2FUZA

Ugl hexagonal crystal structure without glycine and dtt molecules
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
377
structure length
377
Chain Sequence
b'MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Unsaturated glucuronyl hydrolase
publication title Substrate recognition by unsaturated glucuronyl hydrolase from Bacillus sp. GL1
pubmed doi rcsb
source organism Bacillus sp.
molecule tags Hydrolase
total genus 158
structure length 377
sequence length 377
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2006-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2fuzA00
2D8LA 4Z4JA 5MEHA 4Q88A 5GW7A 4Z4LA 3GT5A 2AHFA 1HCUA 1KS8A 4WVCA 1CLCA 1L1YA 1TF4A 2D5JA 1FBWA 1G6IA 4WVBA 3H2WA 4CJ1A 1G87A 1GLMA 1FMIA 1F9DA 3W7UA 1FO2A 1FAEA 1FO3A 3QSPA 1H13A 1V7XA 5M7IA 1H54A 1G9JA 5DGRA 1AYXA 5CA3A 3EZ8A 4AYRA 1V5DA 2FV0A 4DOEA 3W7SA 2FUZA 3QRYA 2XFGA 3W7XA 3ANKA 3GLYA 3RX5A 5CZLA 2DROA 3S4AA 4AYQA 1NC5A 3RRSA 3WIWA 4AYPA 1NXCA 2EAEA 3E6UA 3QDEA 3X17A 1WU6A 2AFAA 1KFGA 2AHGA 1KSDA 1XW2A 2DRQA 2RI8A 3QXQA 1AGMA 2GH4A 3ACTA 2CQSA 3QPFA 4L6XA 3WIQA 3QT3A 2P0VA 3QFYA 3VXDA 2RGKA 1FCEA 2JG0A 2DRRA 3QWTA 5DGQA 1V7WA 2EADA 3RENA 1UT9A 3CIHA 2DRSA 1G9GA 4L0GA 3H7LA 1DOGA 3WKGA 1VD5A 4EL8A 3WC3A 1GA2A 1IA7A 1XWQA 3QT9A 1RQ5A 4AYOA 1WU5A 4Q2BA 2EACA 2ZZRA 3WKFA 2VN4A 1L2AA 3S4DA 5M7YA 1V5CA 3ANIA 4DODA 1F9OA 4KTPA 2VN7A 2QNOA 3ON6A 5CD2A 2WYNA 2JF4A 3W7WA 1H12A 4WU0A 3RX8A 3P2CA 4WVAA 2Z07A 3T33A 4ZH5A 1FP3A 2RI9A 1DL2A 3AFJA 3RSYA 4CE7A 1LF9A 1GAHA 3K11A 1KKTA 3W7TA 2CQTA 1IA6A 2B4FA 2GZ6A 2OKXA 1KRFA 2ZBLA 3H3KA 3RX7A 5E2JA 3EQAA 4KTRA 3WUXA 5KKBA 3WIRA 3D3IA 1X9DA 4TF4A 1KREA 3GZKA 2F6DA 4ZG8A 1FBOA 3E73A 3W5MA 4JJJA 4FUSA 3TF4A 3WKHA 3W5NA 1WU4A 4J5TA 2A8ZA 1XWTA 1IS9A 5GY3A 2NVPA 2EABA 1H14A 1UG9A 3ACSA 3PMMA 1WZZA 3S4BA 3QFZA 3S4CA 2YIKA 1V7VA 4CJ0A 2FBAA 1JS4A 1ULVA 3VW5A 3A3VA 3QG0A 3QXFA 2FV1A 1KWFA 4TXTA 1GAIA 1KSCA 4XUVA 1LF6A 1K72A 3ANJA 1CEMA 3WKIA 2JJBA
chains in the Genus database with same CATH superfamily
4Z4JA 4GTSB 4Q88A 1N7OA 2AHFA 1KS8A 1CLCA 4OJZA 3M76A 1FBWA 4WVBA 3D5RA 3CU7A 5IK6A 3HXEB 1FAEA 3QSPA 1H13A 4LNVA 5M7IA 1G9JA 3G4FA 1AYXA 2BRWA 1HXGA 3DSVB 5CA3A 4YCRA 3SQCA 4QT9A 4F13A 4D4DA 1H36A 1TNOB 4MMHA 5FO7B 2BEDB 2FUTA 3ANKA 3DPYB 1O1TB 3GLYA 1TN7B 2DROA 3RX5A 4LNBB 1RWFA 1W3YA 3EU5B 1KSDA 1N95B 1N22A 4L6XA 3WIQA 1FCEA 2JG0A 3CIHA 2DRSA 1W6KA 1N94B 3H7LA 1H3CA 3SFXB 3WC3A 1HV6A 1RQ5A 1WU5A 2WIIB 4V1RA 4Q2BA 1HMWA 2EACA 5ILZA 3RJ3A 3ANIA 4KKIA 2G02A 4KTPA 3ON6A 3W7WA 4WU0A 1HZFA 3P2CA 2V8IA 3T33A 2Z07A 3DRAB 1N7QA 4CE7A 3PYBA 3M7BA 1GAHA 1LTXB 1KKTA 3NNBA 4BOJA 1KRFA 1NL4B 3H3KA 3P5PA 5ILYA 3WIRA 1X9DA 1KZPB 4DI5A 3E73A 1OJOA 3W5MA 3TF4A 3E7JA 2WINB 1F9GA 1QQFA 5GY3A 2NVPA 4C1SA 5ILHA 3PMMA 2FBAA 1JS4A 1N23A 4YDOB 2BBCA 4FNVA 1OJNA 4GTTB 2FV1A 2BRVX 1KSCA 2Q1FA 1LF6A 2R2LB 1CEMA 4RNQA 2JJBA 5IK0A 5MEHA 5GW7A 3PZ3B 4M76A 1TF4A 4OZWA 3Q79B 3M7LA 1J0NA 2B39A 3SDUA 1FMIA 1F9DA 3SDRA 2PN5A 3A0OA 2ONGA 3E80A 5DGRA 4ZRQA 2J5CA 3AFLA 3SDQA 2X03A 1HXAA 4DOEA 1SA5B 3P5RA 1C82A 5JMDA 5CZLA 4AYQA 1NC5A 3RRSA 3WIWA 2H6IB 3QDEA 2AFAA 2RI8A 3VSMA 5ILIA 1AGMA 4FJQA 4EHMB 3QT3A 3VXDA 3QFYA 5DGQA 2DRRA 1UT9A 2PMVA 1N20A 5DHKA 1DOGA 5AGDA 3WKGA 4EL8A 1XWQA 5IM1A 5JPMB 3WKFA 2ZZRA 2F0YB 3S4DA 5M7YA 1QBQB 1D8DB 4DODA 1LD8B 2WDAA 1H12A 3RX8A 1GXNA 1N4QB 1FP3A 3RSYA 1LF9A 1LXMA 3K11A 3SDVA 2B4FA 1JCRB 1N7RA 5E2JA 4MMIA 3Q78B 2IEJB 4GTOB 4TF4A 1O1RB 1FBOA 1FT2B 1LOHA 3OEDA 1H35A 3W5NA 3G6JB 1N7PA 2A8ZA 4D4BA 5IKAA 4GTQB 1DCEB 3E32B 1UG9A 1N7NA 1WZZA 4F10A 3DSSB 3S4CA 2BRPA 1OJPA 1O6HA 3A3VA 1RWHA 3QG0A 5ILJA 3D5SA 4TXTA 4FXKB 3Q75B 1K72A 1TNUB 1X81B 3K7XA 3PZ2B 2G0DA 3E33B 2D8LA 4Z4LA 5FO8B 1HCUA 3KLSA 2I07B 3M7CA 1X1IA 1G6IA 3H2WA 4BOKA 1N24A 4CJ1A 5JPNB 1G87A 1GLMA 1FO3A 1QSJA 1V7XA 1TN8B 2ZIRB 3EZ8A 4AYRA 4D94A 1V5DA 2FV0A 3W7SA 2XQWA 3QRYA 4V1SA 2XFGA 2V3PA 3S4AA 5EASA 3PZ4B 4AYPA 1TN6B 1HM2A 5GZKA 1NXCA 5IL3A 3E6UA 4KKJA 3X17A 1WU6A 2AHGA 2DRQA 3HXBB 3EU8A 3QXQA 1NI1B 1X1JA 4OK4A 2A73B 2CQSA 3Q7FB 2P0VA 1V7WA 2EADA 1S64B 3RENA 1O79A 1N4RB 3M02A 2BB5A 4D4AA 1VD5A 3E34B 1RWAA 1GA2A 1IA7A 5IK9A 3QT9A 1GHQA 1GXMA 1OJMA 1RW9A 3EUVB 2VN4A 1S63B 2WY8A 2VN7A 2GOXA 2QNOA 2WYNA 2XWJB 1JCQB 3M00A 4WVAA 4ZH5A 3M7EA 4GTRB 1EGUA 5JMFA 1IA6A 1UMPA 2OKXA 2XWBB 4GTVB 2FUQA 1KZOB 1O6QA 3SAEA 2ONHA 3S9VA 5KKBA 1KREA 3M71A 3GZKA 3HXFB 4ZG8A 1N1ZA 2H6HB 5C05A 3VSNA 1W6JA 4LIXA 4D4CA 3WKHA 3M72A 3E37B 1WU4A 5FOBB 4OZVA 1TNYB 3M74A 3KSQB 3S4BA 1TNZB 3N0GA 4ONTA 3QFZA 1N21A 1V7VA 2WCOA 1LD7B 3SFYB 1H3AA 1HN0A 4ZRPA 4E1YA 1KWFA 1LXKA 3E30B 3DSWB 3OXUA 1H37A 2BB6A 3DSXB 1HMUA 3GT5A 2V8KA 5EAUA 4WVCA 3KQ4A 4FXGB 1L1YA 1MZCB 2D5JA 3NFVA 2NOJA 3W7UA 1FO2A 3M73A 1O1SB 1H54A 1RWCA 4ZH1A 3SDTA 2E22A 1F1SA 2FUZA 3W7XA 1N1BA 3M78A 1H3BA 2E24A 2WY7A 5EATA 1FT1B 1HXCA 1C3DA 1RWGA 2EAEA 1SA4B 1KFGA 1XW2A 2GH4A 2ZISB 3ACTA 2H6FB 3QPFA 3KSLB 3Q7AB 2RGKA 4GL3A 3QWTA 1J0MA 1O6RA 1G9GA 4L0GA 2V3NA 4YDEB 3HXDB 3HXCB 4AYOA 1N9AB 3DSTB 1N4PB 4OK2A 1L2AA 1V5CA 3PYAA 1F9OA 3M01A 1I8QA 3Q73B 3LZ9A 5CD2A 3WKIA 2JF4A 1GXOA 4LNGB 1X1HA 1R76A 2RI9A 1DL2A 3AFJA 4GTPB 3DSUB 3W7TA 5IKHA 2CQTA 2GZ6A 1D8EB 4L9PB 2ZBLA 3RX7A 4GAXA 3EQAA 4KTRA 5IL8A 5ILDA 3WUXA 5ILKA 3D3IA 3G4DA 2F6DA 5DHIA 2SQCA 1CB8A 3N0FA 4FUSA 4JJJA 1GSZA 4GTMB 1O5MB 4NEIA 5FO9B 4J5TA 1H39A 2V8JA 1XWTA 1IS9A 1N4SB 2EABA 1H14A 3ACSA 3C72B 1HX9A 1TNBB 3M77A 2YIKA 4CJ0A 3VW5A 1ULVA 1FPPB 4MU9A 1JCSB 1HM3A 3M75A 3PZ1B 3QXFA 1QAZA 1GAIA 2H6GB 4XUVA 3ANJA 1SQCA 4MBGB
chains in the Genus database with same CATH topology
4Z4JA 4GTSB 4Q88A 2AHFA 1KS8A 1CLCA 3M76A 1FBWA 4WVBA 3D5RA 3CU7A 3HXEB 1FAEA 3QSPA 1H13A 4LNVA 5M7IA 1G9JA 1AYXA 5CA3A 3DSVB 4YCRA 3SQCA 4QT9A 4D4DA 1H36A 1TNOB 5FO7B 2BEDB 3DPYB 3ANKA 3GLYA 1O1TB 3RX5A 1TN7B 2DROA 4LNBB 3EU5B 1KSDA 1N95B 4L6XA 3WIQA 1FCEA 2JG0A 3CIHA 2DRSA 1W6KA 1N94B 3H7LA 1H3CA 3SFXB 3WC3A 1RQ5A 1WU5A 2WIIB 4V1RA 4Q2BA 2EACA 3RJ3A 3ANIA 4KKIA 2G02A 4KTPA 3ON6A 3W7WA 4WU0A 1HZFA 3P2CA 2V8IA 3T33A 2Z07A 3DRAB 4CE7A 3PYBA 3M7BA 1GAHA 1LTXB 1KKTA 4BOJA 1KRFA 1NL4B 3H3KA 3P5PA 3WIRA 1X9DA 1KZPB 3E73A 3W5MA 3TF4A 2WINB 1QQFA 5GY3A 2NVPA 4C1SA 3PMMA 2FBAA 1JS4A 4YDOB 2BBCA 4GTTB 2FV1A 1KSCA 1LF6A 2R2LB 1CEMA 2JJBA 5MEHA 5GW7A 3PZ3B 4M76A 1TF4A 3Q79B 3M7LA 2B39A 3SDUA 1FMIA 1F9DA 3SDRA 2PN5A 5DGRA 4ZRQA 3SDQA 4DOEA 1SA5B 3P5RA 5CZLA 4AYQA 1NC5A 3RRSA 3WIWA 2H6IB 3QDEA 2AFAA 2RI8A 1AGMA 4EHMB 3QT3A 3VXDA 3QFYA 5DGQA 2DRRA 1UT9A 2PMVA 1DOGA 5AGDA 3WKGA 4EL8A 1XWQA 5JPMB 3WKFA 2ZZRA 2F0YB 3S4DA 5M7YA 1QBQB 1D8DB 4DODA 1LD8B 1H12A 3RX8A 1GXNA 1N4QB 1FP3A 3RSYA 1LF9A 3K11A 3SDVA 2B4FA 1JCRB 5E2JA 3Q78B 2IEJB 4GTOB 4TF4A 1O1RB 1FBOA 1FT2B 3OEDA 1H35A 3W5NA 3G6JB 2A8ZA 4D4BA 4GTQB 1DCEB 3E32B 1UG9A 1WZZA 3DSSB 3S4CA 1O6HA 3A3VA 3QG0A 3D5SA 4TXTA 4FXKB 3Q75B 1K72A 1TNUB 1X81B 3K7XA 3PZ2B 2G0DA 3E33B 2D8LA 4Z4LA 5FO8B 1HCUA 3KLSA 2I07B 3M7CA 1G6IA 3H2WA 4BOKA 4CJ1A 5JPNB 1G87A 1GLMA 1FO3A 1QSJA 1V7XA 1TN8B 2ZIRB 3EZ8A 4AYRA 4D94A 1V5DA 2FV0A 3W7SA 2XQWA 3QRYA 4V1SA 2XFGA 2V3PA 3S4AA 3PZ4B 4AYPA 1TN6B 5GZKA 1NXCA 3E6UA 4KKJA 3X17A 1WU6A 2AHGA 2DRQA 3HXBB 3EU8A 3QXQA 1NI1B 2A73B 2CQSA 3Q7FB 2P0VA 1V7WA 2EADA 1S64B 3RENA 1O79A 1N4RB 2BB5A 4D4AA 1VD5A 3E34B 1GA2A 1IA7A 3QT9A 1GHQA 1GXMA 3EUVB 2VN4A 1S63B 2WY8A 2VN7A 2GOXA 2QNOA 2WYNA 2XWJB 1JCQB 4WVAA 4ZH5A 3M7EA 4GTRB 1IA6A 1UMPA 2OKXA 2XWBB 4GTVB 1KZOB 1O6QA 3SAEA 3S9VA 5KKBA 1KREA 3M71A 3GZKA 3HXFB 4ZG8A 2H6HB 1W6JA 4LIXA 4D4CA 3WKHA 3M72A 3E37B 1WU4A 5FOBB 3M74A 1TNYB 3KSQB 3S4BA 1TNZB 4ONTA 3QFZA 1V7VA 1LD7B 3SFYB 1H3AA 4ZRPA 1KWFA 3E30B 3DSWB 3OXUA 1H37A 2BB6A 3DSXB 3GT5A 2V8KA 4WVCA 3KQ4A 4FXGB 1L1YA 1MZCB 2D5JA 2NOJA 3W7UA 1FO2A 3M73A 1O1SB 1H54A 4ZH1A 3SDTA 2FUZA 3W7XA 3M78A 1H3BA 2WY7A 1FT1B 1C3DA 2EAEA 1SA4B 1KFGA 1XW2A 2GH4A 2ZISB 3ACTA 2H6FB 3QPFA 3KSLB 3Q7AB 2RGKA 4GL3A 3QWTA 1O6RA 1G9GA 4L0GA 2V3NA 4YDEB 3HXDB 3HXCB 4AYOA 1N9AB 3DSTB 1N4PB 1L2AA 1V5CA 3PYAA 1F9OA 3Q73B 3WKIA 5CD2A 2JF4A 1GXOA 4LNGB 1R76A 2RI9A 1DL2A 3AFJA 4GTPB 3DSUB 3W7TA 2CQTA 2GZ6A 1D8EB 4L9PB 2ZBLA 3RX7A 3EQAA 4KTRA 3WUXA 3D3IA 2F6DA 2SQCA 4JJJA 4FUSA 1GSZA 4GTMB 1O5MB 5FO9B 4J5TA 1H39A 1XWTA 2V8JA 1IS9A 1N4SB 2EABA 1H14A 3ACSA 3C72B 1TNBB 3M77A 2YIKA 4CJ0A 3VW5A 1ULVA 1FPPB 4MU9A 1JCSB 3M75A 3PZ1B 3QXFA 1GAIA 2H6GB 4XUVA 3ANJA 1SQCA 4MBGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8L A;  4Z4J A;  5MEH A;  4Q88 A;  5GW7 A;  4Z4L A;  3GT5 A;  2AHF A;  1HCU A;  1KS8 A;  4WVC A;  1CLC A;  1L1Y A;  1TF4 A;  2D5J A;  1FBW A;  1G6I A;  4WVB A;  3H2W A;  4CJ1 A;  1G87 A;  1GLM A;  1FMI A;  1F9D A;  3W7U A;  1FO2 A;  1FAE A;  1FO3 A;  3QSP A;  1H13 A;  1V7X A;  5M7I A;  1H54 A;  1G9J A;  5DGR A;  1AYX A;  5CA3 A;  3EZ8 A;  4AYR A;  1V5D A;  2FV0 A;  4DOE A;  3W7S A;  2FUZ A;  3QRY A;  2XFG A;  3W7X A;  3ANK A;  3GLY A;  3RX5 A;  5CZL A;  2DRO A;  3S4A A;  4AYQ A;  1NC5 A;  3RRS A;  3WIW A;  4AYP A;  1NXC A;  2EAE A;  3E6U A;  3QDE A;  3X17 A;  1WU6 A;  2AFA A;  1KFG A;  2AHG A;  1KSD A;  1XW2 A;  2DRQ A;  2RI8 A;  3QXQ A;  1AGM A;  2GH4 A;  3ACT A;  2CQS A;  3QPF A;  4L6X A;  3WIQ A;  3QT3 A;  2P0V A;  3QFY A;  3VXD A;  2RGK A;  1FCE A;  2JG0 A;  2DRR A;  3QWT A;  5DGQ A;  1V7W A;  2EAD A;  3REN A;  1UT9 A;  3CIH A;  2DRS A;  1G9G A;  4L0G A;  3H7L A;  1DOG A;  3WKG A;  1VD5 A;  4EL8 A;  3WC3 A;  1GA2 A;  1IA7 A;  1XWQ A;  3QT9 A;  1RQ5 A;  4AYO A;  1WU5 A;  4Q2B A;  2EAC A;  2ZZR A;  3WKF A;  2VN4 A;  1L2A A;  3S4D A;  5M7Y A;  1V5C A;  3ANI A;  4DOD A;  1F9O A;  4KTP A;  2VN7 A;  2QNO A;  3ON6 A;  5CD2 A;  2WYN A;  2JF4 A;  3W7W A;  1H12 A;  4WU0 A;  3RX8 A;  3P2C A;  4WVA A;  2Z07 A;  3T33 A;  4ZH5 A;  1FP3 A;  2RI9 A;  1DL2 A;  3AFJ A;  3RSY A;  4CE7 A;  1LF9 A;  1GAH A;  3K11 A;  1KKT A;  3W7T A;  2CQT A;  1IA6 A;  2B4F A;  2GZ6 A;  2OKX A;  1KRF A;  2ZBL A;  3H3K A;  3RX7 A;  5E2J A;  3EQA A;  4KTR A;  3WUX A;  5KKB A;  3WIR A;  3D3I A;  1X9D A;  4TF4 A;  1KRE A;  3GZK A;  2F6D A;  4ZG8 A;  1FBO A;  3E73 A;  3W5M A;  4JJJ A;  4FUS A;  3TF4 A;  3WKH A;  3W5N A;  1WU4 A;  4J5T A;  2A8Z A;  1XWT A;  1IS9 A;  5GY3 A;  2NVP A;  2EAB A;  1H14 A;  1UG9 A;  3ACS A;  3PMM A;  1WZZ A;  3S4B A;  3QFZ A;  3S4C A;  2YIK A;  1V7V A;  4CJ0 A;  2FBA A;  1JS4 A;  1ULV A;  3VW5 A;  3A3V A;  3QG0 A;  3QXF A;  2FV1 A;  1KWF A;  4TXT A;  1GAI A;  1KSC A;  4XUV A;  1LF6 A;  1K72 A;  3ANJ A;  1CEM A;  3WKI A;  2JJB A; 
#chains in the Genus database with same CATH topology
 4Z4J A;  4GTS B;  4Q88 A;  1N7O A;  2AHF A;  1KS8 A;  1CLC A;  4OJZ A;  3M76 A;  1FBW A;  4WVB A;  3D5R A;  3CU7 A;  5IK6 A;  3HXE B;  1FAE A;  3QSP A;  1H13 A;  4LNV A;  5M7I A;  1G9J A;  3G4F A;  1AYX A;  2BRW A;  1HXG A;  3DSV B;  5CA3 A;  4YCR A;  3SQC A;  4QT9 A;  4F13 A;  4D4D A;  1H36 A;  1TNO B;  4MMH A;  5FO7 B;  2BED B;  2FUT A;  3ANK A;  3DPY B;  1O1T B;  3GLY A;  1TN7 B;  2DRO A;  3RX5 A;  4LNB B;  1RWF A;  1W3Y A;  3EU5 B;  1KSD A;  1N95 B;  1N22 A;  4L6X A;  3WIQ A;  1FCE A;  2JG0 A;  3CIH A;  2DRS A;  1W6K A;  1N94 B;  3H7L A;  1H3C A;  3SFX B;  3WC3 A;  1HV6 A;  1RQ5 A;  1WU5 A;  2WII B;  4V1R A;  4Q2B A;  1HMW A;  2EAC A;  5ILZ A;  3RJ3 A;  3ANI A;  4KKI A;  2G02 A;  4KTP A;  3ON6 A;  3W7W A;  4WU0 A;  1HZF A;  3P2C A;  2V8I A;  3T33 A;  2Z07 A;  3DRA B;  1N7Q A;  4CE7 A;  3PYB A;  3M7B A;  1GAH A;  1LTX B;  1KKT A;  3NNB A;  4BOJ A;  1KRF A;  1NL4 B;  3H3K A;  3P5P A;  5ILY A;  3WIR A;  1X9D A;  1KZP B;  4DI5 A;  3E73 A;  1OJO A;  3W5M A;  3TF4 A;  3E7J A;  2WIN B;  1F9G A;  1QQF A;  5GY3 A;  2NVP A;  4C1S A;  5ILH A;  3PMM A;  2FBA A;  1JS4 A;  1N23 A;  4YDO B;  2BBC A;  4FNV A;  1OJN A;  4GTT B;  2FV1 A;  2BRV X;  1KSC A;  2Q1F A;  1LF6 A;  2R2L B;  1CEM A;  4RNQ A;  2JJB A;  5IK0 A;  5MEH A;  5GW7 A;  3PZ3 B;  4M76 A;  1TF4 A;  4OZW A;  3Q79 B;  3M7L A;  1J0N A;  2B39 A;  3SDU A;  1FMI A;  1F9D A;  3SDR A;  2PN5 A;  3A0O A;  2ONG A;  3E80 A;  5DGR A;  4ZRQ A;  2J5C A;  3AFL A;  3SDQ A;  2X03 A;  1HXA A;  4DOE A;  1SA5 B;  3P5R A;  1C82 A;  5JMD A;  5CZL A;  4AYQ A;  1NC5 A;  3RRS A;  3WIW A;  2H6I B;  3QDE A;  2AFA A;  2RI8 A;  3VSM A;  5ILI A;  1AGM A;  4FJQ A;  4EHM B;  3QT3 A;  3VXD A;  3QFY A;  5DGQ A;  2DRR A;  1UT9 A;  2PMV A;  1N20 A;  5DHK A;  1DOG A;  5AGD A;  3WKG A;  4EL8 A;  1XWQ A;  5IM1 A;  5JPM B;  3WKF A;  2ZZR A;  2F0Y B;  3S4D A;  5M7Y A;  1QBQ B;  1D8D B;  4DOD A;  1LD8 B;  2WDA A;  1H12 A;  3RX8 A;  1GXN A;  1N4Q B;  1FP3 A;  3RSY A;  1LF9 A;  1LXM A;  3K11 A;  3SDV A;  2B4F A;  1JCR B;  1N7R A;  5E2J A;  4MMI A;  3Q78 B;  2IEJ B;  4GTO B;  4TF4 A;  1O1R B;  1FBO A;  1FT2 B;  1LOH A;  3OED A;  1H35 A;  3W5N A;  3G6J B;  1N7P A;  2A8Z A;  4D4B A;  5IKA A;  4GTQ B;  1DCE B;  3E32 B;  1UG9 A;  1N7N A;  1WZZ A;  4F10 A;  3DSS B;  3S4C A;  2BRP A;  1OJP A;  1O6H A;  3A3V A;  1RWH A;  3QG0 A;  5ILJ A;  3D5S A;  4TXT A;  4FXK B;  3Q75 B;  1K72 A;  1TNU B;  1X81 B;  3K7X A;  3PZ2 B;  2G0D A;  3E33 B;  2D8L A;  4Z4L A;  5FO8 B;  1HCU A;  3KLS A;  2I07 B;  3M7C A;  1X1I A;  1G6I A;  3H2W A;  4BOK A;  1N24 A;  4CJ1 A;  5JPN B;  1G87 A;  1GLM A;  1FO3 A;  1QSJ A;  1V7X A;  1TN8 B;  2ZIR B;  3EZ8 A;  4AYR A;  4D94 A;  1V5D A;  2FV0 A;  3W7S A;  2XQW A;  3QRY A;  4V1S A;  2XFG A;  2V3P A;  3S4A A;  5EAS A;  3PZ4 B;  4AYP A;  1TN6 B;  1HM2 A;  5GZK A;  1NXC A;  5IL3 A;  3E6U A;  4KKJ A;  3X17 A;  1WU6 A;  2AHG A;  2DRQ A;  3HXB B;  3EU8 A;  3QXQ A;  1NI1 B;  1X1J A;  4OK4 A;  2A73 B;  2CQS A;  3Q7F B;  2P0V A;  1V7W A;  2EAD A;  1S64 B;  3REN A;  1O79 A;  1N4R B;  3M02 A;  2BB5 A;  4D4A A;  1VD5 A;  3E34 B;  1RWA A;  1GA2 A;  1IA7 A;  5IK9 A;  3QT9 A;  1GHQ A;  1GXM A;  1OJM A;  1RW9 A;  3EUV B;  2VN4 A;  1S63 B;  2WY8 A;  2VN7 A;  2GOX A;  2QNO A;  2WYN A;  2XWJ B;  1JCQ B;  3M00 A;  4WVA A;  4ZH5 A;  3M7E A;  4GTR B;  1EGU A;  5JMF A;  1IA6 A;  1UMP A;  2OKX A;  2XWB B;  4GTV B;  2FUQ A;  1KZO B;  1O6Q A;  3SAE A;  2ONH A;  3S9V A;  5KKB A;  1KRE A;  3M71 A;  3GZK A;  3HXF B;  4ZG8 A;  1N1Z A;  2H6H B;  5C05 A;  3VSN A;  1W6J A;  4LIX A;  4D4C A;  3WKH A;  3M72 A;  3E37 B;  1WU4 A;  5FOB B;  4OZV A;  1TNY B;  3M74 A;  3KSQ B;  3S4B A;  1TNZ B;  3N0G A;  4ONT A;  3QFZ A;  1N21 A;  1V7V A;  2WCO A;  1LD7 B;  3SFY B;  1H3A A;  1HN0 A;  4ZRP A;  4E1Y A;  1KWF A;  1LXK A;  3E30 B;  3DSW B;  3OXU A;  1H37 A;  2BB6 A;  3DSX B;  1HMU A;  3GT5 A;  2V8K A;  5EAU A;  4WVC A;  3KQ4 A;  4FXG B;  1L1Y A;  1MZC B;  2D5J A;  3NFV A;  2NOJ A;  3W7U A;  1FO2 A;  3M73 A;  1O1S B;  1H54 A;  1RWC A;  4ZH1 A;  3SDT A;  2E22 A;  1F1S A;  2FUZ A;  3W7X A;  1N1B A;  3M78 A;  1H3B A;  2E24 A;  2WY7 A;  5EAT A;  1FT1 B;  1HXC A;  1C3D A;  1RWG A;  2EAE A;  1SA4 B;  1KFG A;  1XW2 A;  2GH4 A;  2ZIS B;  3ACT A;  2H6F B;  3QPF A;  3KSL B;  3Q7A B;  2RGK A;  4GL3 A;  3QWT A;  1J0M A;  1O6R A;  1G9G A;  4L0G A;  2V3N A;  4YDE B;  3HXD B;  3HXC B;  4AYO A;  1N9A B;  3DST B;  1N4P B;  4OK2 A;  1L2A A;  1V5C A;  3PYA A;  1F9O A;  3M01 A;  1I8Q A;  3Q73 B;  3LZ9 A;  5CD2 A;  3WKI A;  2JF4 A;  1GXO A;  4LNG B;  1X1H A;  1R76 A;  2RI9 A;  1DL2 A;  3AFJ A;  4GTP B;  3DSU B;  3W7T A;  5IKH A;  2CQT A;  2GZ6 A;  1D8E B;  4L9P B;  2ZBL A;  3RX7 A;  4GAX A;  3EQA A;  4KTR A;  5IL8 A;  5ILD A;  3WUX A;  5ILK A;  3D3I A;  3G4D A;  2F6D A;  5DHI A;  2SQC A;  1CB8 A;  3N0F A;  4FUS A;  4JJJ A;  1GSZ A;  4GTM B;  1O5M B;  4NEI A;  5FO9 B;  4J5T A;  1H39 A;  2V8J A;  1XWT A;  1IS9 A;  1N4S B;  2EAB A;  1H14 A;  3ACS A;  3C72 B;  1HX9 A;  1TNB B;  3M77 A;  2YIK A;  4CJ0 A;  3VW5 A;  1ULV A;  1FPP B;  4MU9 A;  1JCS B;  1HM3 A;  3M75 A;  3PZ1 B;  3QXF A;  1QAZ A;  1GAI A;  2H6G B;  4XUV A;  3ANJ A;  1SQC A;  4MBG B; 
#chains in the Genus database with same CATH homology
 4Z4J A;  4GTS B;  4Q88 A;  2AHF A;  1KS8 A;  1CLC A;  3M76 A;  1FBW A;  4WVB A;  3D5R A;  3CU7 A;  3HXE B;  1FAE A;  3QSP A;  1H13 A;  4LNV A;  5M7I A;  1G9J A;  1AYX A;  5CA3 A;  3DSV B;  4YCR A;  3SQC A;  4QT9 A;  4D4D A;  1H36 A;  1TNO B;  5FO7 B;  2BED B;  3DPY B;  3ANK A;  3GLY A;  1O1T B;  3RX5 A;  1TN7 B;  2DRO A;  4LNB B;  3EU5 B;  1KSD A;  1N95 B;  4L6X A;  3WIQ A;  1FCE A;  2JG0 A;  3CIH A;  2DRS A;  1W6K A;  1N94 B;  3H7L A;  1H3C A;  3SFX B;  3WC3 A;  1RQ5 A;  1WU5 A;  2WII B;  4V1R A;  4Q2B A;  2EAC A;  3RJ3 A;  3ANI A;  4KKI A;  2G02 A;  4KTP A;  3ON6 A;  3W7W A;  4WU0 A;  1HZF A;  3P2C A;  2V8I A;  3T33 A;  2Z07 A;  3DRA B;  4CE7 A;  3PYB A;  3M7B A;  1GAH A;  1LTX B;  1KKT A;  4BOJ A;  1KRF A;  1NL4 B;  3H3K A;  3P5P A;  3WIR A;  1X9D A;  1KZP B;  3E73 A;  3W5M A;  3TF4 A;  2WIN B;  1QQF A;  5GY3 A;  2NVP A;  4C1S A;  3PMM A;  2FBA A;  1JS4 A;  4YDO B;  2BBC A;  4GTT B;  2FV1 A;  1KSC A;  1LF6 A;  2R2L B;  1CEM A;  2JJB A;  5MEH A;  5GW7 A;  3PZ3 B;  4M76 A;  1TF4 A;  3Q79 B;  3M7L A;  2B39 A;  3SDU A;  1FMI A;  1F9D A;  3SDR A;  2PN5 A;  5DGR A;  4ZRQ A;  3SDQ A;  4DOE A;  1SA5 B;  3P5R A;  5CZL A;  4AYQ A;  1NC5 A;  3RRS A;  3WIW A;  2H6I B;  3QDE A;  2AFA A;  2RI8 A;  1AGM A;  4EHM B;  3QT3 A;  3VXD A;  3QFY A;  5DGQ A;  2DRR A;  1UT9 A;  2PMV A;  1DOG A;  5AGD A;  3WKG A;  4EL8 A;  1XWQ A;  5JPM B;  3WKF A;  2ZZR A;  2F0Y B;  3S4D A;  5M7Y A;  1QBQ B;  1D8D B;  4DOD A;  1LD8 B;  1H12 A;  3RX8 A;  1GXN A;  1N4Q B;  1FP3 A;  3RSY A;  1LF9 A;  3K11 A;  3SDV A;  2B4F A;  1JCR B;  5E2J A;  3Q78 B;  2IEJ B;  4GTO B;  4TF4 A;  1O1R B;  1FBO A;  1FT2 B;  3OED A;  1H35 A;  3W5N A;  3G6J B;  2A8Z A;  4D4B A;  4GTQ B;  1DCE B;  3E32 B;  1UG9 A;  1WZZ A;  3DSS B;  3S4C A;  1O6H A;  3A3V A;  3QG0 A;  3D5S A;  4TXT A;  4FXK B;  3Q75 B;  1K72 A;  1TNU B;  1X81 B;  3K7X A;  3PZ2 B;  2G0D A;  3E33 B;  2D8L A;  4Z4L A;  5FO8 B;  1HCU A;  3KLS A;  2I07 B;  3M7C A;  1G6I A;  3H2W A;  4BOK A;  4CJ1 A;  5JPN B;  1G87 A;  1GLM A;  1FO3 A;  1QSJ A;  1V7X A;  1TN8 B;  2ZIR B;  3EZ8 A;  4AYR A;  4D94 A;  1V5D A;  2FV0 A;  3W7S A;  2XQW A;  3QRY A;  4V1S A;  2XFG A;  2V3P A;  3S4A A;  3PZ4 B;  4AYP A;  1TN6 B;  5GZK A;  1NXC A;  3E6U A;  4KKJ A;  3X17 A;  1WU6 A;  2AHG A;  2DRQ A;  3HXB B;  3EU8 A;  3QXQ A;  1NI1 B;  2A73 B;  2CQS A;  3Q7F B;  2P0V A;  1V7W A;  2EAD A;  1S64 B;  3REN A;  1O79 A;  1N4R B;  2BB5 A;  4D4A A;  1VD5 A;  3E34 B;  1GA2 A;  1IA7 A;  3QT9 A;  1GHQ A;  1GXM A;  3EUV B;  2VN4 A;  1S63 B;  2WY8 A;  2VN7 A;  2GOX A;  2QNO A;  2WYN A;  2XWJ B;  1JCQ B;  4WVA A;  4ZH5 A;  3M7E A;  4GTR B;  1IA6 A;  1UMP A;  2OKX A;  2XWB B;  4GTV B;  1KZO B;  1O6Q A;  3SAE A;  3S9V A;  5KKB A;  1KRE A;  3M71 A;  3GZK A;  3HXF B;  4ZG8 A;  2H6H B;  1W6J A;  4LIX A;  4D4C A;  3WKH A;  3M72 A;  3E37 B;  1WU4 A;  5FOB B;  3M74 A;  1TNY B;  3KSQ B;  3S4B A;  1TNZ B;  4ONT A;  3QFZ A;  1V7V A;  1LD7 B;  3SFY B;  1H3A A;  4ZRP A;  1KWF A;  3E30 B;  3DSW B;  3OXU A;  1H37 A;  2BB6 A;  3DSX B;  3GT5 A;  2V8K A;  4WVC A;  3KQ4 A;  4FXG B;  1L1Y A;  1MZC B;  2D5J A;  2NOJ A;  3W7U A;  1FO2 A;  3M73 A;  1O1S B;  1H54 A;  4ZH1 A;  3SDT A;  2FUZ A;  3W7X A;  3M78 A;  1H3B A;  2WY7 A;  1FT1 B;  1C3D A;  2EAE A;  1SA4 B;  1KFG A;  1XW2 A;  2GH4 A;  2ZIS B;  3ACT A;  2H6F B;  3QPF A;  3KSL B;  3Q7A B;  2RGK A;  4GL3 A;  3QWT A;  1O6R A;  1G9G A;  4L0G A;  2V3N A;  4YDE B;  3HXD B;  3HXC B;  4AYO A;  1N9A B;  3DST B;  1N4P B;  1L2A A;  1V5C A;  3PYA A;  1F9O A;  3Q73 B;  3WKI A;  5CD2 A;  2JF4 A;  1GXO A;  4LNG B;  1R76 A;  2RI9 A;  1DL2 A;  3AFJ A;  4GTP B;  3DSU B;  3W7T A;  2CQT A;  2GZ6 A;  1D8E B;  4L9P B;  2ZBL A;  3RX7 A;  3EQA A;  4KTR A;  3WUX A;  3D3I A;  2F6D A;  2SQC A;  4JJJ A;  4FUS A;  1GSZ A;  4GTM B;  1O5M B;  5FO9 B;  4J5T A;  1H39 A;  1XWT A;  2V8J A;  1IS9 A;  1N4S B;  2EAB A;  1H14 A;  3ACS A;  3C72 B;  1TNB B;  3M77 A;  2YIK A;  4CJ0 A;  3VW5 A;  1ULV A;  1FPP B;  4MU9 A;  1JCS B;  3M75 A;  3PZ1 B;  3QXF A;  1GAI A;  2H6G B;  4XUV A;  3ANJ A;  1SQC A;  4MBG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...