3QRYA 3QG0A 3AFJA 1C3DA 1UG9A 3Q73B 1IA6A 1GXOA 2ZIRB 3ANKA 5M7IA 4GTQB 3SDTA 1GHQA 2ZISB 3QFYA 4GTTB 3DRAB 4ZH5A 1CEMA 3H3KA 2PMVA 4GTMB 1N4RB 2GOXA 3KSQB 3WIRA 1FCEA 1FAEA 1D8DB 1H35A 1DCEB 2JJBA 1VD5A 3W7TA 1FT1B 1TN6B 4YCRA 2NVPA 3H7LA 2H6HB 5FO7B 4D94A 1W6JA 3KLSA 4J5TA 1IA7A 1TNUB 4Z4JA 3E37B 1H54A 1R76A 1N4QB 3Q75B 3PYBA 3SDQA 3M7BA 3VW5A 4CE7A 3TF4A 4TF4A 3P5RA 3RRSA 2AHFA 1V7WA 2BB5A 1KS8A 3W7UA 3W5MA 2VN4A 1TNOB 4JJJA 1MZCB 1O1TB 3WKIA 1NC5A 3M7EA 4MBGB 3S4AA 3VXDA 1GLMA 1KZOB 1SA5B 3ACSA 1G9GA 1N9AB 2AFAA 3EZ8A 3WC3A 2QNOA 3DSTB 1FBWA 3PMMA 2GZ6A 2H6IB 1AGMA 1WU5A 3K7XA 1H3BA 4V1SA 2NOJA 3DSVB 3T33A 2BB6A 3Q7AB 2EAEA 5JPMB 1H39A 1SQCA 2V3NA 4GTOB 4KTRA 3W7SA 2XQWA 1DL2A 3M7CA 1NXCA 4ZH1A 5AGDA 4AYRA 4CJ1A 2FUZA 3Q78B 1H36A 4XUVA 2FV0A 4EL8A 3QSPA 2CQTA 1LTXB 2PN5A 1LF6A 3PZ3B 1GAIA 1G6IA 1JCSB 1L2AA 3KQ4A 4Q2BA 4Z4LA 1O6QA 2EADA 4BOJA 1N94B 1TF4A 3E73A 1FT2B 1HCUA 3E33B 3DSXB 3W5NA 1O6HA 4L9PB 1LD8B 1FPPB 3RENA 4EHMB 2D8LA 4KKIA 3DSWB 3D5SA 1W6KA 1NI1B 3HXDB 4DODA 1DOGA 2OKXA 1FBOA 1UT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CE7 A;  3TF4 A;  4TF4 A;  3RRS A;  2AHF A;  2RGK A;  1V7W A;  4Q88 A;  4WU0 A;  3H2W A;  1KS8 A;  4AYQ A;  3W7X A;  3W7U A;  3W5M A;  3RX5 A;  2VN4 A;  3S4D A;  3RX8 A;  1KRE A;  4JJJ A;  2DRR A;  4KTP A;  3RSY A;  1G87 A;  1H14 A;  4AYO A;  3E6U A;  3WKI A;  1NC5 A;  3S4A A;  3VXD A;  2JF4 A;  1WU6 A;  1GLM A;  1V7V A;  1AYX A;  2F6D A;  5DGR A;  2DRQ A;  3ACS A;  1G9G A;  3X17 A;  2AFA A;  3EZ8 A;  1V5C A;  4WVC A;  2QNO A;  3PMM A;  1FBW A;  3A3V A;  3QFZ A;  1JS4 A;  1IS9 A;  2GZ6 A;  4L0G A;  1AGM A;  3RX7 A;  3WIW A;  1V7X A;  1H13 A;  2AHG A;  1WU5 A;  2RI8 A;  4ZG8 A;  2VN7 A;  2RI9 A;  2YIK A;  1ULV A;  1XWT A;  4WVA A;  2D5J A;  3EQA A;  2FV1 A;  3ON6 A;  5GW7 A;  3T33 A;  1UT9 A;  5GY3 A;  2EAE A;  1WZZ A;  3QXF A;  2Z07 A;  1KKT A;  4KTR A;  3W7S A;  3WKG A;  3S4B A;  3W7W A;  3K11 A;  1G9J A;  3WKH A;  2CQS A;  1CLC A;  1DL2 A;  4AYP A;  1NXC A;  1KFG A;  3P2C A;  1GA2 A;  3ANI A;  1L1Y A;  1F9O A;  2B4F A;  3QRY A;  3QG0 A;  5DGQ A;  4AYR A;  3AFJ A;  2XFG A;  4CJ1 A;  5CD2 A;  1UG9 A;  2FUZ A;  1V5D A;  4XUV A;  2FV0 A;  4EL8 A;  2JG0 A;  3QSP A;  1LF9 A;  2CQT A;  3QDE A;  2DRO A;  1IA6 A;  1FO2 A;  3ANK A;  3GT5 A;  3S4C A;  1LF6 A;  1GAI A;  2A8Z A;  5M7I A;  3QT3 A;  3QFY A;  1G6I A;  1K72 A;  1H12 A;  4ZH5 A;  1F9D A;  1L2A A;  3ANJ A;  1CEM A;  3QT9 A;  4Q2B A;  3H3K A;  4CJ0 A;  4Z4L A;  1XW2 A;  3WKF A;  2P0V A;  1FP3 A;  3QXQ A;  3WIR A;  2EAD A;  1FCE A;  2ZZR A;  5E2J A;  3WIQ A;  1FAE A;  2EAC A;  5MEH A;  1KRF A;  2JJB A;  1KSD A;  1VD5 A;  3W7T A;  1TF4 A;  3WC3 A;  1FMI A;  3E73 A;  2NVP A;  1HCU A;  3H7L A;  5M7Y A;  3QPF A;  3W5N A;  3GLY A;  1FO3 A;  1GAH A;  4TXT A;  3ACT A;  4WVB A;  3REN A;  4J5T A;  3D3I A;  2ZBL A;  2FBA A;  2D8L A;  5CA3 A;  2WYN A;  3GZK A;  1IA7 A;  1KSC A;  4DOE A;  3CIH A;  1XWQ A;  4Z4J A;  2EAB A;  1WU4 A;  1X9D A;  1H54 A;  2GH4 A;  5CZL A;  1RQ5 A;  5KKB A;  4DOD A;  1DOG A;  4L6X A;  3WUX A;  2OKX A;  1FBO A;  1KWF A;  3VW5 A;  4FUS A;  2DRS A;  3QWT A; 
#chains in the Genus database with same CATH topology
 2BRW A;  1N95 B;  2RGK A;  4Q88 A;  4WU0 A;  5C05 A;  4D4C A;  3G4F A;  3W7X A;  5FO8 B;  2XWB B;  3PZ4 B;  1OJO A;  4KTP A;  3RSY A;  4YDO B;  2JF4 A;  4LIX A;  1WU6 A;  1V7V A;  3M76 A;  4ZRQ A;  1HXG A;  1AYX A;  1D8E B;  1HM2 A;  5IK6 A;  4C1S A;  3A3V A;  1JS4 A;  1IS9 A;  4KKJ A;  1S64 B;  1N7N A;  1H13 A;  1TNZ B;  2AHG A;  1UMP A;  2RI8 A;  3S9V A;  2VN7 A;  3E30 B;  2RI9 A;  4BOK A;  2YIK A;  1XWT A;  1N21 A;  1X1I A;  3C72 B;  3M75 A;  5GW7 A;  2FUQ A;  5FOB B;  1H37 A;  1O1R B;  1KKT A;  1GXM A;  3WKG A;  3W7W A;  1I8Q A;  2CQS A;  1CLC A;  3SDV A;  4GTR B;  1GA2 A;  2R2L B;  1L1Y A;  5DGQ A;  2XFG A;  2BRV X;  1V5D A;  2WIN B;  3CU7 A;  1H3C A;  1TN8 B;  2DRO A;  5DHI A;  1GXN A;  2V8I A;  2A8Z A;  4MMI A;  3QT3 A;  1K72 A;  2E24 A;  1F9D A;  1N4S B;  3Q79 B;  4GTP B;  4D4D A;  4CJ0 A;  1XW2 A;  5ILY A;  2P0V A;  1KZP B;  4M76 A;  2SQC A;  4MU9 A;  1S63 B;  3N0G A;  1OJP A;  4LNB B;  2H6F B;  5IK9 A;  1FMI A;  2WII B;  5M7Y A;  3GLY A;  1FO3 A;  4TXT A;  3ACT A;  1QQF A;  3EUV B;  3D3I A;  2ZBL A;  2FBA A;  3P5P A;  3PZ1 B;  2WYN A;  3GZK A;  1KSC A;  4DOE A;  1XWQ A;  2EAB A;  1X9D A;  2GH4 A;  1RQ5 A;  1N4P B;  2H6G B;  5ILJ A;  1KWF A;  2DRS A;  1F1S A;  4GTS B;  1RWA A;  3HXE B;  2F0Y B;  5JMD A;  2V3P A;  4OK2 A;  4QT9 A;  3RX5 A;  5GZK A;  3S4D A;  1KRE A;  3E32 B;  2DRR A;  1G87 A;  1H14 A;  4AYO A;  3E6U A;  1H3A A;  2WDA A;  3OED A;  3E80 A;  4OJZ A;  2F6D A;  5DGR A;  2DRQ A;  4OK4 A;  2IEJ B;  1RWH A;  3X17 A;  1O1S B;  4V1R A;  1HM3 A;  3DSU B;  1V5C A;  5CZL A;  4L0G A;  3SFY B;  3M72 A;  1TN7 B;  2A73 B;  1TNY B;  4ZG8 A;  2WY8 A;  4FXK B;  1QSJ A;  1ULV A;  2Q1F A;  4GL3 A;  3EQA A;  2FV1 A;  3ON6 A;  3PYA A;  5GY3 A;  3HXF B;  5FO9 B;  1CB8 A;  1SA4 B;  1GSZ A;  3S4B A;  5JPN B;  1HMW A;  3WKH A;  2G0D A;  3P2C A;  1LOH A;  3ANI A;  3RJ3 A;  1F9O A;  2B4F A;  5CD2 A;  1QBQ B;  1OJM A;  1X81 B;  2BED B;  2JG0 A;  1LF9 A;  1RWG A;  3QDE A;  3SAE A;  1FO2 A;  3GT5 A;  3S4C A;  1H12 A;  4YDE B;  3ANJ A;  3QT9 A;  4D4A A;  3E7J A;  3M78 A;  1HMU A;  3WKF A;  1FP3 A;  3QXQ A;  2V8K A;  2XWJ B;  2ZZR A;  5E2J A;  3WIQ A;  2EAC A;  5MEH A;  1KRF A;  3EU5 B;  1KSD A;  1NL4 B;  3LZ9 A;  1X1H A;  5DHK A;  3QPF A;  3HXB B;  1F9G A;  1N23 A;  1J0N A;  1O6R A;  1GAH A;  1TNB B;  4ONT A;  4WVB A;  3M73 A;  3D5R A;  1LD7 B;  5CA3 A;  2B39 A;  3M01 A;  1JCR B;  3OXU A;  3CIH A;  1WU4 A;  5KKB A;  4L6X A;  3WUX A;  5EAU A;  4FUS A;  3SFX B;  3QWT A;  3VSN A;  3M77 A;  1EGU A;  3H2W A;  4AYQ A;  3G6J B;  2I07 B;  1N1Z A;  3M74 A;  3M71 A;  4GAX A;  3RX8 A;  2BBC A;  4GTV B;  3M7L A;  3DSS B;  3SDR A;  3Q7F B;  1HXA A;  1HZF A;  3EU8 A;  3KSL B;  4NEI A;  4WVC A;  3QFZ A;  3WIW A;  4FXG B;  3RX7 A;  3PZ2 B;  4ZRP A;  1V7X A;  3VSM A;  2BRP A;  1HV6 A;  3HXC B;  2ONH A;  1O79 A;  4WVA A;  4LNV A;  2J5C A;  2D5J A;  2V8J A;  2G02 A;  1O5M B;  1WZZ A;  5ILD A;  3QXF A;  4FJQ A;  2Z07 A;  4D4B A;  1JCQ B;  3DPY B;  4LNG B;  1HN0 A;  3E34 B;  3K11 A;  1G9J A;  3SDU A;  1N7Q A;  4AYP A;  1KFG A;  3SQC A;  2WY7 A;  3QRY A;  3QG0 A;  3AFJ A;  1C3D A;  5EAS A;  1UG9 A;  4OZV A;  3Q73 B;  4OZW A;  1LXM A;  1IA6 A;  1GXO A;  2ZIR B;  3ANK A;  5M7I A;  4GTQ B;  5IKA A;  3M00 A;  5IKH A;  3SDT A;  1GHQ A;  2ZIS B;  3QFY A;  4GTT B;  3DRA B;  4MMH A;  4ZH5 A;  1CEM A;  3N0F A;  3A0O A;  3H3K A;  2PMV A;  1N24 A;  4GTM B;  1N4R B;  2GOX A;  3KSQ B;  1W3Y A;  1J0M A;  3WIR A;  1FCE A;  1FAE A;  1D8D B;  1H35 A;  1DCE B;  2JJB A;  1VD5 A;  5IK0 A;  1FT1 B;  1TN6 B;  3W7T A;  4YCR A;  2NVP A;  1X1J A;  2E22 A;  3H7L A;  2H6H B;  5FO7 B;  4D94 A;  1N22 A;  1W6J A;  3KLS A;  1N7R A;  4J5T A;  5JMF A;  1IA7 A;  1TNU B;  3AFL A;  4Z4J A;  3E37 B;  1LXK A;  1H54 A;  1R76 A;  3M02 A;  2X03 A;  4RNQ A;  1N4Q B;  3Q75 B;  3PYB A;  3SDQ A;  3G4D A;  3M7B A;  3VW5 A;  1OJN A;  4CE7 A;  3TF4 A;  4TF4 A;  3P5R A;  3RRS A;  2AHF A;  1RWF A;  1V7W A;  2BB5 A;  1KS8 A;  5IL3 A;  3W7U A;  3W5M A;  5ILI A;  1N7O A;  2VN4 A;  1TNO B;  4JJJ A;  5ILK A;  1MZC B;  1O1T B;  3WKI A;  1NC5 A;  3M7E A;  4MBG B;  3S4A A;  3VXD A;  1GLM A;  4DI5 A;  1KZO B;  1SA5 B;  1N7P A;  3ACS A;  1G9G A;  1N9A B;  5ILH A;  2AFA A;  3EZ8 A;  5ILZ A;  3WC3 A;  2QNO A;  3DST B;  1FBW A;  3PMM A;  2GZ6 A;  2H6I B;  1AGM A;  1WU5 A;  3NFV A;  3K7X A;  1H3B A;  4V1S A;  2NOJ A;  3DSV B;  2FUT A;  3T33 A;  2BB6 A;  3Q7A B;  2EAE A;  5JPM B;  1H39 A;  1SQC A;  2V3N A;  4FNV A;  4GTO B;  4KTR A;  3W7S A;  2XQW A;  1DL2 A;  1HXC A;  1NXC A;  3M7C A;  4ZH1 A;  5AGD A;  4AYR A;  4CJ1 A;  2FUZ A;  3Q78 B;  1H36 A;  4XUV A;  2FV0 A;  4EL8 A;  3QSP A;  2CQT A;  2WCO A;  1LTX B;  2PN5 A;  1LF6 A;  3PZ3 B;  1GAI A;  3NNB A;  1G6I A;  1JCS B;  1L2A A;  3KQ4 A;  4Q2B A;  4F13 A;  4Z4L A;  1RWC A;  1O6Q A;  2EAD A;  4BOJ A;  2ONG A;  1N94 B;  1TF4 A;  3E73 A;  4E1Y A;  1FT2 B;  1RW9 A;  1HCU A;  3E33 B;  3DSX B;  5IL8 A;  3W5N A;  1O6H A;  4L9P B;  1LD8 B;  1HX9 A;  1C82 A;  1FPP B;  3REN A;  4EHM B;  2D8L A;  4F10 A;  5IM1 A;  4KKI A;  3DSW B;  3D5S A;  5EAT A;  1N20 A;  1N1B A;  1W6K A;  1NI1 B;  3HXD B;  1QAZ A;  4DOD A;  1DOG A;  2OKX A;  1FBO A;  1UT9 A; 
#chains in the Genus database with same CATH homology
 1N95 B;  2RGK A;  4Q88 A;  4WU0 A;  4D4C A;  3W7X A;  5FO8 B;  2XWB B;  3PZ4 B;  4KTP A;  3RSY A;  4YDO B;  2JF4 A;  4LIX A;  1WU6 A;  1V7V A;  3M76 A;  4ZRQ A;  1AYX A;  1D8E B;  4C1S A;  3A3V A;  1JS4 A;  1IS9 A;  4KKJ A;  1S64 B;  1H13 A;  1TNZ B;  2AHG A;  1UMP A;  2RI8 A;  3S9V A;  2VN7 A;  3E30 B;  2RI9 A;  4BOK A;  2YIK A;  1XWT A;  3C72 B;  3M75 A;  5GW7 A;  5FOB B;  1H37 A;  1O1R B;  1KKT A;  1GXM A;  3WKG A;  3W7W A;  2CQS A;  1CLC A;  3SDV A;  4GTR B;  1GA2 A;  2R2L B;  1L1Y A;  5DGQ A;  2XFG A;  1V5D A;  2WIN B;  3CU7 A;  1H3C A;  1TN8 B;  2DRO A;  1GXN A;  2V8I A;  2A8Z A;  3QT3 A;  1K72 A;  1F9D A;  1N4S B;  3Q79 B;  4GTP B;  4D4D A;  4CJ0 A;  1XW2 A;  2P0V A;  1KZP B;  4M76 A;  2SQC A;  4MU9 A;  1S63 B;  4LNB B;  2H6F B;  1FMI A;  2WII B;  5M7Y A;  3GLY A;  1FO3 A;  4TXT A;  3ACT A;  1QQF A;  3EUV B;  3D3I A;  2ZBL A;  3P5P A;  2FBA A;  3PZ1 B;  2WYN A;  3GZK A;  1KSC A;  4DOE A;  1XWQ A;  2EAB A;  1X9D A;  2GH4 A;  1RQ5 A;  1N4P B;  2H6G B;  1KWF A;  2DRS A;  4GTS B;  3HXE B;  2F0Y B;  2V3P A;  4QT9 A;  3RX5 A;  5GZK A;  3S4D A;  1KRE A;  3E32 B;  2DRR A;  1G87 A;  1H14 A;  4AYO A;  3E6U A;  1H3A A;  3OED A;  2F6D A;  5DGR A;  2DRQ A;  2IEJ B;  3X17 A;  1O1S B;  4V1R A;  3DSU B;  1V5C A;  5CZL A;  4L0G A;  3SFY B;  3M72 A;  1TN7 B;  2A73 B;  1TNY B;  4ZG8 A;  2WY8 A;  4FXK B;  1QSJ A;  1ULV A;  4GL3 A;  3EQA A;  2FV1 A;  3ON6 A;  3PYA A;  5GY3 A;  3HXF B;  5FO9 B;  1SA4 B;  1GSZ A;  3S4B A;  5JPN B;  3WKH A;  2G0D A;  3P2C A;  3ANI A;  3RJ3 A;  1F9O A;  2B4F A;  5CD2 A;  1QBQ B;  1X81 B;  2BED B;  2JG0 A;  1LF9 A;  3QDE A;  3SAE A;  1FO2 A;  3GT5 A;  3S4C A;  1H12 A;  4YDE B;  3ANJ A;  3QT9 A;  4D4A A;  3M78 A;  3WKF A;  1FP3 A;  3QXQ A;  2V8K A;  2XWJ B;  2ZZR A;  5E2J A;  3WIQ A;  2EAC A;  5MEH A;  1KRF A;  3EU5 B;  1KSD A;  1NL4 B;  3QPF A;  3HXB B;  1O6R A;  1GAH A;  1TNB B;  4ONT A;  4WVB A;  3M73 A;  3D5R A;  1LD7 B;  5CA3 A;  2B39 A;  3OXU A;  1JCR B;  3CIH A;  1WU4 A;  5KKB A;  4L6X A;  3WUX A;  4FUS A;  3SFX B;  3QWT A;  3M77 A;  3H2W A;  4AYQ A;  3G6J B;  2I07 B;  3M74 A;  3M71 A;  3RX8 A;  2BBC A;  4GTV B;  3M7L A;  3DSS B;  3SDR A;  3Q7F B;  1HZF A;  3EU8 A;  3KSL B;  4WVC A;  3QFZ A;  3WIW A;  4FXG B;  3RX7 A;  3PZ2 B;  4ZRP A;  1V7X A;  3HXC B;  1O79 A;  4WVA A;  4LNV A;  2D5J A;  2V8J A;  2G02 A;  1O5M B;  1WZZ A;  3QXF A;  2Z07 A;  4D4B A;  1JCQ B;  3DPY B;  4LNG B;  3E34 B;  3K11 A;  1G9J A;  3SDU A;  4AYP A;  1KFG A;  3SQC A;  2WY7 A;  3QRY A;  3QG0 A;  3AFJ A;  1C3D A;  1UG9 A;  3Q73 B;  1IA6 A;  1GXO A;  2ZIR B;  3ANK A;  5M7I A;  4GTQ B;  3SDT A;  1GHQ A;  2ZIS B;  3QFY A;  4GTT B;  3DRA B;  4ZH5 A;  1CEM A;  3H3K A;  2PMV A;  4GTM B;  1N4R B;  2GOX A;  3KSQ B;  3WIR A;  1FCE A;  1FAE A;  1D8D B;  1H35 A;  1DCE B;  2JJB A;  1VD5 A;  3W7T A;  1FT1 B;  1TN6 B;  4YCR A;  2NVP A;  3H7L A;  2H6H B;  5FO7 B;  4D94 A;  1W6J A;  3KLS A;  4J5T A;  1IA7 A;  1TNU B;  4Z4J A;  3E37 B;  1H54 A;  1R76 A;  1N4Q B;  3Q75 B;  3PYB A;  3SDQ A;  3M7B A;  3VW5 A;  4CE7 A;  3TF4 A;  4TF4 A;  3P5R A;  3RRS A;  2AHF A;  1V7W A;  2BB5 A;  1KS8 A;  3W7U A;  3W5M A;  2VN4 A;  1TNO B;  4JJJ A;  1MZC B;  1O1T B;  3WKI A;  1NC5 A;  3M7E A;  4MBG B;  3S4A A;  3VXD A;  1GLM A;  1KZO B;  1SA5 B;  3ACS A;  1G9G A;  1N9A B;  2AFA A;  3EZ8 A;  3WC3 A;  2QNO A;  3DST B;  1FBW A;  3PMM A;  2GZ6 A;  2H6I B;  1AGM A;  1WU5 A;  3K7X A;  1H3B A;  4V1S A;  2NOJ A;  3DSV B;  3T33 A;  2BB6 A;  3Q7A B;  2EAE A;  5JPM B;  1H39 A;  1SQC A;  2V3N A;  4GTO B;  4KTR A;  3W7S A;  2XQW A;  1DL2 A;  3M7C A;  1NXC A;  4ZH1 A;  5AGD A;  4AYR A;  4CJ1 A;  2FUZ A;  3Q78 B;  1H36 A;  4XUV A;  2FV0 A;  4EL8 A;  3QSP A;  2CQT A;  1LTX B;  2PN5 A;  1LF6 A;  3PZ3 B;  1GAI A;  1G6I A;  1JCS B;  1L2A A;  3KQ4 A;  4Q2B A;  4Z4L A;  1O6Q A;  2EAD A;  4BOJ A;  1N94 B;  1TF4 A;  3E73 A;  1FT2 B;  1HCU A;  3E33 B;  3DSX B;  3W5N A;  1O6H A;  4L9P B;  1LD8 B;  1FPP B;  3REN A;  4EHM B;  2D8L A;  4KKI A;  3DSW B;  3D5S A;  1W6K A;  1NI1 B;  3HXD B;  4DOD A;  1DOG A;  2OKX A;  1FBO A;  1UT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...