2FUZA

Ugl hexagonal crystal structure without glycine and dtt molecules
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
377
structure length
377
Chain Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Unsaturated glucuronyl hydrolase
publication title Substrate recognition by unsaturated glucuronyl hydrolase from Bacillus sp. GL1
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 158
structure length 377
sequence length 377
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2006-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2fuzA00
3WC3A 3QPFA 1WU6A 4JJJA 3WIRA 3W7TA 2P0VA 3H3KA 4J5TA 2JG0A 4Q2BA 4WVBA 3RX7A 1G9GA 1G6IA 2EACA 4AYRA 4TF4A 2JF4A 3AFJA 1H13A 1IA7A 1KFGA 3S4AA 1NXCA 3VXDA 3QT3A 4ZG8A 3VW5A 5DGQA 1WU4A 2WYNA 5E2JA 2JJBA 1XWTA 3S4BA 3K11A 1GAHA 2DROA 4L0GA 3W5MA 4DODA 3TF4A 5GY3A 1IA6A 3WKFA 3X17A 4Z4LA 1FO3A 1ULVA 2DRRA 3A3VA 4ZH5A 3GZKA 3W7XA 1H14A 5KKBA 5M7IA 3W7WA 2VN4A 3WKIA 1XWQA 3EZ8A 1GAIA 2DRQA 1CLCA 1DOGA 2FV0A 1NC5A 2XFGA 3W7UA 4CJ1A 3P2CA 1KSDA 5CA3A 1GA2A 1LF9A 1IS9A 3ANJA 1KSCA 3QXFA 1V7VA 2OKXA 1H54A 4TXTA 1UT9A 3RSYA 3ANIA 4CJ0A 4Q88A 3WKHA 2NVPA 1FAEA 3WUXA 3QXQA 1KREA 2D5JA 2D8LA 2F6DA 4L6XA 3QSPA 3EQAA 4WVCA 2EABA 4CE7A 1AYXA 1DL2A 3GLYA 3QWTA 2FV1A 3ACTA 4KTRA 4AYQA 3QT9A 1H12A 3ACSA 1XW2A 5GW7A 3H2WA 5DGRA 3RX8A 4FUSA 1FBWA 1AGMA 2EADA 1WU5A 2CQTA 4AYOA 1HCUA 1RQ5A 2CQSA 1FCEA 1JS4A 2FUZA 1VD5A 5CZLA 2QNOA 2DRSA 2YIKA 3PMMA 4KTPA 1L1YA 1KRFA 3S4CA 3WIQA 4XUVA 2AFAA 2EAEA 1FBOA 4DOEA 4EL8A 3GT5A 1K72A 1WZZA 1G9JA 5CD2A 1FMIA 1F9OA 1FP3A 3E73A 3QG0A 1V7WA 1KKTA 4AYPA 1V5DA 2GH4A 3ANKA 1FO2A 1V5CA 3W7SA 2AHGA 1KS8A 2GZ6A 2VN7A 3E6UA 1V7XA 3CIHA 3QFYA 3QFZA 4WU0A 3RRSA 5MEHA 2A8ZA 5M7YA 3WKGA 3W5NA 3RX5A 1CEMA 2RI8A 2Z07A 1L2AA 1KWFA 3H7LA 2RGKA 2ZBLA 3QDEA 1TF4A 2RI9A 4Z4JA 2ZZRA 3ON6A 1UG9A 1F9DA 4WVAA 3T33A 1G87A 1GLMA 1X9DA 2AHFA 3QRYA 3RENA 1LF6A 3WIWA 2FBAA 2B4FA 3D3IA 3S4DA
chains in the Genus database with same CATH superfamily
3QPFA 1OJPA 4E1YA 3G4DA 3M77A 3W7TA 5DHIA 2EACA 2JF4A 4MMHA 1H13A 1S63B 1S64B 3QT3A 1LTXB 5DGQA 1WU4A 1HM3A 1N23A 2JJBA 5FO7B 3M01A 1N9AB 4MU9A 1GAHA 1KZOB 3Q73B 3SFYB 5FO9B 3W5MA 3X17A 1IA6A 4OZWA 1EGUA 1N1BA 1TNYB 1H14A 3PZ1B 1CLCA 2XFGA 2FV0A 3NFVA 1QQFA 3N0GA 1H3BA 3P5RA 1NL4B 1GA2A 1IS9A 3SAEA 1J0NA 1LXMA 1N4RB 4ZRPA 3G4FA 3ANIA 2FUTA 4CJ0A 1LXKA 1FAEA 4GTPB 3WUXA 1FT2B 4L6XA 1AYXA 3GLYA 2FV1A 3QT9A 1XW2A 1C82A 4FUSA 3KLSA 4M76A 3Q79B 4D94A 2PN5A 2V3PA 3NNBA 2EADA 1D8EB 5GZKA 3E33B 1KRFA 3S4CA 3C72B 2AFAA 4MMIA 3LZ9A 1SA4B 1G9JA 4DI5A 1LD8B 5IL3A 3M00A 1N7RA 4L9PB 3M7BA 1V5DA 3E32B 3EU5B 4LNBB 1V5CA 3W7SA 1KS8A 1SA5B 2XWBB 3WKGA 1RWFA 1H36A 2RI8A 3E34B 1KWFA 3H7LA 2RGKA 2ZZRA 2BRWA 3Q7FB 4OJZA 3T33A 1C3DA 2AHFA 2WY7A 3DSXB 2EAEA 1O5MB 3SDTA 3E7JA 3WC3A 1RWCA 3M7LA 1WU6A 2WINB 3M76A 3SDQA 1GSZA 3WIRA 1LD7B 1GXNA 2P0VA 3H3KA 2IEJB 4J5TA 4Q2BA 2BRPA 3RX7A 1G6IA 4AYRA 1NI1B 2ONGA 3KSLB 1JCRB 1KFGA 5IKAA 2V8KA 1J0MA 4ZG8A 1HXGA 1W6JA 5JPNB 3VW5A 4KKIA 4D4AA 1HM2A 5E2JA 1N20A 1KZPB 3DSSB 1N7QA 3Q7AB 5ILJA 3DSUB 4OZVA 4EHMB 2J5CA 3TF4A 2XWJB 4Z4LA 5JMDA 4LNGB 1DCEB 4FNVA 1ULVA 2DRRA 1N1ZA 3A3VA 3GZKA 3W7XA 5KKBA 5M7IA 3W7WA 2VN4A 1OJMA 3EZ8A 1NC5A 4CJ1A 2WCOA 1KSDA 2H6HB 2R2LB 5CA3A 1LF9A 2H6IB 2V3NA 3M02A 2BEDB 1UT9A 2V8IA 3PZ2B 4F13A 4V1RA 1GHQA 4Q88A 4KKJA 1OJOA 1QBQB 3WKHA 1H3AA 1QSJA 2D8LA 4CE7A 3W5NA 3EQAA 4OK2A 4KTRA 1H12A 2GOXA 1RWGA 3ACSA 5IL8A 5GW7A 3H2WA 1FBWA 4QT9A 1AGMA 1WU5A 1HXCA 1FCEA 1VD5A 4D4DA 1N7OA 2QNOA 2H6FB 5EATA 2V8JA 1L1YA 4GTRB 1HX9A 1TN8B 3KQ4A 3GT5A 3P5PA 4D4CA 2NOJA 4FXGB 5CD2A 3HXFB 1F9OA 1FPPB 1JCQB 2ZIRB 3RJ3A 2AHGA 2GZ6A 3QFYA 4LNVA 5MEHA 1H39A 1HMUA 5IKHA 5ILIA 5M7YA 4V1SA 5ILKA 2WDAA 5EASA 3QDEA 4ZRQA 1TF4A 2BRVX 2PMVA 3ON6A 1UG9A 1F9DA 2XQWA 4WVAA 1G87A 1GLMA 3RENA 5IM1A 2FBAA 4GTQB 4NEIA 1FT1B 2JG0A 3E30B 1G9GA 3DPYB 4TF4A 3AFJA 1NXCA 3VXDA 3PYBA 4C1SA 1R76A 1N22A 4FJQA 3M7CA 4RNQA 1GXMA 3S4BA 3K11A 2G02A 2A73B 2DROA 4L0GA 1F1SA 3WKFA 4GTTB 5ILHA 1FO3A 1GXOA 1N24A 4ZH5A 2ZISB 1XWQA 1GAIA 2F0YB 3W7UA 3M7EA 3P2CA 1H37A 5JPMB 3DSWB 1HXAA 3PYAA 1HMWA 4GAXA 1V7VA 2OKXA 3SDRA 5FO8B 3E80A 1HV6A 4YCRA 3M72A 3E37B 3HXBB 3SDVA 1O1RB 1O6QA 2D5JA 1TNUB 3DSVB 2WIIB 4AYQA 3ACTA 2E22A 5C05A 5IK0A 5IK9A 3A0OA 2CQSA 3SDUA 2FUZA 5CZLA 1MZCB 2DRSA 3PMMA 4KTPA 5DHKA 3DSTB 3WIQA 1OJNA 2H6GB 1X1IA 1F9GA 4OK4A 1SQCA 1RWAA 3OEDA 4EL8A 3DRAB 1WZZA 1HZFA 2BBCA 1FMIA 1FP3A 3E73A 1V7WA 3G6JB 3S9VA 4AYPA 1FO2A 2VN7A 3E6UA 2BB5A 2A8ZA 3D5SA 3RX5A 2Z07A 2ONHA 2ZBLA 3Q75B 4BOKA 2FUQA 5AGDA 1N4PB 4AYOA 1RWHA 2B4FA 3D3IA 4WVBA 3S4DA 1O6HA 4JJJA 3N0FA 3HXCB 1N4QB 3D5RA 1QAZA 1IA7A 3EUVB 3S4AA 5ILZA 5ILYA 4MBGB 2B39A 2WYNA 1XWTA 1N21A 3PZ4B 4GL3A 1X1JA 1X1HA 1TNBB 3M78A 4DODA 3EU8A 5GY3A 3VSNA 4YDOB 3WKIA 2DRQA 1O6RA 1DOGA 1CB8A 3Q78B 1HN0A 1O1SB 1W6KA 3M75A 5JMFA 3ANJA 1O1TB 1KSCA 3QXFA 2BB6A 3OXUA 4GTVB 1H54A 1TNOB 4TXTA 3SQCA 4GTMB 3RSYA 3AFLA 1N7PA 1X81B 3M74A 1H35A 1UMPA 2G0DA 4ONTA 2Q1FA 2NVPA 2SQCA 3QXQA 1KREA 2F6DA 4WVCA 3QSPA 5ILDA 2EABA 1TN6B 4BOJA 1DL2A 5FOBB 3QWTA 1TNZB 3PZ3B 1LOHA 4D4BA 4ZH1A 5DGRA 3RX8A 5EAUA 2I07B 2CQTA 3K7XA 1HCUA 1RQ5A 1JS4A 4GTOB 2YIKA 4GTSB 1D8DB 3VSMA 4FXKB 1N95B 2X03A 4XUVA 1W3YA 2WY8A 3HXDB 1FBOA 4LIXA 4DOEA 1K72A 5IK6A 3QG0A 1N7NA 1KKTA 1I8QA 1RW9A 2E24A 2GH4A 3ANKA 3M73A 3QFZA 1V7XA 3CIHA 4WU0A 4YDEB 1N94B 3RRSA 1JCSB 1O79A 1CEMA 1L2AA 4F10A 3KSQB 1N4SB 2RI9A 4Z4JA 3HXEB 1LF6A 1H3CA 1X9DA 3CU7A 3QRYA 3SFXB 3WIWA 3M71A 1TN7B
chains in the Genus database with same CATH topology
3QPFA 3M77A 3W7TA 2EACA 2JF4A 1H13A 1S63B 1S64B 3QT3A 1LTXB 5DGQA 1WU4A 2JJBA 5FO7B 1N9AB 4MU9A 1GAHA 1KZOB 3Q73B 3SFYB 5FO9B 3W5MA 3X17A 1IA6A 1TNYB 1H14A 3PZ1B 1CLCA 2XFGA 2FV0A 1QQFA 1H3BA 3P5RA 1NL4B 1GA2A 1IS9A 3SAEA 1N4RB 4ZRPA 3ANIA 4CJ0A 1FAEA 4GTPB 3WUXA 1FT2B 4L6XA 1AYXA 3GLYA 2FV1A 3QT9A 1XW2A 4FUSA 3KLSA 4M76A 3Q79B 4D94A 2PN5A 2V3PA 2EADA 1D8EB 5GZKA 3E33B 1KRFA 3S4CA 3C72B 2AFAA 1SA4B 1G9JA 1LD8B 4L9PB 3M7BA 1V5DA 3E32B 3EU5B 4LNBB 1V5CA 3W7SA 1KS8A 1SA5B 2XWBB 3WKGA 1H36A 2RI8A 3E34B 1KWFA 3H7LA 2RGKA 2ZZRA 3Q7FB 3T33A 1C3DA 2AHFA 2WY7A 3DSXB 2EAEA 1O5MB 3SDTA 3WC3A 3M7LA 1WU6A 2WINB 3M76A 3SDQA 1GSZA 3WIRA 1LD7B 1GXNA 2P0VA 3H3KA 2IEJB 4J5TA 4Q2BA 3RX7A 1G6IA 4AYRA 1NI1B 3KSLB 1JCRB 1KFGA 2V8KA 4ZG8A 1W6JA 5JPNB 3VW5A 4KKIA 4D4AA 5E2JA 1KZPB 3DSSB 3Q7AB 3DSUB 4EHMB 3TF4A 2XWJB 4Z4LA 4LNGB 1DCEB 1ULVA 2DRRA 3A3VA 3GZKA 3W7XA 5KKBA 5M7IA 3W7WA 2VN4A 3EZ8A 1NC5A 4CJ1A 1KSDA 2H6HB 2R2LB 5CA3A 1LF9A 2H6IB 2V3NA 2BEDB 1UT9A 2V8IA 3PZ2B 4V1RA 1GHQA 4Q88A 4KKJA 1QBQB 3WKHA 1H3AA 1QSJA 2D8LA 4CE7A 3W5NA 3EQAA 4KTRA 1H12A 2GOXA 3ACSA 5GW7A 3H2WA 1FBWA 4QT9A 1AGMA 1WU5A 1FCEA 1VD5A 4D4DA 2QNOA 2H6FB 2V8JA 1L1YA 4GTRB 1TN8B 3KQ4A 3GT5A 3P5PA 4D4CA 2NOJA 4FXGB 5CD2A 3HXFB 1F9OA 1FPPB 1JCQB 2ZIRB 3RJ3A 2AHGA 2GZ6A 3QFYA 4LNVA 5MEHA 1H39A 5M7YA 4V1SA 3QDEA 4ZRQA 1TF4A 2PMVA 3ON6A 1UG9A 1F9DA 2XQWA 4WVAA 1G87A 1GLMA 3RENA 2FBAA 4GTQB 1FT1B 2JG0A 3E30B 1G9GA 3DPYB 4TF4A 3AFJA 1NXCA 3VXDA 3PYBA 4C1SA 1R76A 3M7CA 1GXMA 3S4BA 3K11A 2G02A 2A73B 2DROA 4L0GA 3WKFA 4GTTB 1FO3A 1GXOA 4ZH5A 2ZISB 1XWQA 1GAIA 2F0YB 3W7UA 3M7EA 3P2CA 1H37A 5JPMB 3DSWB 3PYAA 1V7VA 2OKXA 3SDRA 5FO8B 4YCRA 3M72A 3E37B 3HXBB 3SDVA 1O1RB 1O6QA 2D5JA 1TNUB 3DSVB 2WIIB 4AYQA 3ACTA 2CQSA 3SDUA 2FUZA 5CZLA 1MZCB 2DRSA 3PMMA 4KTPA 3DSTB 3WIQA 2H6GB 1SQCA 4EL8A 3OEDA 3DRAB 1WZZA 1HZFA 2BBCA 1FMIA 1FP3A 3E73A 1V7WA 3G6JB 3S9VA 4AYPA 1FO2A 2VN7A 3E6UA 2BB5A 2A8ZA 3D5SA 3RX5A 2Z07A 2ZBLA 3Q75B 4BOKA 5AGDA 1N4PB 4AYOA 2B4FA 3D3IA 4WVBA 3S4DA 1O6HA 4JJJA 3HXCB 1N4QB 3D5RA 1IA7A 3EUVB 3S4AA 4MBGB 2B39A 2WYNA 1XWTA 3PZ4B 4GL3A 1TNBB 3M78A 4DODA 3EU8A 5GY3A 4YDOB 3WKIA 2DRQA 1O6RA 1DOGA 3Q78B 1O1SB 1W6KA 3M75A 3ANJA 1O1TB 1KSCA 3QXFA 2BB6A 3OXUA 4GTVB 1H54A 1TNOB 4TXTA 3SQCA 4GTMB 3RSYA 1X81B 3M74A 1H35A 1UMPA 2G0DA 4ONTA 2NVPA 2SQCA 3QXQA 1KREA 2F6DA 4WVCA 3QSPA 2EABA 1TN6B 4BOJA 1DL2A 5FOBB 3QWTA 1TNZB 3PZ3B 4D4BA 4ZH1A 5DGRA 3RX8A 2I07B 2CQTA 3K7XA 1HCUA 1RQ5A 1JS4A 4GTOB 2YIKA 4GTSB 1D8DB 4FXKB 1N95B 4XUVA 2WY8A 3HXDB 1FBOA 4LIXA 4DOEA 1K72A 3QG0A 1KKTA 2GH4A 3ANKA 3M73A 3QFZA 1V7XA 3CIHA 4WU0A 4YDEB 1N94B 3RRSA 1JCSB 1O79A 1CEMA 1L2AA 3KSQB 1N4SB 2RI9A 4Z4JA 3HXEB 1LF6A 1H3CA 1X9DA 3CU7A 3QRYA 3SFXB 3WIWA 3M71A 1TN7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WC3 A;  3QPF A;  1WU6 A;  4JJJ A;  3WIR A;  3W7T A;  2P0V A;  3H3K A;  4J5T A;  2JG0 A;  4Q2B A;  4WVB A;  3RX7 A;  1G9G A;  1G6I A;  2EAC A;  4AYR A;  4TF4 A;  2JF4 A;  3AFJ A;  1H13 A;  1IA7 A;  1KFG A;  3S4A A;  1NXC A;  3VXD A;  3QT3 A;  4ZG8 A;  3VW5 A;  5DGQ A;  1WU4 A;  2WYN A;  5E2J A;  2JJB A;  1XWT A;  3S4B A;  3K11 A;  1GAH A;  2DRO A;  4L0G A;  3W5M A;  4DOD A;  3TF4 A;  5GY3 A;  1IA6 A;  3WKF A;  3X17 A;  4Z4L A;  1FO3 A;  1ULV A;  2DRR A;  3A3V A;  4ZH5 A;  3GZK A;  3W7X A;  1H14 A;  5KKB A;  5M7I A;  3W7W A;  2VN4 A;  3WKI A;  1XWQ A;  3EZ8 A;  1GAI A;  2DRQ A;  1CLC A;  1DOG A;  2FV0 A;  1NC5 A;  2XFG A;  3W7U A;  4CJ1 A;  3P2C A;  1KSD A;  5CA3 A;  1GA2 A;  1LF9 A;  1IS9 A;  3ANJ A;  1KSC A;  3QXF A;  1V7V A;  2OKX A;  1H54 A;  4TXT A;  1UT9 A;  3RSY A;  3ANI A;  4CJ0 A;  4Q88 A;  3WKH A;  2NVP A;  1FAE A;  3WUX A;  3QXQ A;  1KRE A;  2D5J A;  2D8L A;  2F6D A;  4L6X A;  3QSP A;  3EQA A;  4WVC A;  2EAB A;  4CE7 A;  1AYX A;  1DL2 A;  3GLY A;  3QWT A;  2FV1 A;  3ACT A;  4KTR A;  4AYQ A;  3QT9 A;  1H12 A;  3ACS A;  1XW2 A;  5GW7 A;  3H2W A;  5DGR A;  3RX8 A;  4FUS A;  1FBW A;  1AGM A;  2EAD A;  1WU5 A;  2CQT A;  4AYO A;  1HCU A;  1RQ5 A;  2CQS A;  1FCE A;  1JS4 A;  2FUZ A;  1VD5 A;  5CZL A;  2QNO A;  2DRS A;  2YIK A;  3PMM A;  4KTP A;  1L1Y A;  1KRF A;  3S4C A;  3WIQ A;  4XUV A;  2AFA A;  2EAE A;  1FBO A;  4DOE A;  4EL8 A;  3GT5 A;  1K72 A;  1WZZ A;  1G9J A;  5CD2 A;  1FMI A;  1F9O A;  1FP3 A;  3E73 A;  3QG0 A;  1V7W A;  1KKT A;  4AYP A;  1V5D A;  2GH4 A;  3ANK A;  1FO2 A;  1V5C A;  3W7S A;  2AHG A;  1KS8 A;  2GZ6 A;  2VN7 A;  3E6U A;  1V7X A;  3CIH A;  3QFY A;  3QFZ A;  4WU0 A;  3RRS A;  5MEH A;  2A8Z A;  5M7Y A;  3WKG A;  3W5N A;  3RX5 A;  1CEM A;  2RI8 A;  2Z07 A;  1L2A A;  1KWF A;  3H7L A;  2RGK A;  2ZBL A;  3QDE A;  1TF4 A;  2RI9 A;  4Z4J A;  2ZZR A;  3ON6 A;  1UG9 A;  1F9D A;  4WVA A;  3T33 A;  1G87 A;  1GLM A;  1X9D A;  2AHF A;  3QRY A;  3REN A;  1LF6 A;  3WIW A;  2FBA A;  2B4F A;  3D3I A;  3S4D A; 
#chains in the Genus database with same CATH topology
 3QPF A;  1OJP A;  4E1Y A;  3G4D A;  3M77 A;  3W7T A;  5DHI A;  2EAC A;  2JF4 A;  4MMH A;  1H13 A;  1S63 B;  1S64 B;  3QT3 A;  1LTX B;  5DGQ A;  1WU4 A;  1HM3 A;  1N23 A;  2JJB A;  5FO7 B;  3M01 A;  1N9A B;  4MU9 A;  1GAH A;  1KZO B;  3Q73 B;  3SFY B;  5FO9 B;  3W5M A;  3X17 A;  1IA6 A;  4OZW A;  1EGU A;  1N1B A;  1TNY B;  1H14 A;  3PZ1 B;  1CLC A;  2XFG A;  2FV0 A;  3NFV A;  1QQF A;  3N0G A;  1H3B A;  3P5R A;  1NL4 B;  1GA2 A;  1IS9 A;  3SAE A;  1J0N A;  1LXM A;  1N4R B;  4ZRP A;  3G4F A;  3ANI A;  2FUT A;  4CJ0 A;  1LXK A;  1FAE A;  4GTP B;  3WUX A;  1FT2 B;  4L6X A;  1AYX A;  3GLY A;  2FV1 A;  3QT9 A;  1XW2 A;  1C82 A;  4FUS A;  3KLS A;  4M76 A;  3Q79 B;  4D94 A;  2PN5 A;  2V3P A;  3NNB A;  2EAD A;  1D8E B;  5GZK A;  3E33 B;  1KRF A;  3S4C A;  3C72 B;  2AFA A;  4MMI A;  3LZ9 A;  1SA4 B;  1G9J A;  4DI5 A;  1LD8 B;  5IL3 A;  3M00 A;  1N7R A;  4L9P B;  3M7B A;  1V5D A;  3E32 B;  3EU5 B;  4LNB B;  1V5C A;  3W7S A;  1KS8 A;  1SA5 B;  2XWB B;  3WKG A;  1RWF A;  1H36 A;  2RI8 A;  3E34 B;  1KWF A;  3H7L A;  2RGK A;  2ZZR A;  2BRW A;  3Q7F B;  4OJZ A;  3T33 A;  1C3D A;  2AHF A;  2WY7 A;  3DSX B;  2EAE A;  1O5M B;  3SDT A;  3E7J A;  3WC3 A;  1RWC A;  3M7L A;  1WU6 A;  2WIN B;  3M76 A;  3SDQ A;  1GSZ A;  3WIR A;  1LD7 B;  1GXN A;  2P0V A;  3H3K A;  2IEJ B;  4J5T A;  4Q2B A;  2BRP A;  3RX7 A;  1G6I A;  4AYR A;  1NI1 B;  2ONG A;  3KSL B;  1JCR B;  1KFG A;  5IKA A;  2V8K A;  1J0M A;  4ZG8 A;  1HXG A;  1W6J A;  5JPN B;  3VW5 A;  4KKI A;  4D4A A;  1HM2 A;  5E2J A;  1N20 A;  1KZP B;  3DSS B;  1N7Q A;  3Q7A B;  5ILJ A;  3DSU B;  4OZV A;  4EHM B;  2J5C A;  3TF4 A;  2XWJ B;  4Z4L A;  5JMD A;  4LNG B;  1DCE B;  4FNV A;  1ULV A;  2DRR A;  1N1Z A;  3A3V A;  3GZK A;  3W7X A;  5KKB A;  5M7I A;  3W7W A;  2VN4 A;  1OJM A;  3EZ8 A;  1NC5 A;  4CJ1 A;  2WCO A;  1KSD A;  2H6H B;  2R2L B;  5CA3 A;  1LF9 A;  2H6I B;  2V3N A;  3M02 A;  2BED B;  1UT9 A;  2V8I A;  3PZ2 B;  4F13 A;  4V1R A;  1GHQ A;  4Q88 A;  4KKJ A;  1OJO A;  1QBQ B;  3WKH A;  1H3A A;  1QSJ A;  2D8L A;  4CE7 A;  3W5N A;  3EQA A;  4OK2 A;  4KTR A;  1H12 A;  2GOX A;  1RWG A;  3ACS A;  5IL8 A;  5GW7 A;  3H2W A;  1FBW A;  4QT9 A;  1AGM A;  1WU5 A;  1HXC A;  1FCE A;  1VD5 A;  4D4D A;  1N7O A;  2QNO A;  2H6F B;  5EAT A;  2V8J A;  1L1Y A;  4GTR B;  1HX9 A;  1TN8 B;  3KQ4 A;  3GT5 A;  3P5P A;  4D4C A;  2NOJ A;  4FXG B;  5CD2 A;  3HXF B;  1F9O A;  1FPP B;  1JCQ B;  2ZIR B;  3RJ3 A;  2AHG A;  2GZ6 A;  3QFY A;  4LNV A;  5MEH A;  1H39 A;  1HMU A;  5IKH A;  5ILI A;  5M7Y A;  4V1S A;  5ILK A;  2WDA A;  5EAS A;  3QDE A;  4ZRQ A;  1TF4 A;  2BRV X;  2PMV A;  3ON6 A;  1UG9 A;  1F9D A;  2XQW A;  4WVA A;  1G87 A;  1GLM A;  3REN A;  5IM1 A;  2FBA A;  4GTQ B;  4NEI A;  1FT1 B;  2JG0 A;  3E30 B;  1G9G A;  3DPY B;  4TF4 A;  3AFJ A;  1NXC A;  3VXD A;  3PYB A;  4C1S A;  1R76 A;  1N22 A;  4FJQ A;  3M7C A;  4RNQ A;  1GXM A;  3S4B A;  3K11 A;  2G02 A;  2A73 B;  2DRO A;  4L0G A;  1F1S A;  3WKF A;  4GTT B;  5ILH A;  1FO3 A;  1GXO A;  1N24 A;  4ZH5 A;  2ZIS B;  1XWQ A;  1GAI A;  2F0Y B;  3W7U A;  3M7E A;  3P2C A;  1H37 A;  5JPM B;  3DSW B;  1HXA A;  3PYA A;  1HMW A;  4GAX A;  1V7V A;  2OKX A;  3SDR A;  5FO8 B;  3E80 A;  1HV6 A;  4YCR A;  3M72 A;  3E37 B;  3HXB B;  3SDV A;  1O1R B;  1O6Q A;  2D5J A;  1TNU B;  3DSV B;  2WII B;  4AYQ A;  3ACT A;  2E22 A;  5C05 A;  5IK0 A;  5IK9 A;  3A0O A;  2CQS A;  3SDU A;  2FUZ A;  5CZL A;  1MZC B;  2DRS A;  3PMM A;  4KTP A;  5DHK A;  3DST B;  3WIQ A;  1OJN A;  2H6G B;  1X1I A;  1F9G A;  4OK4 A;  1SQC A;  1RWA A;  3OED A;  4EL8 A;  3DRA B;  1WZZ A;  1HZF A;  2BBC A;  1FMI A;  1FP3 A;  3E73 A;  1V7W A;  3G6J B;  3S9V A;  4AYP A;  1FO2 A;  2VN7 A;  3E6U A;  2BB5 A;  2A8Z A;  3D5S A;  3RX5 A;  2Z07 A;  2ONH A;  2ZBL A;  3Q75 B;  4BOK A;  2FUQ A;  5AGD A;  1N4P B;  4AYO A;  1RWH A;  2B4F A;  3D3I A;  4WVB A;  3S4D A;  1O6H A;  4JJJ A;  3N0F A;  3HXC B;  1N4Q B;  3D5R A;  1QAZ A;  1IA7 A;  3EUV B;  3S4A A;  5ILZ A;  5ILY A;  4MBG B;  2B39 A;  2WYN A;  1XWT A;  1N21 A;  3PZ4 B;  4GL3 A;  1X1J A;  1X1H A;  1TNB B;  3M78 A;  4DOD A;  3EU8 A;  5GY3 A;  3VSN A;  4YDO B;  3WKI A;  2DRQ A;  1O6R A;  1DOG A;  1CB8 A;  3Q78 B;  1HN0 A;  1O1S B;  1W6K A;  3M75 A;  5JMF A;  3ANJ A;  1O1T B;  1KSC A;  3QXF A;  2BB6 A;  3OXU A;  4GTV B;  1H54 A;  1TNO B;  4TXT A;  3SQC A;  4GTM B;  3RSY A;  3AFL A;  1N7P A;  1X81 B;  3M74 A;  1H35 A;  1UMP A;  2G0D A;  4ONT A;  2Q1F A;  2NVP A;  2SQC A;  3QXQ A;  1KRE A;  2F6D A;  4WVC A;  3QSP A;  5ILD A;  2EAB A;  1TN6 B;  4BOJ A;  1DL2 A;  5FOB B;  3QWT A;  1TNZ B;  3PZ3 B;  1LOH A;  4D4B A;  4ZH1 A;  5DGR A;  3RX8 A;  5EAU A;  2I07 B;  2CQT A;  3K7X A;  1HCU A;  1RQ5 A;  1JS4 A;  4GTO B;  2YIK A;  4GTS B;  1D8D B;  3VSM A;  4FXK B;  1N95 B;  2X03 A;  4XUV A;  1W3Y A;  2WY8 A;  3HXD B;  1FBO A;  4LIX A;  4DOE A;  1K72 A;  5IK6 A;  3QG0 A;  1N7N A;  1KKT A;  1I8Q A;  1RW9 A;  2E24 A;  2GH4 A;  3ANK A;  3M73 A;  3QFZ A;  1V7X A;  3CIH A;  4WU0 A;  4YDE B;  1N94 B;  3RRS A;  1JCS B;  1O79 A;  1CEM A;  1L2A A;  4F10 A;  3KSQ B;  1N4S B;  2RI9 A;  4Z4J A;  3HXE B;  1LF6 A;  1H3C A;  1X9D A;  3CU7 A;  3QRY A;  3SFX B;  3WIW A;  3M71 A;  1TN7 B; 
#chains in the Genus database with same CATH homology
 3QPF A;  3M77 A;  3W7T A;  2EAC A;  2JF4 A;  1H13 A;  1S63 B;  1S64 B;  3QT3 A;  1LTX B;  5DGQ A;  1WU4 A;  2JJB A;  5FO7 B;  1N9A B;  4MU9 A;  1GAH A;  1KZO B;  3Q73 B;  3SFY B;  5FO9 B;  3W5M A;  3X17 A;  1IA6 A;  1TNY B;  1H14 A;  3PZ1 B;  1CLC A;  2XFG A;  2FV0 A;  1QQF A;  1H3B A;  3P5R A;  1NL4 B;  1GA2 A;  1IS9 A;  3SAE A;  1N4R B;  4ZRP A;  3ANI A;  4CJ0 A;  1FAE A;  4GTP B;  3WUX A;  1FT2 B;  4L6X A;  1AYX A;  3GLY A;  2FV1 A;  3QT9 A;  1XW2 A;  4FUS A;  3KLS A;  4M76 A;  3Q79 B;  4D94 A;  2PN5 A;  2V3P A;  2EAD A;  1D8E B;  5GZK A;  3E33 B;  1KRF A;  3S4C A;  3C72 B;  2AFA A;  1SA4 B;  1G9J A;  1LD8 B;  4L9P B;  3M7B A;  1V5D A;  3E32 B;  3EU5 B;  4LNB B;  1V5C A;  3W7S A;  1KS8 A;  1SA5 B;  2XWB B;  3WKG A;  1H36 A;  2RI8 A;  3E34 B;  1KWF A;  3H7L A;  2RGK A;  2ZZR A;  3Q7F B;  3T33 A;  1C3D A;  2AHF A;  2WY7 A;  3DSX B;  2EAE A;  1O5M B;  3SDT A;  3WC3 A;  3M7L A;  1WU6 A;  2WIN B;  3M76 A;  3SDQ A;  1GSZ A;  3WIR A;  1LD7 B;  1GXN A;  2P0V A;  3H3K A;  2IEJ B;  4J5T A;  4Q2B A;  3RX7 A;  1G6I A;  4AYR A;  1NI1 B;  3KSL B;  1JCR B;  1KFG A;  2V8K A;  4ZG8 A;  1W6J A;  5JPN B;  3VW5 A;  4KKI A;  4D4A A;  5E2J A;  1KZP B;  3DSS B;  3Q7A B;  3DSU B;  4EHM B;  3TF4 A;  2XWJ B;  4Z4L A;  4LNG B;  1DCE B;  1ULV A;  2DRR A;  3A3V A;  3GZK A;  3W7X A;  5KKB A;  5M7I A;  3W7W A;  2VN4 A;  3EZ8 A;  1NC5 A;  4CJ1 A;  1KSD A;  2H6H B;  2R2L B;  5CA3 A;  1LF9 A;  2H6I B;  2V3N A;  2BED B;  1UT9 A;  2V8I A;  3PZ2 B;  4V1R A;  1GHQ A;  4Q88 A;  4KKJ A;  1QBQ B;  3WKH A;  1H3A A;  1QSJ A;  2D8L A;  4CE7 A;  3W5N A;  3EQA A;  4KTR A;  1H12 A;  2GOX A;  3ACS A;  5GW7 A;  3H2W A;  1FBW A;  4QT9 A;  1AGM A;  1WU5 A;  1FCE A;  1VD5 A;  4D4D A;  2QNO A;  2H6F B;  2V8J A;  1L1Y A;  4GTR B;  1TN8 B;  3KQ4 A;  3GT5 A;  3P5P A;  4D4C A;  2NOJ A;  4FXG B;  5CD2 A;  3HXF B;  1F9O A;  1FPP B;  1JCQ B;  2ZIR B;  3RJ3 A;  2AHG A;  2GZ6 A;  3QFY A;  4LNV A;  5MEH A;  1H39 A;  5M7Y A;  4V1S A;  3QDE A;  4ZRQ A;  1TF4 A;  2PMV A;  3ON6 A;  1UG9 A;  1F9D A;  2XQW A;  4WVA A;  1G87 A;  1GLM A;  3REN A;  2FBA A;  4GTQ B;  1FT1 B;  2JG0 A;  3E30 B;  1G9G A;  3DPY B;  4TF4 A;  3AFJ A;  1NXC A;  3VXD A;  3PYB A;  4C1S A;  1R76 A;  3M7C A;  1GXM A;  3S4B A;  3K11 A;  2G02 A;  2A73 B;  2DRO A;  4L0G A;  3WKF A;  4GTT B;  1FO3 A;  1GXO A;  4ZH5 A;  2ZIS B;  1XWQ A;  1GAI A;  2F0Y B;  3W7U A;  3M7E A;  3P2C A;  1H37 A;  5JPM B;  3DSW B;  3PYA A;  1V7V A;  2OKX A;  3SDR A;  5FO8 B;  4YCR A;  3M72 A;  3E37 B;  3HXB B;  3SDV A;  1O1R B;  1O6Q A;  2D5J A;  1TNU B;  3DSV B;  2WII B;  4AYQ A;  3ACT A;  2CQS A;  3SDU A;  2FUZ A;  5CZL A;  1MZC B;  2DRS A;  3PMM A;  4KTP A;  3DST B;  3WIQ A;  2H6G B;  1SQC A;  4EL8 A;  3OED A;  3DRA B;  1WZZ A;  1HZF A;  2BBC A;  1FMI A;  1FP3 A;  3E73 A;  1V7W A;  3G6J B;  3S9V A;  4AYP A;  1FO2 A;  2VN7 A;  3E6U A;  2BB5 A;  2A8Z A;  3D5S A;  3RX5 A;  2Z07 A;  2ZBL A;  3Q75 B;  4BOK A;  5AGD A;  1N4P B;  4AYO A;  2B4F A;  3D3I A;  4WVB A;  3S4D A;  1O6H A;  4JJJ A;  3HXC B;  1N4Q B;  3D5R A;  1IA7 A;  3EUV B;  3S4A A;  4MBG B;  2B39 A;  2WYN A;  1XWT A;  3PZ4 B;  4GL3 A;  1TNB B;  3M78 A;  4DOD A;  3EU8 A;  5GY3 A;  4YDO B;  3WKI A;  2DRQ A;  1O6R A;  1DOG A;  3Q78 B;  1O1S B;  1W6K A;  3M75 A;  3ANJ A;  1O1T B;  1KSC A;  3QXF A;  2BB6 A;  3OXU A;  4GTV B;  1H54 A;  1TNO B;  4TXT A;  3SQC A;  4GTM B;  3RSY A;  1X81 B;  3M74 A;  1H35 A;  1UMP A;  2G0D A;  4ONT A;  2NVP A;  2SQC A;  3QXQ A;  1KRE A;  2F6D A;  4WVC A;  3QSP A;  2EAB A;  1TN6 B;  4BOJ A;  1DL2 A;  5FOB B;  3QWT A;  1TNZ B;  3PZ3 B;  4D4B A;  4ZH1 A;  5DGR A;  3RX8 A;  2I07 B;  2CQT A;  3K7X A;  1HCU A;  1RQ5 A;  1JS4 A;  4GTO B;  2YIK A;  4GTS B;  1D8D B;  4FXK B;  1N95 B;  4XUV A;  2WY8 A;  3HXD B;  1FBO A;  4LIX A;  4DOE A;  1K72 A;  3QG0 A;  1KKT A;  2GH4 A;  3ANK A;  3M73 A;  3QFZ A;  1V7X A;  3CIH A;  4WU0 A;  4YDE B;  1N94 B;  3RRS A;  1JCS B;  1O79 A;  1CEM A;  1L2A A;  3KSQ B;  1N4S B;  2RI9 A;  4Z4J A;  3HXE B;  1LF6 A;  1H3C A;  1X9D A;  3CU7 A;  3QRY A;  3SFX B;  3WIW A;  3M71 A;  1TN7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...