2VN4A

Glycoside hydrolase family 15 glucoamylase from hypocrea jecorina
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
599
structure length
599
Chain Sequence
SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords GLUCOAMYLASE
publication title Three-Dimensional Structure of an Intact Glycoside Hydrolase Family 15 Glucoamylase from Hypocrea Jecorina.
pubmed doi rcsb
total genus 212
structure length 599
sequence length 599
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2008-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2vn4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vn4A02
1YEDB 3P9MA 5IW1A 1AO7A 5GGVY 4NZRH 4QXWA 3MCKB 1R3LA 1KLGA 2AABL 3MODL 2DLHA 4G6KL 3RPIA 1Q38A 1YEKH 5CEZH 3F6LA 4TPRH 1D3CA 4F7EA 1UZ6E 2O5ZL 1HQ4A 3MACL 4PJ9A 1IC4L 4OZGE 1PVHA 3TESA 1NAMB 1J1OH 2I07A 3JV5A 4ODBD 5DVMA 1R3HB 4HCRL 1D5BB 4XCFH 4DQOH 1VB9A 4X6FB 5CA3A 3EFDH 3CCHB 4JM2B 4DAGH 1AHWB 1RIHL 4YHPA 3SOBL 2IBZX 3DX6A 5K59F 4WWKD 2H3NB 1DUZA 1MHPL 1EXUA 3R1GL 4IOFC 5HJ3A 3WFCL 5IFAL 1R0AL 4Q9CA 2GITB 2A6KA 3MTRA 4XGZB 5EN2B 3OXSA 3NMEA 4YC2C 5T5FH 3NH7H 4NO3A 3WNPA 3BZ4B 1BOYA 1ZT7B 4GG6F 2DDQH 2I07B 3BP7A 5HGBB 4YBQD 4M9PA 4OZIF 1MWAH 3I3DA 3WUXA 3G6AB 4GRWE 1P7QB 1D5IH 2QHRH 3HPLB 1HH9A 5D7JB 3RA7H 3FAWA 2ENYA 3VXNA 1NDGA 3T2OA 3MV8D 4U7SA 2G60L 3UTQA 4Z7VB 4R90H 3JWDC 3REWA 3HAEB 3GSUA 1VGEL 3STZB 5HHPA 1PG7W 4NO3B 2YD5A 1UGNA 3QDMD 3PHSA 4HJJH 2DTSA 3SKJL 3QI9D 5T1KD 4DGYH 4BKLB 5DC4B 3SQOH 5IHUL 5F1NB 4OV5A 2Z8WC 5HDBF 5IB1A 1T03L 5BRZA 3QXQA 2HT3D 2Z8VC 3W9DA 1FCCA 3DVNA 4MJ2A 1ZGLM 1UXSA 1BFVH 3KPOB 1NDGB 2A9ML 1F00I 2X5PA 1IGCL 2WWMC 3NPSB 5JQHC 3QQ4B 1IJ9A 4YFDB 5FO9B 1AH1A 1W2KT 3F7YA 2BFVL 5AUMB 4PD4K 4YDVA 3P2CA 2Z8RA 1W72L 4GRMB 2AEWA 5DHVA 1I1YB 4Z7OF 5EU6A 1S9KC 4OV5B 2XIDA 4GS7B 2C7UA 2VERN 1IQWL 5IB1B 5JOPE 4NOFA 3W9DB 4Y4KA 2AGJH 1DSFH 3ARVA 3DVNB 2FX7H 1UXSB 2R0WH 5C0AB 1XF4B 3EGSB 1ITBB 3UTZA 1N6VA 3P4OB 2V7HB 4HPOL 5C3TA 2OR8A 1FBIH 3NOIA 1JK8B 3RUGF 1VEMA 3BVNB 1FO0B 3H7BB 5IK3B 5MENE 1MCWM 4G6JH 4N0UA 4Y5YB 3F7YB 2R0KH 3CVHA 4URTB 1K3IA 3GSNB 4O2EA 2X4TA 4D8PA 5EU6B 1Z9MA 2ARWA 2W0LA 1XZ0A 3R0NA 4DCQA 2MPAH 4IIQA 5GS1A 1G9MH 1RZ7L 4NN7C 4PRPE 4UT9H 1F11B 2ZUSA 1QYGH 3IETA 4AK1A 4RQQA 2OI9C 1MRDL 1B0RA 5E8DL 2B7DT 1NL0H 3P4MA 2PXYA 4WJ5A 3IDIA 4XCNA 1JF1B 4CMHB 1FZMB 2C1OA 3IFPB 1CCZA 4TTGA 1Y6MR 2YN5A 1NC5A 4KXZI 1S7UA 2D9CA 2QBWA 4PJCE 1DJSA 1CFBA 4RBPK 4PJIA 5C71A 1EO8H 1FNSH 4M8VA 1J0KA 4ZS7L 3KG5A 4IIQB 3ACSA 2Z35A 5ELIA 2BVUA 2R2CA 3IETB 3SE3C 4M62L 5JW4M 3MLYH 1X4ZA 3OQ3B 2PXYB 1WV7T 3IDIB 5DZLA 3VGDA 4YFEA 2C1OB 5IQ9B 4PJDF 4NJ9L 5D70L 3FFCE 3QUXC 4GMSL 1PW3A 1S7UB 3JV0A 2G9HA 4GRLA 4XUVA 4PJIB 25C8L 3Q5OA 3GMNA 4AYPA 2GK2A 1MCQA 3O6FA 5C9KA 1KCVH 4ZD3L 5DJAA 4I3RH 2P4AB 3TO2B 3IDNB 2PYED 3LKQB 3S36H 2DS4A 1OPGH 5H2BB 1A7NH 3VGAC 4FABH 1X5IA 5C0CE 5H37G 5JW3H 2E27L 1IGYA 3F12B 1CE6A 3CD4A 1S9YA 4ALAL 4W68A 2E9IA 4GRLB 2O26U 4BZ2H 3GSQB 4MA8H 4XWOC 1FNHA 4FQ1H 1ZANL 1MHHA 3LSOA 3MJ8B 3OB0H 4KUCF 4PJ8B 1C5CL 4PJEE 1V5JA 4OZHE 5DQDL 5E6IB 3BGFC 3SDDB 5DUML 4UNTA 8FABA 3GMMA 4PP2A 2E7BA 4L8BB 5DJAB 3UYPA 4JHAH 2NY3C 3WJJC 3WIFA 4V1DD 2HT4C 3R8BB 4X7SH 3RDTB 1EK3A 5IVXE 2ZCKL 1D5XA 4KQ4L 4RGMC 4N0CC 4QOKA 1S9YB 1L7IL 4R7NB 3L6FA 1EGJH 3FQUA 9CGTA 4GSDL 4MNGE 2H2SC 3FZUC 1KPUB 5J3HC 2VDNL 1KN2H 3RRQA 3IFNL 3ILQD 4FQCL 2NY6B 4HJGA 1JPFA 3NCJL 1CD0A 2IG2H 5L7XH 2FJFA 4BFIB 4BFBD 4JPKH 1WICA 1A7QH 4PJ5A 2HTKC 3KPSD 4AYQA 1JRHI 2W1NA 3QXDA 4K2UH 3WKGA 1OAZL 3DPBA 2BVOB 3PUCA 1J1XH 2EZ0C 4G3YH 3BZEB 4F37K 4HD9A 3L6FB 2FGWL 3I02A 3SDCC 5LBSH 3MRNA 5D7LD 3ZDXE 4LIQE 5LGKA 2CMRL 2GSGA 4LCWE 2I26N 1QNZL 1IZJA 4LLDB 1HCVA 2HFEB 3DECA 4HX1B 4JPWH 3L95A 4YO0B 3QHFH 4BZ1H 2FJFB 1MHCA 1JHKH 4KXZH 4Y0GA 4UV4L 4XPFL 5I19L 1O7SA 1WWAX 4PJ5B 3UC0H 4KVCL 5I30L 2ENSA 4JO4L 3UDWC 1U93A 3GSVA 4Q6IA 4ZTPL 5F7HA 3K46A 4YGAB 4QWWC 1MFAH 2YOCA 4NN6C 4OBRA 1KEML 4YX2H 5I66A 5C08A 3MRNB 3RUGE 2VABB 5DJ2A 1C08A 3VH8G 4Y4HD 3ZE1F 1HNGA 2YSSA 1HHIB 3KXFE 3E6FB 3ZTJH 2MSPA 1BX2B 1HE7A 1N3NA 1WBYB 3BZDA 2Y4SA 3BKJL 4GUPA 3FO0L 4MNQA 4DOHB 1LO0H 1LMKA 1WZLA 3GSVB 1B2WL 1BJ1J 3DO7A 3U0PA 3O4LB 2FX9H 5DJCA 4PG2A 1VFUA 5SWZA 2IPKA 5C08B 1RUQL 2FGZA 3MOBH 4KK6C 1Y0LA 4JFYB 5JORA 3V4VL 3GJEB 3IRZA 3P77B 2CUIA 5JIHA 5DEGB 4WV1B 1PEWA 5E99H 5E00A 4NYLA 1N3NB 3T2QA 4XBEH 2W0FB 5E1AB 1HHJA 1TVHB 5DJXB 1DQLH 4GBXC 5D1XA 4EDXB 4R7DB 3FRPA 4FP8H 3MBEA 3RVWD 4QT5A 3DO7B 4HMDA 5DMGC 5FDWA 1YN7B 4A2LA 5AWNH 3B9VA 1U6AH 1EA9C 3KPLB 4JDZB 2E9BA 4L9LB 2Q8AH 1EUTA 4QYOA 4OI9A 5JORB 2D7OA 5F9JA 2CRMA 3PWLA 1OGTB 2PTTA 4YHZH 3T0XA 3O3EA 2BDNH 2YA1A 5HHOE 4NKOB 3QWOB 3QEQD 1AC6A 3PIQA 3I50L 4FQXA 4ZUTB 4W70A 4H1LB 4K8RL 3HC0A 4LFHD 3WKFA 1E6JH 5KSAD 5EIIB 3EOAA 5CJ8A 5GGRY 4X80L 4B0MM 4WI3A 3WEXB 1KFGA 1I75A 2VZTA 3ULVE 5EUOB 3MRJA 2R4SH 3OTTA 3CVHL 4XH2A 1GOFA 3V95A 2BVPB 4WY7H 1IARB 5F9JB 3ULUL 3GBMH 4I3SH 4GMTH 2PTTB 4LARL 4WWKB 3V6ZA 3O3EB 4Z7VE 2B0SL 2X1QA 2CDEB 1SY6H 3MV8A 1Z6JT 1KXQE 1KSCA 15C8L 3S4SG 1PDKA 1HINH 1IAIL 1NBYB 1S7SB 3PWVA 1UCTA 1HHHA 3VWKD 2IFFL 4LSRL 3VDBA 2EKSA 5D1ZD 4U3CA 5CLWA 5HBBA 1G6RH 5EZIH 3QI9A 3PGDA 3MRJB 1KBGH 2HKFL 1F6LL 2AXJA 5DJ6A 4QHLB 5D96C 2VLKD 4IS6A 4JFOA 4N90D 3V5DA 1AD0A 3MV8B 3BP6B 4MNHA 1DQMH 5BVPH 1CE1H 5GIRA 2VLJE 5IB2B 1FORH 1HEZA 2G2RA 1SJXA 1WAAF 3QDMB 2ADJA 5TPWH 4JO2L 4YDLB 5T1KB 2FNBA 3Q6FA 1MPAH 2NR6D 1IM3A 1A6UL 5DJYB 1NCBH 2JK5B 3T1WA 4G8EA 5AZEH 3OR6B 4M02A 5C0AE 3B8YA 1AGEA 5C1MB 3V5DB 4LFHG 1U8IB 1QBLL 2YKLL 5IJKC 3F58L 4MNHB 5DEFA 1LEKA 1TCMA 3QBTB 1YY8A 3H7LA 3ILPA 4XNXH 5GIRB 1HEZB 3C5SA 5C70A 1OAYL 3L3GB 2XQBL 1AE6L 5IMOA 3QO1B 3M8OH 4JZNA 3HS0A 4MAYD 4P2RD 3OB0K 1LNUB 4EJ1C 2X1OA 2WBJD 4M03A 4O58H 5FCSH 1L6ZA 4AT6B 4AY0A 5EOCJ 2FJGB 2AV1B 3T0EA 1LD9A 2FWOA 4LCCA 4X5XA 1R5IB 3JUZA 3G6JA 4JB9H 3LQAH 4Z0BL 3QAZC 1EBPA 5DEFB 1HWGB 2VC2H 3RL1A 2JJUA 4Q9QH 5HYQA 3VXMD 1NGWB 1REIA 5GQBA 5D6DA 3C5SB 2ZUWA 5DFVC 3MRLA 3KHOA 3ROLA 5CSZA 3TFKC 5ECJE 3FT2A 2ADGA 4KDVA 3L3JA 5IB4A 1CD1A 1CLCA 3CFBA 4JZNB 3HS0B 2D7PA 3B8SA 4JDTL 4AG4L 4R3SA 3D1MC 3X14A 2IQ9H 3LEVL 5BQ7B 1LO2L 1NJ9A 1YC7A 3MV7A 3EOBB 1QLRB 2FWOB 2XNAA 2FR4B 1NGZA 4Z76A 1GGUA 1T7ZA 4HXAH 1SM3H 1ZVSA 3IXTB 4NQED 3G6JB 2P8PA 3STLB 1ORQB 5ALCH 2IEPA 4M3KB 4F2MB 4LCYA 3RL1B 1RD6A 3KDMA 4XC3L 5HYQB 1TVDA 4CN4A 1K5NA 1T89C 4D9QE 3QIUD 3P73B 4NRXA 4P3WA 5CSZB 3SDAC 3FT2B 4WUUA 2ADGB 3L3JB 2ITCB 4NQTA 4OQTL 4I2XA 2VQ1A 4R3SB 5I8CB 4R0LC 2RI8A 3UAJD 1NBVH 4FZ8H 1CR9H 3C5ZD 1DEEB 2HTLC 2XNAB 1BQHA 2EIZA 5SV3A 2NTSP 1T3FB 3VI4E 2GAZB 3C2AL 5J13B 2DQHH 1OTTC 2P8PB 4LVHC 1GA2A 3MUY1 4OFIA 2R29L 1YYML 4WDIA 3ARPA 3FHQA 2X89D 4JM4H 3T4YA 3RIAK 4RX4D 5A2FA 5F88A 5GGUB 4X7DC 2EECA 3WIIH 5DXWA 3WS6A 1C5DA 2Q87A 5DFTA 2WLZA 4IDJH 1KWFA 4AEHH 3HI5H 5F96H 2UZYB 1WC7B 2EXWD 3UTPE 1BQHB 4KMTH 5DD0L 2EIZB 1OTSD 3ARGD 3GMRA 5IM7A 4DN3L 2PYEB 1OLLA 2L4OA 2LVEA 3I2CL 4X98A 5FOBA 3RP1A 4Z7NE 3TBTA 5E8NB 1IC7L 2YD6A 3MGTA 3PWNA 3OZ9L 1NDMB 4IRJD 5D7SH 4NQVA 3LS5L 4XCEA 3BN9C 4H88H 3BWUC 3L5XL 4XB8A 4FG6D 3S35H 3VWJC 3X17A 4I0PA 1OAXL 4EI6A 3O45A 4Y2DD 4OV6F 1NKOA 2OJEA 4TSCH 3VFMB 1ZLUH 3VXSA 5CWSA 4FXKB 4WNQA 3GMRB 3WJLC 4LLYB 3DLQR 4JN1H 1YMHB 3AROA 3MA7B 4JKLA 2XFXA 3DARA 5CIPB 5JLZA 3RX7A 4V1DB 4QY8B 1A4KA 3KPSA 3HNVH 3LN5B 3QPQC 1D5MB 2Y07H 3KYKH 4HKJA 3T77B 3MGTB 3O41A 2NYYC 3AS2A 2B2XL 3TWCL 3LKNB 4F80A 5AG8A 4LSQH 3G04B 3BYTA 4BQBA 3MRFA 4EI6B 4J3UA 5I1CL 1OF2B 4ODVH 2OJEB 1AIFA 1KTLB 2ARJQ 3OAZH 4NP4H 1H3PH 1WAAE 5DVNA 5J6GB 1SBSL 3PGCA 3TZVC 4S2SA 3TYGL 3I9GL 1UKTA 3SBWA 5D8JH 4R26L 3WDIA 1TDQA 3D3VE 5JLZB 5DDHB 5F7DA 3KPSB 4YPGA 5F9AC 3SDYH 3ESUF 2XXMB 3RWCB 1RAMA 1B6DA 1EGJA 2VDML 3TF7C 5KS9A 1QUNA 4XNMB 5D7LB 3AM8A 2IPUG 4PTUA 4XHJD 3X11B 1LHZA 4PJAF 4YUEH 1ZHKA 4QRPA 4NZRL 3SE9H 1OY3B 3V6FB 1YEKL 2J8UA 5CEZL 1BP3B 4TPRL 4DOHE 1M05A 2YA0A 4FNLH 2HJLA 5ID0A 4RISH 1I8LC 3FJTA 4PBVC 4HT1H 2DYPA 4PV9A 5KS9B 3TF4A 2NY1C 4JFXB 1KB5B 4KI5E 1T0NA 1J1OL 2P49B 3RENA 2RQ8A 2BNRD 1KIPB 4XCFL 4YAQB 4DQOL 4TSBH 3HZYA 3MRKB 5E7FA 3MRMA 1JL8A 1Q9LB 4DAGL 4I4WB 2D2OA 4B7LA 5IR1B 4Y4HB 4P46A 1ZTXH 1T1WA 5J56B 2W60B 2H32H 1T1ZB 3MCLH 4NQDD 5C6PB 2J8UB 5T5FL 1PYWB 3V0VB 4WHCA 3SY0A 2EDOA 4F8TA 3NH7L 2MFNA 3P11H 4IRSC 4MB3A 4OF8A 4YHNA 2DDQL 4LNVA 2FSEA 4KK5D 1V05A 4ZO7A 1N5YH 1VD5A 1MWAL 4YE4H 4UQ3B 2QHRL 1D5IL 2VZ3A 4MXQD 1T1WB 3RA7L 3QEQA 4XBGB 4ODWA 5H8DA 3FQNA 5EOCH 1CGYA 1FO2A 5KSAA 4DVRH 2JF4A 5GPRA 1UXWA 3TVMD 2F53A 2NCMA 4NKQB 2VXSL 4HWNA 4R90L 3SY0B 5CZVL 1EEZB 4N8VB 4D0CB 3UJIH 3FCTA 5FUOH 1XR8B 5EUOE 5E5RB 2NY5C 3SGJA 1CLOL 4YHNB 4HJJL 3IF1A 3GHEH 3CFDA 2FSEB 1Q8MA 2OXHA 4DGYL 4UIKH 1KELH 4F8QA 3SQOL 2RI9A 5CJ5A 4PTTB 3WNKA 1UWEH 5FO7A 5F89B 5FHBL 3BD3A 3QEQB 5EO0B 4ZUWB 2DJSA 4KRLB 5E94B 1BFVL 1T21A 3WO4B 2IF7A 4FUSA 3C2SA 2CSPA 2H6PA 5KSAB 4Y4FC 3BMVA 4KQ3H 4I13B 4OFDA 1MFNA 3EYQD 1KACB 4OCSH 2FEDC 4X4XB 1Z2KA 5EC1A 5I8OH 3IF1B 3CFDB 2FO1A 2ZUQB 2X10A 4HS3B 2DWDB 4PV8B 5FYJH 1T0MB 4OF5A 2DM3A 3FOLB 3QQ3A 4XZUB 4L4VE 2AGJL 1DSFL 4LLWA 2FX7L 2R0WL 4KPHH 1KJVB 3VFSB 3KAAA 2PR4L 4P57A 5F1IA 2CJUH 3QDME 4HS6B 4XNQA 5F6HJ 4X4YA 3VWKB 1BZQK 4PB9H 5D1ZB 2R0KL 1QBBA 1U2HA 3DX7A 2KKQA 4Y5XB 4PRID 4LRIA 3TPUA 2GJJA 4PLKD 4X7FC 3X12A 2R2HB 4M6MH 2WZPD 1QQDB 4AIOA 2MPAL 1G9ML 2RBLA 2PO6A 5IHZA 2VLKB 4XRCB 4Y1AD 1QYGL 1Q9OA 3OAYH 4NC1E 5INCB 4PRAB 3ECBA 1NMCB 1PG7L 3QHTC 1GYAA 2J12B 1OL0A 2AHFA 2V2XA 1XIWC 4ODHH 4XP4H 3VXUE 4MD5B 5F1IB 4WU5B 1JZ7A 7FABH 3V5HA 1G6RA 5EOQH 4X4YB 3Q3GA 2OKXA 4TUJA 1O5DT 3L3KA 4MQXC 3FO2B 1KIQA 2R1XA 3TPUB 1OAUH 4BELD 1FCGA 3X12B 2R0ZH 5HHQB 4JO3L 1EO8L 1FNSL 3QEHA 3MJGX 5GRUH 1MCSA 4TUOA 2RR3A 4LF3B 1Q9OB 2WWKO 3MRIA 4OQ1A 1P84K 2CQTA 3BXNB 1X6NA 1EAJA 3FMGH 3TC9A 1QSZA 2V2XB 3MLYL 2D7TL 1UEMA 2I5YH 3IAGC 3JWNC 3OHXA 4L3ED 3IKCA 1LK3H 2DQJH 3KNBB 1BLNA 5K9KB 4P9MH 4Y19A 4LDLB 1TQBB 4HIXH 2NY2C 4MAYB 4P2RB 1RV6X 1G0XA 1KIQB 2WBJB 5BS0D 2NXZC 3C60C 5J12B 4GQ9H 3SGKC 3QEHB 2PW2B 4I18A 4TUOB 4S0TD 4KV5E 4ODSH 1DN0A 5KSBF 2ZNXA 4I3RL 1MLBA 1BD2D 4IOIB 5HYFA 3K2UH 4Q7DA 4RAHA 4UOW1 2X42A 3VXMB 4CKVX 3S36L 1OPGL 4JQXC 1A7NL 4NZTH 4ZOCA 4HZAA 4FABL 4DOEA 5JW3L 3FL7A 4R97C 5IFJA 4BZ2L 5MI0C 3RHWF 4MA8L 2FRGP 2OMNA 1T4KB 2EXYC 1E4KA 3DSNA 3OAZK 4JRXA 4KDTC 4FQ1L 4CBPA 3HMWH 2B5IC 4PJFF 4I18B 1DN0B 4NQEB 4HHAB 4P0DA 2HG5B 1U0QA 2H2PC 5F6HI 1MI5A 4JHAL 3ZT5A 1MIMH 1P2CA 1U42A 4U4BA 1JWSA 1DBJH 3QO0A 3K4DA 3QIUB 4X7SL 1H5BC 1HIMH 1I7ZA 4JG0H 2X70A 3HZKB 4P23C 5JW4N 4G6AC 4JY4A 3H9SD 1A1OA 1EGJL 3S5LG 4JE4B 4Q9RH 1YECH 3C5ZB 3TCXA 3VFVA 4G8FA 1QKZL 1KN2L 5T3XH 3BDYL 3ARED 3ARGA 2Q86A 3MZGB 4XAWH 1AXSB 2F54D 1OAQH 3ZDYE 1PD6A 3LHPH 4LSUH 3DV6B 4OM0H 2IG2L 3S36X 2JCCA 1K3ZA 4HWBH 5L7XL 3NCCB 3T2NH 5FHAL 3QO0B 4JPKL 4Y8AA 1A7QL 1DQJA 2C3VB 3D39D 1CF8H 3L3OA 5I71B 2X70B 4WFHD 5I8EA 4K2UL 5L8KB 4WGVB 1J1XL 4G3YL 1N6QH 3C8HA 4K7FB 1A1OB 1WZMA 2CO6B 4TNWK 3TGXA 4ZO8A 4X6BB 5T1DH 2P42B 2GQHA 2ESVD 5BZWA 5E4EB 4IEFB 3ARGB 2Q86B 4PY7A 1DBBH 1QPXA 3T0BA 1KSDA 3EZ8A 1DLFH 3BH9A 1N7MH 3DROA 3HRZA 4JPWL 4XPTH 1NLBH 3QHFL 2BRRH 4JKWA 4BZ1L 1JHKL 1JZ4A 4XVJH 2JLLA 2YUWA 3UC0L 3FFDB 4MA1B 3VGEA 4ONHB 5JXEA 1UM6H 4IRJB 3RNQB 4GKSA 1MLCA 5F7UA 4RSVA 1MFAL 3PP3H 5JHDE 5HGGS 5KANG 4YX2L 5I0ZA 1B6UA 4LKXB 4PJBE 5ILTL 4Y2DB 3ACTA 3WXVH 4K94C 4MJ6A 3AY4C 5IVOA 1XR9B 5C2BH 5E5MB 5D9SA 1AXIB 2UWEF 1PSKH 3HRZB 4KH2A 1IGJA 4QRRA 3RZWA 4FZEH 4M43H 3QA3B 3QXVA 4BQ8A 1JJUA 4IJ3C 1LO0L 3MMEB 3TIEA 1FAEA 2RFXA 2XN9E 5D7LE 1CU4H 1EEUA 5I74C 1X44A 5LWYH 3MGOA 1LE9A 2FX9L 1HSAA 4MCZA 3RNKB 4R8WH 2WWKT 3D0VA 2IPTL 3MOBL 4N68A 4U1GC 4WU7A 2AERT 2FEEL 2JJSC 3GLYA 4O4YH 4WHTA 4IOFD 1MUJA 2D0FA 5I76B 1IGJB 2GT9B 4NWUL 5E99L 4XBEL 1A7RH 4M93C 3IJYA 4YDJA 1AGMA 1RK0B 4YHKH 1ND0B 4Z7UB 1DQLL 4HUWB 4FP8L 3QUYC 2WUCH 5DJ8B 1QZ1A 2L7JA 2BNRA 5AWNL 4AYFA 1U6AL 1GHFL 2R2EA 3QFYA 4WHTB 3FRPG 2KL6A 3LZFH 4D3CL 4YHZL 1CICC 2BDNL 3JSSA 4RFOL 3Q48A 4WU0A 3IJSB 4NQDA 1FNGA 1E6JL 4O2FA 2RB8A 5DZNA 4JFDD 3VXTA 3RJQB 5D93B 4QHNB 1KCKA 1SJVA 4RWYH 3OJDB 3C5JA 4P3DB 4PJXA 3ARYA 2LTQC 2BNRB 2VXUH 2OP4H 2W9LA 3U36A 2GKIA 2YPKB 2R4SL 1QG3A 4YPJA 3E8UH 2D7NA 4WY7L 3OAYK 4JFZH 3CVIH 5C0RH 1VADA 3GBML 4I3SL 4IRZH 1FC1A 5ITBH 3FT3A 2DBJA 4GMTL 3V4UL 1GZQB 1IRAY 4NQDB 1SY6L 3RBGA 2MCPH 4AMKH 4CU8A 2WWMD 3CH8A 1TFHA 2QQLH 1OAKH 2N7BA 4RFNB 3WUWA 1HINL 4K55A 4PJFE 2MJWA 3VXTB 5DD5L 1MQKH 4D2NA 1I85A 1AGCB 1G6RL 2IH3A 2VAJA 5EZIL 3ULVC 4PJXB 4JGJA 1EEYA 1KBGL 1H13A 2EIBA 2ZOKA 5D7JC 5FECA 3QULB 1F4YH 4M7JL 2YBRA 5MEQA 3OKEA 1I9RH 1UACH 3JTSA 2E9JA 2H32A 3D6GA 1DZBA 1FYTD 3EDJA 3CXDH 2ZUYA 2EDLA 3L3IB 2VR9A 1DQML 4EQ3A 4ZUVB 2APWA 5D5MA 1VACA 3TVMB 5BVPL 4J3SA 2V5RA 4XMPH 1CE1L 3O11B 3P9LA 5JIIA 1S8DB 4CADA 3M07A 1FORL 1I3RB 3HG1E 4FXGB 2NQCA 5HYIA 2FBOJ 3ZO0A 1MPAL 3MROB 2D31A 2CPCA 4LCIH 5FECB 5I16A 1YNKH 1RUKH 1NCBL 1LO4H 5AZEL 5T5NG 3EFFA 3CUPA 2DN7A 2Q3AA 4JJ5A 3IDGB 5M7YA 3EOYG 3GSXB 1T5WA 4WIQA 2V5TA 5BV7C 4JFHD 4OLVH 1F9DA 3KPPA 1G7QB 3K81A 3NGBB 4XNXL 4ODXA 5JPMA 1CXLA 3DJ9A 1FSKC 2NXYC 2IBBA 2YPVH 1INEH 4O9HL 1UB6A 4PRIA 2CIKA 4GS7C 1FFPB 1W0VA 2KBGA 1JF6A 3AAZA 2VLKE 4WHYH 2XWBA 3HTLX 1F5WA 1ADQH 1QBMH 4N0FA 2AFAA 4X7CC 4XXCA 2C5DC 4Y88A 4JB9L 3PHQA 1TCRA 2D5JA 4EUPG 1FFRA 3LQAL 1S9WA 2BCKA 4JVPA 4OCNC 2VC2L 4JKPH 4Q9QL 1NFIB 4U1HB 2APBA 4LLMA 5C6TH 4FA8A 3QUXD 1KGCD 1KIUA 2XOTA 4ODXB 4NBZB 2BMKA 2A9NH 5IW6B 4X7EC 1A7PL 2P5WA 3V6OA 2GH4A 4PRIB 1UENA 4O51B 2IQ9L 4D9LH 4BQ6A 1W0VB 1SEQH 5EZLA 4O5LH 4JAMA 1OW0A 1GAIA 1PZ5B 3AU1A 3FQXB 4N0FB 1I8KA 4HXAL 4M4PA 1SM3L 4Y1AB 4GAFB 1J87A 4Z0XB 1U92A 5JZ7C 3FB5B 5ALCL 2BCKB 5K9QG 5C3LD 5IBTH 3K8LA 4K71C 2CDFB 4ONFH 5KSUA 5CBAB 2OL3A 5C0JB 3RWFA 3NCYS 3RTQC 2YC1A 3B4NA 1VGKB 3P0YH 4P2RE 4Y5VA 3K1DA 3MREA 4HGKC 4XWOD 4GW5A 4Q2ZA 4ZO6A 5CLTA 2NX5A 1NBVL 4FZ8L 1CR9L 1G9NC 3ZKMC 3AU1B 3CFEB 1CI5A 4WGWB 5HYSB 2NY3D 2VN7A 1I4FB 5IBUG 3VXME 2DQHL 3HR6A 1U92B 5C86A 2VDPH 5I1DB 5KVEH 5LGJB 4F57H 2HT4D 5KSUB 3ZE2E 1X4YA 5IKCB 4L3EB 1G7IB 1ZS8B 4JM4L 5B8CC 2OL3B 5I1AB 4N0CD 4U6HA 1U8PB 1PQZA 3OKDB 2CH8A 3PP3K 3K1KC 5EA0H 5SX4I 2GCYB 4WVCA 4Q2ZB 2H2SD 3QIWA 3FZUD 5BS0B 3UTSE 4PRNA 5J3HD 1CXEA 4IDJL 4AEHL 1ZXQA 4NQEE 5HY9A 3HI5L 1I3VA 3CZJA 4JFED 5F96L 4KMTL 3HMXA 4ELKB 3WS3A 4M1DH 3PE9A 2IMMA 5HYEA 1X4XA 1BD2B 1OP5H 2HTKD 3MNZA 1UADC 5LJYH 5I6XC 1U8HA 1FNFA 3N9GH 4U6HB 2EZ0D 5IB5A 1YPZA 2HA1A 5D7SL 3ULSB 3ARUA 4H88L 3HLAB 4UTAL 3ULUF 3S35L 1I1AA 2YD4A 5ID1B 1DLHA 4D0BA 3AREA 2CLZB 3BO8A 1RZGB 4LVOC 2GTZA 4JN1L 2ARJA 3MNZB 1H8SA 2F8XC 3NAAH 5T33H 4NFDA 4ELMA 4HG4J 4MQ7B 3HNVL 1U8LA 1WBXA 5ISZD 4QWWD 3BEWA 1RZ8B 2X4QB 1FO3A 4XNZB 4J4PC 1QSED 2WYNA 1DE4B 3H9SB 1XGUA 1IEBB 3HRPA 2VIRB 4OCXH 4PY8J 4PJIF 4NHUB 4LSQL 3JV6A 2HFTA 1FQ9C 1DLHB 3AREB 4G9FD 4RNRB 2F54B 3SO5A 5KN5B 4NP4L 1H3PL 1KIRA 2A74B 4YHOH 3U9UA 3GEWB 3QDJD 4F7CB 2GTZB 1G6VK 1IM9A 3WFDL 3TLRA 3S96A 1VEPA 1Y18A 4NRZA 3D39B 4ZSOB 1U8LB 1ZHBA 1QRNE 1IILE 1NBZA 5JDSA 3WIQA 4WW2A 1WIOA 3QUMH 3JV6B 5ITFB 3HE7C 2AJSH 2ESVB 4JFQA 5BOZG 1NCNA 4NN5B 5TF0A 3BP4A 3ZKSD 3DGGB 4HWBA 2EH8H 4QEGA 4UU9A 2DIAA 5DF0A 2GUOB 3SE9L 2A73B 4MWFA 3QCVH 1Y18B 2MWCA 4GBXD 3P4NA 1PX3A 3TV3H 1DDHB 2VAAA 4FNLL 5DMGD 1HZHH 1T83A 3UTOA 5TDPA 1N64H 3D85D 3MV01 4HT1L 4ORGA 3RY6C 3EYUH 3E2HB 4X6EA 1V7NH 1U3HC 3MLXH 3MRDA 2VL5A 4NCDA 4WW2B 2C1PA 1CGXA 4AQOA 5CP7B 4RGOH 3BP4B 2BSRB 3MNVA 4NRYB 5FYKD 1ZTXL 2IANE 1U8OA 2Y36H 3MOAH 1XF3B 5E6YA 3ME0A 5C07D 5CJBA 1KT2B 3MCLL 3VRJA 1WU6A 5KVFH 4Z7UE 1CQKA 3U0TA 1A1NA 1A7OH 1KPVB 5SX4H 4W6WB 4LAQH 3GI8H 3KWWA 3P11L 4PJHA 2XV6B 4QGYA 2NVPA 4HUKB 3O6LH 4BSWB 1ZHNB 5DK0A 5I17A 4L6XA 4JR9H 1JWUA 3JZ7A 4NC2B 1N5YL 4KK8C 1PLGH 1KRFA 2Y5TA 4YE4L 5DD6A 2EDNA 5E2VH 4CN6A 5JOEA 4YC2B 1GAFH 5FO8B 5T1LD 5EOCL 4BSJA 1QVOB 3OXRB 4N9GB 1S9XA 4X6DA 4RDQG 1ES0A 4DVRL 2X4NA 4JFDA 4HF5L 3BPCB 3P30H 4P9HH 3PQYB 4PY8I 4D9RE 1E27A 1IL1B 3UJIL 4PJHB 5FUOL 1Q0XH 4EVNA 1XGPA 1KLUB 2VITB 5F7MC 5DK0B 5I17B 1U58B 1FNLA 1O0VA 2OBGA 3NFSH 3ZT6A 4CGTA 1KELL 2DLIA 3HPJB 1TIUA 3PHOB 2Q7YB 4ZXBA 3OG4B 1OVZA 4LLQB 4CNIB 2WM0A 3OMZA 3UEZA 1UWEL 4F7PA 4HIJA 3KPRE 5ACZB 4X0KB 1MVFA 5E95B 3BE1L 3I6LE 4KQ3L 5KW9H 1XWTA 4NM8H 4JFDB 3SN6N 4Y7MA 4Z7WB 1QO3B 1CL7I 4UB0L 5I8OL 2AS5M 1FRGL 4MD4A 5DRWA 2Z07A 5FYJL 3HCVB 4ZOEA 1FVDA 4LNRA 4N0UE 1RZFL 4JY5H 4PB0H 1UVQA 1DANU 2VR4A 5C09D 1FG2A 1ZVYA 2G5BA 4KPHL 2NNAB 3O2WH 4EUPB 3QEGH 2FO4B 3EO1A 4DKDC 5IF0A 1G7PA 5TGBB 5BW7A 2CJUL 3FONA 1MJUH 1UA6H 1JI1A 3TA3A 5EFIB 4AENA 4KMQA 1AR1C 4LMQI 2HLAA 3MCG1 4NKMB 5DRWB 2Y7QA 1K85A 4L4TD 3BEVB 4LNRB 5CCKH 1INQB 3KPQB 1FYTB 2F8VA 1PKOA 2PKDA 1T2QH 4F7MA 1QA9A 4U1NA 4CRPA 1C8PA 4EL8A 5IHBA 2QTEA 2CUMA 4ODHL 4DJMA 5DFVD 2EACA 3B9EA 3VFTA 2E7LC 2YIKA 7FABL 4J2XA 5EOQL 3ZDZF 3D3IA 4LRNH 2CR6A 3DRTA 4KKAC 1CDUA 3MYZA 3WNMA 3U7YH 4G8GD 1A14H 4HLZG 1WITA 3CU7A 4NNYA 3KLSA 1OAUL 4S11A 4S0SD 4NN7B 1OGAA 5ERWB 3HC3L 2HWZH 5GRUL 3SE3A 4Z7QF 4OIAA 4XBPA 3WYRA 2OI9B 3W7SA 1N4XH 3SDXE 4X6CB 3MLVH 3FMGL 5B39A 3BT2H 4WVBA 5DVOA 2I5YL 2KZ1B 5FAAA 3L5IA 1ZA6B 3SDAD 3B2UC 3FN9A 3HFMH 1LK3L 2DQJL 3EO0B 4P9ML 3WHXA 3UBXI 4HIXL 2A2QT 4F58H 1H14A 4R2GC 5L0QC 5SWSD 2HTLD 3QEUA 3QNZB 4WFED 4GQ9L 4Y1AE 4EDWH 3LRSA 1OTTD 2ZUXA 1QHOA 4OCLC 2EKJA 5DMKB 3CMGA 5J6HA 5DHYA 1BPVA 4HFWB 3K2UL 1CBVH 3MX0A 3QUXB 5GGQH 1KJ3H 3SCMC 4ETQA 4NZTL 3WKNA 1OTUC 5F3HB 4NBYB 4KY1H 3LKPA 1RUAH 4F37F 3MRCB 1FNEB 1RURL 4H26A 2PW1B 1NEUA 2HRLA 4M8QA 2ICEB 5EBWA 5I2IB 4IHOB 3FQWB 3FN0L 3H42H 2NTFB 3HMWL 2YR3A 4LVNC 4PS4H 5CMAA 4QOKE 3TO4C 2EIEA 4RZCA 5C92A 1FYHB 3WJJA 3QDAA 4WW1B 1J9CT 3FT4A 4X4MA 3NZHH 4L3EE 3TH3T 3ALPA 3HN3A 5J6HB 1MIML 4EI5A 4P4KC 4KHTH 3W0WD 1Z9OA 3U9PL 1DBJL 1ZLSH 3C08H 1WTGT 4ETQB 3TBVA 1HIML 1T66C 5D2NA 2YPLE 2EDDA 4JG0L 4P5KA 5BS0E 3BN9D 1WFNA 1U3YA 4NFCA 1CG9B 1U41A 2X41A 4ZAKC 3VWJD 2R2BA 4S1RL 1WVZA 1DL7H 4M8QB 2AXFB 4U6YA 4Q9RL 3BGFB 1YECL 4JFEA 4E41D 2V2WA 5IP4A 1KKTA 5T3XL 2EIDA 1BD2E 1DQQA 2NY3B 3SEPA 5HHXH 1AKJD 2EO1A 4HH9A 5E8EA 1X5HA 3LHPL 3LKRB 5ENWA 4OM0L 2L7UA 4RIRA 4HWBL 3PWPA 1MCOL 3G08B 4L29B 4OLZH 3QPQD 3RKDC 2VLMD 1UH3A 4LOUC 2DIBA 3E6HB 2EEBA 3U1SH 1W8NA 2NYYD 2UUDH 3BKCH 4YHLH 3TBVB 1CF8L 3W7XA 2G5RA 2XRAH 4ODTL 4CVZA 1OSPL 1T04A 4A6YH 3SDCA 2VR5A 5E9DD 4I77H 3UTTD 2JG0A 2W91A 1KENH 3Q5TA 3QDHA 4BFGA 4U6YB 3SKOB 3NIDF 3HUJA 5T1DL 4M7KH 5BMFH 4LPTA 4H25A 1A6ZB 4WEBH 5SWQA 3TZVD 2I9LB 1DBBL 3G6JF 5JMRA 5E8EB 2WQ8A 1DLFL 1K9TA 4XPTL 1KF9B 4OUUB 1NLBL 1YJDH 2BRRL 1K8IA 3GRWA 3SGEI 4YDKH 1TLKA 1FV1B 5KZCD 4XVJL 1I7UA 5IWLC 3QRGH 3H9SE 4E0RB 3MLTB 1RPQA 2E3VA 1FLRH 1LWRA 2YD3A 5CBEA 1BMGA 1P7KA 2F54E 3HUJB 3HI6H 5DJZA 4G9FA 3WXVL 4DFHA 4MA3B 1WZZA 2R69H 2D0GA 2P8MB 3DX9A 3RVUC 1OWWA 5C2BL 3RY4A 4PJGB 5DYOB 1KULA 4FHBD 3D39E 3T65B 3FOMA 4ZSOE 2IJ0C 1K8IB 2BP3A 2PCPA 1JMXA 4FZEL 3V9FA 2O5YH 3CFJA 3MO1A 5ISZB 1BF8A 2NY1D 4NN6B 2F5BH 2VO5A 3L5JA 3MR9B 1QSEB 1IKNA 1CU4L 4HXBH 5LWYL 5DQJB 2ESVE 5DK3A 5ICYA 5HSFA 5CBEB 2VDLH 1JYWA 4XCYA 3V7AG 4R8WL 5H35B 4HIIB 3VXPA 5EU4A 1IGFL 3QG7H 1X5ZA 4O4YL 4YFLI 3S9DB 5LAXB 3DX9B 3QDJB 3DV4A 4GBXA 5EOTA 1A7RL 1A9EA 4IRSD 4YHKL 5D2LE 4DUVA 5JOFB 1WGOA 3L7EA 4PRHA 2FIKB 2BSSB 3W5NA 2VZSA 1MRCH 1HH6A 1A3RH 4XCYB 3UPRA 1A47A 5EDXA 4PGEA 2BVQB 5IROA 2QV2A 5EU4B 2AJZB 3RGVA 5J4MA 2Y23A 2X09A 3G5VA 2APTA 2IADA 4OLUH 1J5OH 4YHIA 5M7QA 5GS0C 3V0WH 2LE9A 2HJFA 2PETA 1G7LA 3MV9D 1MFEL 4GBXB 5CHNB 5EOTB 3VXRE 1MAKA 1FZJA 5CEZE 1OD9A 5EULV 5C0EB 3D85B 5I1LA 3L7EB 3K2MC 5FUZH 3LEYH 2MKLC 3RQ3A 2OP4L 3N1FC 1H12A 2V17H 3E8UL 5J9PB 4JFZL 5C0RL 1A22B 3DI2B 5ITBL 4IRZL 1H54A 1GC1C 5C07B 1JIBA 4Y4FD 3OPZH 1PX4A 3UZQA 2QKIA 2MCPL 3PQYE 3D18B 1JFQL 2QQLL 1OAKL 1GZPB 5I9QC 3L7FA 2FEDD 2HP4A 3RX8A 3K74B 3PWUB 1MQKL 3L3HA 4PIRF 4J6RH 1AGDB 1AQDB 3W81A 4NZDA 1MHPH 3R1GH 2JELH 2UYLA 1F4YL 2W9EL 1I9RL 1UACL 5IVNA 2BHUA 2AV7B 1OB1B 3EYVB 1NFKA 1T80A 3AMLA 5T1LB 3CXDL 1VFMA 4JN2B 4NNPH 1INDH 1MAMH 1TVBA 5C2UB 3MPCA 3CSYB 5BO1H 1RSFA 5K93A 3RVWC 1OCWH 2BY3A 1B0WA 2WAHA 4Z7WE 5JIPA 2WUBH 2X4SA 4G8IA 4HG4K 5I15H 5KS9F 5A43C 3BPLC 3FQRB 1PY4A 3QJFA 1C7SA 5HI5C 2IAMC 1DL2A 4LCIL 4N5EC 3GIVB 1RUKL 5D96B 5DK2A 3ZYIA 1UEYA 1J8HE 1LO4L 1RZJC 4U6XA 4LSTL 1DOGA 5FK9B 5ANMA 1UYWH 1NEZA 5FOJA 1XIWD 2J8UF 1IGTB 1T2JA 3ARFC 3O3UN 4X9BA 2IALA 2FH6A 5IB3B 4OLVL 1RUMH 1CD9B 1EHAA 5TDOB 5MEND 5HGDA 5HVGB 4WENB 4HWZA 4R96A 5E08H 1HQRA 1FIEA 4G8IB 4MQXD 1Q94A 1ZKAA 2YPVL 2YXMA 1T6WA 2PTVA 3BW9A 1F97A 5EH1A 3IAPA 4M6OH 4L4TA 3QFJA 4TOYH 1GAHA 4PRPD 2Z91A 1PKQA 4ZFZB 1FYTE 4OJFH 3A3VA 2A9MH 5C09B 1QBML 2EEAA 4FMKA 5J1AB 5ANMB 5D7IA 1NEZB 5MP6H 3QJHA 4LHUA 1IQDB 3U2SB 3A6BL 3MUHL 5CD5D 4KHXH 4JKPL 4KI1A 1S7XA 4XAKE 5C0BE 1L0XA 4H8WH 4ZDHB 3RIAF 5C6TL 5HYJA 2A9NL 2NY2D 4RWHA 3IFOA 1CT8A 2NXZD 3C60D 2CKBB 4G8GA 4I0CC 2CIIA 4HIEB 4RDQF 4D9LL 4L4TB 1SEQL 4RAVB 1OD7A 1RJYB 2XG5A 3QDGA 4O5LL 3V8OA 5B3JF 3MZTA 1YDPA 4X6CE 4HPOH 3OKNB 3B9DA 5C0DA 1UG9A 1G84A 3QAZB 5D7IB 4I2XE 3UPCA 5B4MC 3PG2A 1XF2A 4L3AA 4UTBH 1T89A 2UUDK 1RJZA 3N06B 5IBTL 4ONFL 4PJ7B 4LLUA 3VJ6A 3X13B 4GXVH 3FFCD 2EO9A 3P0YL 5GS2D 1IVLA 2PNDA 3AC0A 2B39A 1CT8B 5K9OB 1RZ7H 3QXTA 2EXYD 4G8GB 4J3WA 4XP1H 4IDLA 1P4LB 3U82B 2Z92B 1JHLH 3ARBA 3OKKB 5DRNA 4WO4C 5ICZB 1LGVA 2C26A 1YDPB 2XWTA 1QR1B 1VESA 1QLFA 3H2WA 3PMMA 2H2PD 5HHNA 5D1QC 3IJHB 4LQ1A 4O2CB 2VZVA 1GRWA 3GMOB 3GZKA 5FYLH 1RJZB 1R5VA 4OCYH 1KGCE 5KVEL 4F57L 3JBG7 3PXJA 3VFWA 1UJ3C 5C0CD 2Q6WA 5L2JB 3BDBA 2ZUVA 3SDAB 3DVFA 4P23D 4G6AD 1U8KA 2VQUA 1KYOJ 4JY6A 2EH7H 5CGYC 2CDGA 4R0LB 1F4HA 2ZUTA 5EA0L 4U1KA 1M7IA 5HDOA 3ROOA 1F8TL 1R6VA 5SWSB 1IS9A 4LIQH 3E6UA 3CDGB 5EZJB 1LP9A 3VD3A 2XWTB 1LQSR 4LVHB 5HDLA 3VDAA 4M1DL 4J1UA 32C2A 5INDA 3O3BB 3QWRD 4J7RA 3BP5A 3T8XB 1R5VB 1DUYB 1X7QB 1FL5A 1HSBB 4QRSA 4PGZA 3VFWB 5MEOB 1NSNH 4PREA 4JDVA 1YC8A 3N9GL 1U8KB 3ALWA 4Z9KB 4YBHA 1KNOA 3VWJA 1LF6A 1C12A 1V8HA 5FA3A 3NN8A 2OTUB 3LEXB 2JIXD 3ROOB 1BVLB 2P48B 3BISA 3QXAA 1FBOA 4LEOB 2DRQA 3WJLA 2ICWJ 2J88H 4CW1B 4QXGL 2APFA 3GGWA 3PABA 2IQAA 5INDB 4LQFH 3HA0A 5DGQA 3BP5B 5E03A 3BUYB 4ALAH 3W0WB 1P6AB 1A9BA 3NAAL 4QRSB 5T33L 2Z31A 3O9WC 4ZH5A 4HJ0C 4JDVB 1GIGH 1R3KB 3VG9C 3RKPA 1OP9A 4PFEA 1C5CH 3VWJB 5LGHH 1TJHH 4MJID 1LE5A 1VCAA 4OCXL 2DQDH 2HKHL 3GJFH 3QXAB 4E41B 2EDHA 1RVFH 2Y06H 3TZVA 1L0YA 1IAKA 1AKJB 3GGWB 4IMLA 4YHOL 5FYKL 1A6TA 3GSOA 1XF5A 4LVEA 4OBSA 3U4EA 3N50A 1C16A 1L7IH 4JGUA 3PNWB 2H9GA 1NAMH 1HYSC 3LQZA 5IIEB 1ZHLA 2VDNH 3D5OF 5E9DB 3UTTB 4I48A 2XZAH 1NUDA 3NCJH 1JZ5A 1X5XA 1RMFH 2AJSL 3TZVB 1JN6A 4PJGE 43CAA 1CDJA 2EH8L 4P4RA 3W9EB 4DZ8B 2ZG2A 3NCBB 4L8SC 1XF5B 4UIMB 3QCVL 4LKCA 5KZCB 1S9VA 3SGDI 2IBZY 3LS4H 3V7MA 3RIFK 5ISZE 1AGBA 3TV3L 3QUYD 5CSBA 4A6YA 5I1HH 1S7QB 4HULB 1E6OH 5B22A 1HZHL 2EYRA 4LL9A 3OGCA 1N64L 1LO5A 2AW2A 3QFZA 3EYUL 3MLXL 1FFOB 5JR1H 2P46B 2CR3A 5EO1B 3V5KB 4RMUA 4KWUA 5IV2B 1C5BH 2NW2A 4PJ9C 3H3KA 4RGOL 1CICD 4L9DA 1D5ZA 4XPFH 5C0NC 3NBNA 2CLVB 2H8PA 2Y36L 5GSVB 3MOAL 3VFOA 4HUXB 1ZLVK 5CGMA 4ONOA 4LKCB 4NNXA 5L2KD 2ILLA 3HAEH 4H0GA 5KVFL 3VI3F 3I3BA 1A7OL 1RK1B 2ZSVA 1KEMH 1JWMA 4PR5B 5DC0A 4Z78A 4Q9BA 4IRSA 4OZGA 3QIBA 2NY1B 4LAQL 3KJ6H 3GI8L 4G80B 3ZE0F 3U46A 1VDGA 2AJ3B 1LO5B 3BJLA 2X4PB 1MVUB 5J57B 4JR9L 3AUVA 1IA6A 3KYOB 5TDNA 1PLGL 2HFFB 5HHOD 5E2VL 3FO9A 3MYJB 2RHEA 5FA4A 2JCCF 1GAFL 3FO0H 3UBXA 3VFOB 2UY7A 2QSTA 1JNHB 3HNTH 2EDTA 4D0DB 3NFPB 2CO7B 1HDMA 5CJQH 4Z78B 5A16A 4IRSB 4P9HL 4F15C 4OZGB 1RY7B 4M3JA 3ULVD 1E28A 2EDWA 4PYHA 3F7VA 3V4VH 1Q0XL 3U7WH 3VW5A 3MRBA 1VKXB 2QR0A 5I18L 2V9TA 3ELAT 3NFSL 4MMZC 1GLMA 4J3XA 4KKNA 4U0QB 1V5DA 4HFUH 5C07E 3OB8A 4G42A 4QHUA 3VU2A 4YR6A 2LV4A 4KUCD 3MV9B 3S34H 3O3DB 5KW9L 2P24A 4ZUSB 4NM8L 1N26A 5BJTA 1ZEAH 5GSRA 1I7TA 3LVEA 3KS0H 4TXTA 4RRPA 3GSNH 5MERB 1CDBA 3F7VB 1AGFB 4RAUA 2C4FT 2YZ8A 3MLSH 4YWGH 3S98A 4GRWB 3Q2CA 1KXVC 5D6CA 4KU1A 5EU7C 4JY5L 1I9JH 4I5BA 4QHUB 2HN7A 4QNPE 1M6OB 4CVUA 3VRLE 3FRUA 4Y4FB 4Z4JA 1NBQA 3QH3B 2EYTA 2NMSA 4JANA 1EHLH 2AK4E 4WTZA 3QEGL 2VLJD 3FB7A 1H3VA 4K8RC 1GOHA 2Z93B 5IMKA 4Y4KC 1S7RB 4MX7A 3QCUH 1I7TB 2NXYD 3CVHH 5IMLA 1RIUH 1YMMD 1MJUL 1UA6L 4DN4H 3K11A 2VISB 5LVEA 3ULUH 5ACLA 1UZ8A 1KC5H 1NC2D 1TPXC 5JO5B 4LPYA 1N59A 2E6PA 4P5TA 4C58B 4WUKH 1OOAA 1E4XH 1M71A 3KPNB 3SGDH 3HZMB 2ATKA 4J23A 4ZFFA 3U6RB 4K7PH 2FD6H 4AIZA 1XIWA 3VXOB 1T2QL 4JVWA 3IVKA 2RGKA 5C8JB 4QTIH 5GS1C 3DXAD 5MENA 3Q6GH 5IMKB 1LDPH 1VFBB 2BNUB 4LRNL 4XVUC 1UZ8B 4GLRI 4HGWA 3IRPX 4LCUB 3U7YL 3HC4H 5CS7A 4Z77A 1A14L 3TNMA 1P1ZA 3CPLB 5C09E 3BH8A 4PRPA 4OF6A 1NGYA 5FF6B 5ADOH 1FN4A 4K9EH 2HWZL 5ACMA 5JZ7D 1AP2A 1ZT4A 3MGAA 1N4XL 3TBWA 1U8QB 1XIWB 2I60H 3WN5A 2F74A 2IFGA 3IVKB 1TNNA 3BT2L 3RTQD 1JPGB 5MENB 1RFDH 3HFML 5JNYA 2DOCA 4LPUA 3QUZA 4F58L 4ZTOH 1Q9KB 4PJXF 3D87B 5B39G 3VXQA 3CIHA 1P1ZB 5FKPA 3ZKMD 4CMMB 4UUJB 4YNYA 3BH8B 4PRPB 1U8NB 1SEBA 4LGPB 4EDWL 1FN4B 1WZ1H 4KJPC 5GGSY 3D9AH 3TBWB 4ZG8A 2F74B 1NCCL 4YDIL 1AE6H 3CJJA 35C8H 1CBVL 3O6FC 1NUGA 1Z3GL 2EDFA 3O2DA 3FFCA 5GGQL 1KJ3L 2QSVA 2NY2B 3RZCA 5JNYB 1G7HA 3MRGB 4PJCB 3ZZ1A 2BRQA 2NXZB 3C60B 3GBNH 2HVKA 3GJFK 1G7JA 1RUAL 3S3PA 3MRHB 3VXQB 2ZOLB 3VI3E 4YNYB 3UPAA 2BY1A 2DI8A 2HT2C 2ZWLT 5IGXH 4X8JA 4PS4L 3NFNB 1NCUA 4KC3B 4FRWA 4PPTA 4U3XA 5T3ZD 5FIEA 1D9KC 3NZHL 1QFOA 4WHYG 5D5MF 3VE0B 4KHTL 1K4CB 4AG4H 1ZLSL 3FFCB 4P23A 3ZMRA 4R97B 4DVBA 3C9NA 2OX5A 1CXFA 4F33B 2NY7H 3ZKNC 5FGSA 3TJEH 5SWSE 3OKOB 3S37H 2HVKB 2B8OT 1G7JB 4PRDA 3CSBA 1U8JB 4OGXH 3VMPA 5AAWA 1K8DB 1DL7L 1MQ8A 2B5IB 5KAQG 4PJEA 4ISVA 4L8DA 4MXWL 4OZHA 4XPBH 1S7WA 4X8JB 3FB8B 1UQSB 3NIGE 4MCYB 1MNUL 3SO3C 3QWRA 3L5WA 3D2UD 1XEDA 1ACYH 1CTNA 1WCBB 4HMEA 2J3SA 1H5BB 3GMLA 2GJ6D 5IVXA 3Q5YA 5C0CB 2DB8A 4PGDA 3U1SL 3CXHJ 4P23B 3BKCL 4J4PD 3NZ8A 2P45B 1IGIH 4A6YL 5LCVH 5CZKA 4I77L 4MNGA 2JIXA 2VDKH 2GSIB 1KENL 4TVSa 4PJEB 4OZHB 4HKXB 4HDIA 4PBXA 4GG6B 3EUUA 4WEBL 1CGTA 1H0DA 1KV3A 3KLDA 4K3GA 3W0WE 2AK1H 3ON6A 3ETBF 3L5WB 4KMLB 1XGTA 3K3QA 4P2OA 4ZMAT 4WTWA 2FZ3A 3GMLB 1YJDL 4YDKL 3BHBB 3TJHC 5J11C 4S10A 5FB8A 1A6VH 1SYSA 1FG9C 4ZYKA 2DJ4A 3NZ8B 4F7TA 4Y16A 4K07A 4ZFOB 5F44A 3EYFA 1ITCA 2JIXB 1CFNA 1AY1H 3HE7D 4E41E 4P2CG 3V7AE 1EO7A 1FLRL 4LCWA 4OGYH 1SQ2N 2DL9A 3AY4A 4LHQB 4Q6IC 3HI6L 1IEAA 2E8YA 3OF6A 2R69L 3W39B 4EKXA 2SEBA 1XGTB 3D3VD 4H20L 4FQQB 2FZ3B 3T04D 4U1IA 4X99A 1FDLL 1QP1A 5E9DE 1PBYA 3VGHA 4XNZC 3UTTE 4ZYKB 4F7TB 1JE6A 1HCUA 3W7WA 1U3HD 2F5BL 2K7QA 2NY5L 1J11A 1W8OA 4HXBL 4MJIB 5DS8A 2OTWB 3EYFB 4NWTH 5HD8C 4OZFB 2P47B 2VDLL 1XGQB 3U4AA 2QQNH 2VLRD 3MUGA 3QG7L 3KXFA 4DK6A 4H1LH 2Y6SC 4L3CB 3H9ZA 4UQ2A 1IC1A 3T0WA 4PG2C 5IJVA 3AXLB 1NKRA 2SEBB 4TVPD 3V79C 1DBKH 1MCJA 3QQNA 2B2XH 4U1LA 4NDMA 4PGBA 1T7XA 1QFUH 4IJ3B 4WFFD 1XW2A 5FM4A 1ZA3B 5I74B 4TUKL 4H5SA 2BNQE 1CGVA 1T1YB 3F5WB 3S3JA 4KAQH 5IEKB 5IMMA 5DS8B 5JUEL 2ITDB 1JYNA 3RUGB 3BRGC 1YEDA 3DUUB 2A6DB 4U1GB 1NAKL 1MRCL 2YS4A 4KK8D 5DZOA 5EBMA 3MCKA 1A3RL 1CIDA 3W7TA 1BM3H 1CICA 3MBEC 1AXTH 5M95B 3KVQA 3UJJH 4OIBA 3WFHB 4OLUL 1JUFB 1J5OL 4RMVA 2DQEH 4M93B 1NAMA 1CK0L 3QUYB 2W38A 1R3HA 1CGSH 2AI0H 1D5BA 2VB5A 2BVEA 4XPGH 2M1KA 1JZ8A 2F9BT 1YPZF 2XZQH 4FQXC 3CCHA 3CDYA 5I73C 3TT1L 3MUJA 1WT5A 4JM2A 1AHWA 1MF2H 2MNUA 1OM3H 5FUZL 1KYOK 1NCTA 3LEYL 6CGTA 5KVGH 2H3NA 5EBMB 1S7TA 5MHSE 2GITA 4XGZA 3MRQA 2V17L 5I75C 5EN2A 1CICB 5HHOA 4XX1G 4F3FA 1MCPL 2H26A 1U8MA 3OG6B 3T0DA 1KJ2B 3OPZL 4U1JB 5L2KB 1I9EA 3MRRB 4HEPG 4JZJC 3BZ4A 2BSTB 4ELMF 1ZT7A 4WI4A 3GSRB 5HGBA 2L0DA 5IFHH 3I6GB 3L3DA 5DUBB 2HMIC 2DL2A 2DQFB 2LTQB 5FYJU 4J6RL 2V6HA 3G6AA 5D5ME 2ZG1A 1F90H 1P7QA 3HPLA 5D7JA 1K4DA 3Q0HA 4O00A 3GUTB 4PJDB 4TN9A 1S7TB 2MHAB 3MRQB 2JELL 3X3FH 3MJ7A 1PGRB 5HHOB 4F3FB 4Z7VA 5FGBA 2H26B 1U8MB 3MV9E 2MKWA 1JNJA 4C54A 3HAEA 1L0QA 1AQKH 3STZA 4NNPL 1INDL 1CIUA 1MAML 3EOTH 5ICXB 1BIHA 3E1F1 5BO1L 1OHQA 1OCWL 1AR2A 4BKLA 3L3DB 4ODUB 1AR1D 4P2QD 2WUBL 5F1NA 1EVUA 4K7PY 5I15L 3TT3H 2PTUA 4V2BA 2LABA 4WW2F 1K4DB 5HTSA 3T1FB 4M6NH 3KPOA 2CD0A 3N1GC 3ZHLA 3MJ7B 4UNVA 1S7VB 4L4VD 3QHZH 4TSAH 3MBXH 4HV8B 5A2KH 2GI7A 2VXSH 5CZVH 1UYWL 3QQ4A 1HHGB 3QISA 4CE7A 2YK1L 5FO9A 2R0LH 3QT9A 1OT1A 2C3GA 3QUKB 5AUMA 2VLJA 1CLOH 4WEMB 4Z95H 4OTXL 3FQTB 1RUML 2EABA 4GRMA 3T3MF 2I25N 1R24B 4KKAD 2Q76A 3CC5B 1I1YA 5E08L 3VFUB 2QHLA 2D4DA 1I8IB 3DMMB 1NC2A 5DVLA 4JQVA 4QXTB 5LXGH 5FHBH 3WHE0 3U83A 1ONQB 3ARWA 4M6OL 5DTFA 5C0AA 1XF4A 3EGSA 4TOYL 3A67H 3WL9B 1FNAA 4OJFL 3P4OA 1GVIA 2V7HA 5I8KL 4RFEA 1JK8A 5FYJE 3V6OE 5BV7B 4M7LH 5MP6L 2BY2A 3BVNA 1FO0A 3H7BA 4FS0A 5IK3A 1P4IH 3QSKB 4Y5YA 1JGVL 3T0EC 3VXUD 3B2UD 2VLJB 4KHXL 5C0FA 4LCCC 3B5TA 3GSNA 1FSKB 4H8WL 2NXYB 3BSZH 1YMMB 4UAOC 2Q76B 4PJHF 2WQRA 2VLLA 4R2GD 5HGHB 4LAJH 3PGFH 1NC2B 1VA9A 2VDOH 1F11A 5DTFB 5D6DC 1M7XA 2JE8A 5HPMA 2PR4H 2J4WL 2DBLH 4RFEB 4TQEH 1JGEB 4DZBB 1JF1A 3ES6B 1FZMA 3O0RH 4YEEA 3IFPA 4UTBL 3WSQH 3NCMA 4X6DF 3UZEA 2NX5E 4NO0D 4OCWH 3SCMD 4OD1H 5C0FB 1OTUD 3DXAB 3QZWG 4GXVL 1NFDE 1N5AA 2VLLB 1QR4A 3RBSA 5CD3B 3QRFM 2A6IA 1LILA 3B9KC 4XP1L 4G43B 1JHLL 3DVGB 3TO4D 1PG7H 4GAJH 5HPMB 1N2RB 2JB6A 5F7LB 1HN1A 4HPYH 5DLMH 4TF4A 4K71B 4MLSA 4P4KD 4X9IA 5IQ9A 1FH5H 2DQGH 1G9MC 5IT2H 5B8CA 5FYLL 4OCYL 2J7LA 5ESVB 3DI3B 3RTQB 1ZE3C 2WLYA 1T66D 2AVGA 1FVEB 5JDJA 1BZ9B 4OD2B 2C3HA 4HUUB 4ZAKD 1N5AB 1QSFE 4JO3H 4LSPL 2EH7L 4MVBC 3TN0C 4MDJB 3EJJX 2BC4A 1J8KA 1YN6B 2A6IB 2J8HA 5F3BB 3RWJB 4PYGA 4LIQL 4OLEA 3TO2A 4JJJA 3IDNA 3HZVB 3EDFA 2JB6B 2D7TH 3LKQA 3D0LA 5H2BA 2DKUA 5HI3C 5CIPH 4QXUH 3RKDD 1S5HA 4CVWA 8CGTA 2ICWA 3F12A 4LOUD 5B8CB 4OI8A 1Z9SA 1EDQA 4JREC 1B4RA 1Z9LA 3TIDB 5DO2C 2X4OB 5GXBB 3GSQA 1NSNL 1HI6B 3MJ8A 4PJ8A 3CMOH 4X7TB 2BC4B 3OAUH 5E6IA 2DRSA 3SDDA 1B88A 3FTGB 1CZ8L 4L8BA 1LEIB 1BAFL 3EKCA 2FEEI 3K0WA 1U95B 4HLJA 4KJYB 4ZPTA 4PGJA 1ZT1B 3PV6B 1H8NA 2XY2A 3D0LB 2J88L 4PLJC 3RDTA 2EDQA 3QB7C 1RJLB 3D2UA 4LQFL 1S5HB 5K59E 1BGXL 5B38G 2ICWB 1YUHB 3T09A 4I0PC 5I6XB 2R23B 4R4BB 4M7ZC 1QLEH 4MAUH 3JVGA 4R7NA 5KSVB 3DURB 3QT3A 1GIGL 4Z18A 4A2MA 1KPUA 5IG7A 1BQLH 5LGHL 4KKBC 4LBEB 1TJHL 5GZOC 4GG6E 1QEWA 2DQDL 1UWXH 4W4NA 4C56D 1RZIB 1RVFL 2AJYL 2Y06L 4ZPTB 4JHWH 4BFIA 4QHKJ 3RVUD 4LVOB 4OZIE 3QFDB 1G9GA 3LDBC 3D2UB 5T3XE 2F8OA 2R56H 2GJ6B 3WC3A 2BVOA 2OS7A 4TRPH 3MJ9H 3BZEA 4YBLC 2KH2B 1YEIH 2DM4A 4JEGB 3DYPA 1KB5H 5DJDA 1NAML 2G75B 4M61B 1MRFH 1X5FA 5IG7B 5JHDD 1QKZH 5ADPH 3BDYH 3HE7A 3LN4B 4WCYH 2XZAL 5BXFA 2DM7A 2VN4A 4LLDA 1QEWB 2HFEA 4HX1A 1RMFL 1ETZB 3MV11 3E73A 1V3MA 2GHWB 3T3ME 4YO0A 1XCTB 5FHAH 5HDBE 3OKYA 1TITA 3U30C 1BBJA 4WI7A 2P8LA 3AM8C 1WSST 3R8QA 3LS4L 1MELA 2MQ0A 1TZIB 1HILB 1I1RA 4ZO9A 2XN9D 5I1HL 2BOBB 1F42A 1E6OL 1HXMB 4MJIE 5DJDB 3RY6A 2VABA 2Q8BH 1U3HA 4N1CA 1KEGH 4MB5A 3HE7B 3WCYA 2AEQH 5BXFB 2GJZB 1MFDH 4ZS6C 5JR1L 1HHIA 5F1OB 3E6FA 1C5BL 1BX2A 2ERJC 1I1FB 1WBYA 1J1PH 4Z7OE 4XNYH 5GS0D 4ZODA 3C6SB 1BBJB 5DSCA 3D3VB 2P8LB 3QUMB 4RA3A 1MY7A 3LKSB 2ZSWB 3O4LA 5KAQF 4YZFF 3BPOC 4P46C 1JBJA 1KG0B 5ILTH 4X9HA 1U3HB 3KJ6L 4OUOA 2DM2A 2GIYA 3BRFA 4JFYA 3ARZA 3GO1H 3GJEA 3P77A 4BH7B 1GOGA 2JB5L 5CZLA 4C4KO 1WK0A 4RMRA 5DEGA 1LVEA 4WV1A 4HC1H 2VLRB 1CDGA 2QNOA 3QQ9C 2IMNA 2W0FA 3V0AC 3GI9H 4EOWH 5E1AA 2FATL 3BJ91 3G5XA 2EDXA 5D7KE 5DSCB 1TVHA 5DJXA 4HMCA 4EDXA 4R7DA 2FUZA 3HNTL 5H94B 4JQIH 5DMJB 3MLRH 5CJQL 1YN7A 3IDJB 1ZAGA 2FB4H 4ETYA 3MLPA 3DYMA 3KPLA 4JDZA 5C6WH 4L9LA 2IPTH 3UBXG 1BIIA 4G9DA 4N0YH 4QHKI 4PG9B 3U7WL 1OGTA 1IMHC 1P5UA 5IUSA 4NKOA 3HUJF 3QWOA 1H15B 1QACA 4ZUTA 4H1LA 4NWUH 5ESQA 1X5YA 4HFUL 1EPFA 5E2WH 2HJKA 4AYOA 3WXWL 4FQHB 5AD0A 5L2KE 5EIIA 3C8DA 3G5XB 1WFTA 1EAPA 2EADA 3DNKA 2F58H 1GGCH 3GKWL 4NO2B 1NQBA 3S34L 3WEXA 1FO0L 1V3JA 1XGYH 1ZEAL 5EUOA 1DCLA 3U4BL 1GHFH 3JWOH 4XTRC 2DKSA 2BVPA 4MGXA 1BIIB 3CXHK 3GSNL 4PJDE 4G9DB 5HI5D 2IAMD 3IFLH 3ZKXC 4D3CH 4N5ED 3MNWB 4WWKA 4RFOH 3AVEA 3MLSL 4OFKA 4YWGL 2CDEA 5IEHB 1FLTX 4FTVD 4JCMA 5ESQB 4QRTB 2HJKB 3AB0C 1I9JL 5AD0B 1NBYA 3OGOE 3EYOB 2EDBA 1S7SA 2X40A 3ARFD 1EAPB 4NUGH 5JPNA 2HLFC 3RVTC 1KFAH 1EHLL 3HG1D 2DTML 1B90A 4J8RB 3QCUL 1Q72L 1RIUL 3QXWA 4NQXB 4DN4L 3OX8B 1KC5L 4NQCE 3QNXB 3V4UH 4QHLA 3T33A 2GFBB 3C6LC 1H9VA 4ORZC 4WUKL 1JV5B 1E4XL 3BP6A 4L4VA 2DRUA 4CVXB 1XWQA 4ZQKB 1I7RB 5DD5H 3SKMB 4K7PL 2FD6L 4LRIC 5IB2A 5JPNB 2EE9A 2OR7A 3FB6A 1OGAE 4I9WE 3VRIA 4WWID 3QDMA 4QTIL 1QTYT 2BZDA 1NCDH 5T1KA 3HE6C 3Q6GL 2ED7A 3P0GB 3MLUL 4XVSH 1BFOA 1LDPL 4P2QB 3QZWB 5DJYA 1CLYH 4M7JH 2JK5A 5SV4A 3OR6A 3HC4L 4FFZL 5I1GH 2P43B 5EBGA 4BQ9A 1U8IA 4L4VB 4C57C 4XP5H 3CFKA 5ADOL 5B4MD 2FLBT 4K9EL 1NC4D 1MCRA 3JXAA 1BJMA 4HZLB 2I60L 4K3EL 5DJ0B 3L3GA 3FB6B 3VRIB 3VXUA 2MQCA 1YMME 3QO1A 3NTCH 2Y9RT 1QFWM 3WHE1 1RFDL 2VSCA 1LNUA 5EU5B 2DIJA 3IDXH 1BFOB 1HYRC 2K1MA 3BWAB 1XH3A 4J3VA 5FM5M 4AT6A 4BK4A 2FJGA 2AV1A 3C87A 3IAQA 1A3LH 6FABH 1RZKH 3F62A 4OF0A 4UV7H 4ZTOL 1R3JB 1R5IA 4WO4D 1Q9WB 4GQPH 4K7PX 4LP5A 4X9GA 3CFKB 4U1MB 5D1QD 3BAEH 1NGWA 1WZ1L 5DI8B 3D9AL 1J0JA 3DXAE 1FBWA 3VXUB 1ZK9A 35C8L 1RI8A 1IEHA 4O9HH 4PGCB 3DIFB 5CGYD 3TBYA 1FIGH 4AL8H 4C4KT 1XH3B 2CKNA 5BQ7A 4R2GB 5L0QB 2CK0L 3EOBA 4KJWC 3SJVD 3OKMB 3IDYC 3GBNL 1QLRA 2FR4A 2AKRB 2N1KA 5KKBA 1XMWA 5JIKA 3IXTA 3STLA 3MFFB 1ORQA 4F2MA 5IGXL 1F45A 4NSKA 1P7HL 5I1IH 3JV4B 3ZE1E 3WIWA 3P73A 2J8OA 4NO0B 1MCHA 3VCLB 3SCMB 5B38B 1A7PH 1CQYA 4PJAB 3VFNA 5GRVK 2ITCA 1WBZB 1TZHA 3N1PC 3TBYB 3LQAC 3WBDA 5I8CA 1SYVA 3JUYA 2NY7L 3H3PH 3PWPE 3TJEL 1DEEA 3S37L 3UTSD 1E4JA 4U7KA 1I9IL 1T3FA 4OGXL 4LVNB 2GAZA 1MEXH 1QBAA 3TO4B 4XPBL 4NSKB 2WINB 4NM4H 4P4KB 1Z0MA 1ACYL 5GGUA 3LRGA 3O9WD 2V9RA 4ZOBA 2YRZA 1K2DB 4HJ0D 3VFNB 1TZHB 5D71H 4ZAKB 1SYVB 4GOSA 3V8CA 1Q1JL 4IM8A 5EWIH 2ZNWA 2XKUA 2B20A 1WC7A 1IGIL 2EE2A 5LCVL 5FFLA 4S1DC 4PD4J 4UDUB 2VDKL 3O3AB 2PYEA 5T3ZE 3I6KA 2BY0A 5D7IF 3EIFA 5T1MB 2A6JB 2OZ4H 2VWEE 5E8NA 2AK1L 4OT1H 4OKDA 1NDMA 1RQ5A 2IH1B 4YGVB 3WV0A 5IWLA 5EUKB 2F5AH 4U1SA 1EEQA 1F2QA 4K3JH 1A6VL 1HYSD 3PJSB 2FL5A 2O93L 1WJ3A 1WZKA 2X2YA 4NCC2 1BJ1H 2OJZL 5DRXB 3VFMA 3T2PA 1AY1L 3VH8A 4FXKA 4LLYA 4OGYL 1YMHA 1SMAA 5JXEC 2FDBP 1OT2A 3IXAA 1JGUH 3MA7A 4XPHL 5CIPA 1ZWIB 3I6KB 4XT1C 4V1DA 4QY8A 1SJHB 2GJ6E 3LN5A 4EBQL 1D5MA 5CILH 3T77A 1E4WH 4M1GH 2X4RB 3VA6A 5C9JB 1AO7D 4U1SB 4UTAH 3LKNA 3BI9X 4XXDB 4NPYB 3G04A 4C83A 2FL5B 4JGMA 1QRND 1OF2A 3L5HA 5JHDA 4NKDB 1TZGH 2C9AA 1YQVH 1BFSA 2V9QA 1KTLA 5E56A 2GTWA 4PJBA 4NWTL 5J6GA 3VH8B 3C8KB 4PJ9D 3PXHA 3TPKA 2J5LC 4C56B 4RA0C 5C0ND 3IXAB 1OLZA 2QQNL 5EPMA 1HHKB 3BZFA 3WDHA 5DDHA 5AG9A 1XCQB 3RWCA 1BEYL 3BQUC 1DBKL 1FCEA 1OQOA 4GFTB 1QFUL 4XNMA 2XN9A 4C83B 5D7LA 1FFQA 3BDXA 43C9B 4ACPA 5JHDB 3V52H 3EDKA 4KAQL 2GTWB 4PJBB 3X11A 5GGVH 1G6IA 2XZCL 1LP9F 3V6FA 3WFDH 2IAND 5EPMB 1BM3L 3BZFB 1AXTL 3HI1B 3UJJL 4CDGC 3EDDA 3KR3H 4BQCA 1HWHB 3MJ9A 2DQEL 3BIBX 4OAWB 4MQTB 1ODAA 4JFXA 1KB5A 2XN9B 1KIPA 4DK3A 2AI0L 1CGSL 4YAQA 1UCBH 4XPGL 2XZQL 3MRKA 2R1WA 2I27N 1IE5A 3P3YA 1HOCB 1DBMH 1Q9LA 4YHYC 1MF2L 4I4WA 2NW3B 5IR1A 4Y4HA 1OM3L 2VLRE 3P0VH 4B7IA 2W60A 5KVGL 4UI2A 1LO3H 4EEEA 1T1ZA 4HK3N 2E8ZA 1LK2A 4HUMB 1J88A 3M17A 4P48A 1PYWA 4TVPE 4ZPVB 1NPUA 3V0VA 4NZJA 3WDJA 4BH8B 1IAMA 3S4SA 4WFFE 4TTDC 5BRZD 2D03H 4JPVH 4D9RD 4LSVH 5F9OH 3CZFB 3R06B 5IFHL 3NIFF 2R1WB 4ENEC 3CAFA 2MMXA 1F4AA 4U0RC 2O5XH 5DT1L 4UQ3A 4LASH 1F90L 4QRQA 4RMQA 3RAJH 4APQC 2BJMH 4XBGA 1LK2B 1ZSDA 3X3FL 3M17B 3TYFA 1A2YB 1MFBH 3W5MA 3KPRD 3PWJB 1EEZA 4N8VA 3M1BB 3S4SB 4D0CA 1NUFA 5I9QB 3I6LD 1AQKL 3W2DH 4K8RD 1XR8A 2YEZB 3EOTL 4LPVA 5J89A 1N8ZA 3ALXA 4M6AA 4Y4KD 1PZUB 2DQCH 5KSBB 3VW3L 4KUZH 2C4FU 3WMSA 4CJ1A 2EE6A 3BN3B 4MDIB 2LU4A 3H9YA 3BPNC 3HAEG 4LLVB 3RU8H 4PTTA 3TT3L 2B4CH 4HC1A 4QRQB 5F89A 3MFGB 3OV6A 5EO0A 4ZUWA 5A2JH 1A0QH 5E94A 3GM0A 4M6NL 3MRPB 4M00A 1ZSDB 3GB7B 3KYMB 3TYFB 3QHZL 4TSAL 5GRXG 3MBXL 4HF5H 2X6MA 4M7LT 1LEGB 4X4XA 1JGDA 2FCBA 4PJFB 3BD5A 4H0HB 2R0LL 1PKQE 1ZGLB 1N8ZB 4Z95L 3F6IA 3HG1A 2WNGA 2VZ1A 1YEGH 4XVUD 3ZT7A 3BPLB 4NUJB 4HS3A 2DWDA 4PV8A 1T0MA 2IAMB 4E5XB 3FOLA 4XZUA 4N0RA 5LXGL 1T5XB 2P44B 3DOSA 5E8OA 4Q0XH 3K8MA 4FTVB 1KJVA 3H0TB 3VFSA 5E2UH 3A67L 3BE1H 3CU1A 3LB6C 3BGMB 4W6XB 3ARFB 1WQVT 4HS6A 4M7LL 1JGDB 1UZ6F 1P4IL 1ZMYA 3VWKA 1RU9H 5D1ZA 2VYRE 4UB0H 4P2QE 3HG1B 4OZGF 4Y5XA 4EXKA 1FRGH 3ZTNH 3BSZL 4LSSH 3O6KH 2R2HA 1QQDA 2IPUK 1RZFH 1BHGA 3PGFL 1CGUA 2VDOL 4MSWB 2VLKA 4XRCA 5E8OB 4QCIA 2ZP0T 1W72A 2FHFA 5INCA 4PRAA 4C59B 3VFRB 4KJPD 3PDDA 3GBLA 4M5ZH 4HKBB 2DBLL 4TQEL 5C0IB 5IOPB 3GMPB 3S4AA 3V6OC 4MD5A 4WU5A 1PEZA 3O0RL 3WSQL 3O6FD 2OL3H 3I85A 5TE7L 4OCWL 5M94B 4OD1L 1OW0C 3QCTH 4X8XA 3FO2A 5HHQA 5TF1L 1JNNL 1HCFX 4OFYD 2W65B 4OIIH 1B0GA 4GG8A 3UROR 4YK4C 2K9UA 2HT2D 4GRWF 4LF3A 4G5ZH 1W72B 4QCIB 5FGCE 4Z5RB 2A83B 3BXNA 2FHCA 5F9WC 4GAJL 5EZOH 1KXTB 1P9MA 1NC4B 1D9KD 2XWJB 4HPYL 4JKMA 5DLML 4YXKH 3KNBA 4KVNH 1FH5L 2VNCA 5K9KA 2DQGL 5IT2L 1J86A 3DHJA 4JFFE 4MAYA 1CFVL 4P2RA 1OARL 3KPMA 3ZKND 2WBJA 2YWYA 3MOQA 3WFZA 1JS4A 1CFQB 5F93C 3HC3H 3UMTA 1B0GB 4GG8B 2PW2A 3SKNB 4QF1B 4WO4B 2CRIA 3S97C 3HMXH 4QOKD 5CEYB 5HHME 4IOIA 5D1QB 3VXMA 2ATPA 4XPAH 5CD5C 3QIWC 5JW5B 4PJAE 2YD9A 4QXUL 5GGTH 1UJ3B 3B6SB 3DBXB 5IHLB 3KPMB 2YPLD 1EMTH 4HH8A 4FFYH 1T4KA 1WISA 4ZOAA 1ZLUK 1TJIH 3GNMH 3SJVB 3CMOL 3UTSA 5A2LH 2EYSA 1DN2A 3OAUL 1JPST 1PG7X 4NQEA 4HHAA 3LKOA 2HG5A 4OZ4A 2YUZA 3BUTA 3WE6A 5C0GA 3UXFA 3VFPB 4DKEH 2ATPB 2ZG3A 4KTYA 2WW8A 5CP3H 3QIUA 4RGNE 4E42B 5KJRH 3TJHD 2AEIT 3HZKA 1JHTB 1I1AC 3RIFF 1QLEL 4MAUL 1F6FB 2QQQA 1RURH 4EQ2A 2ZZRA 1KCLA 3FN0H 4XMKL 2UY6A 5AZ2H 3C5ZA 3ZHDA 3UTSB 1BQLL 2EYSB 4HWEH 4GW4B 2WBKA 1AXSA 1JPSL 5TE6H 2XTJC 3LKOB 1NANI 2PF6A 4OZ4B 1VEOA 1KPRB 3DV6A 3WE6B 2JJTA 4BFEA 4ZUUB 5C0GB 3PV7A 2X9YA 5E1HB 4JHWL 3U9PH 3UYRL 2X89A 3EAKA 2C3VA 1G0DA 2B4FA 2E7MA 4RX4A 3OKLA 2R56L 3O9WB 4CUCA 4TRPL 5F7EL 5DQ9B 2HFGH 3VG9B 1CFTB 3MJ9L 4S1RH 1YEIL 4K7FA 1KB5L 4X6BA 4JKKA 4LMQE 5GRVL 1MRFL 2R8SH 5HD8D 1M7DB 1MHEB 3PDOB 3SPVB 2V2TB 5ADPL 3FO1B 4WCYL 4MNQD 1FMIA 2YZ1A 1IGML 1DVFC 1MCOH 2Y6SD 1C7TA 1T7WA 1MJJB 5CGTA 5J1SC 4ZNEE 4L8SA 5SWZD 1AD9B 3QRYA 1F3DJ 3FFDA 1X5LA 4ONHA 4PRBB 4ODTH 1OSZA 3CX2A 5F7WC 3OKLB 1KCSH 1KOAA 4IRJA 4J5TA 1OSPH 3KJ4C 3RNQA 2XKNA 4L1DA 1W0YT 4OCMC 1U91B 1QRNA 4YFLF 4LKXA 2VJXA 2ADIB 2Q8BL 3GIZL 2X4UB 3PL6C 4Y2DA 5GJTH 4S1QH 3NABH 1KEGL 4C56E 2E7CA 2AEQL 5D1XD 1MFDL 1XR9A 5E5MA 4CU6A 3MBED 2OZ4A 1T83C 4GH7B 2Z4QA 1J1PL 4L8SB 2NLJB 4XNYL 5F7YC 3DSFH 1A5FH 5ESAB 3QA3A 1OSZB 1R5WA 3MMEA 2XKNB 3P9MB 5IW1B 2M26A 1AO7B 1BZ7A 4FQXD 1R3LB 1KLGB 2QEJA 3RPIB 1QRNB 3RNKA 4OGAC 4BJLA 3O81A 4F7EB 2OK0H 1MCDA 3L1OH 1HQ4B 3GO1L 4PJ9B 4PJEF 4OZHF 4XNUL 5I76A 4HC1L 1AYXA 2IANA 2GT9A 2Z4QB 1RZJL 3ANIA 1X5JA 4EOWL 3GI9L 3JWDH 1MCBA 2JJBA 1RK0A 1ND0A 1R5WB 4LDOB 4YHPB 4Z7UA 4HUWA 4NGHH 5IVXF 4QO1A 3VXRD 4LPXA 3DX6B 2W92A 2QLVB 4U6TA 5DJ8A 5AYQA 4JQIL 1MFCH 1BZ7B 5CEZD 1DUZB 3CLEL 1EXUB 5HJ3B 3MLRL 2HMID 3UP1A 2A6KB 2AXGA 2FB4L 3OXSB 2YRPA 1MOEA 1CDYA 1IGFH 3WNLA 1VPOH 4N0YL 3CK0L 3X3GH 3QYCA 3GK8H 3O8XC 2A77L 2DQUH 5FXCH 3IJSA 2IANB 4PUBH 2DWEA 3BP7B 5E2WL 1KTDA 5DURD 4EUPH 4LP4A 3PQYD 2F58L 4QHNA 1HH9B 1GGCL 4F15B 4H1LG 4ZXBC 1PJ9A 3OJDA 3VXNB 4P3DA 1C1EL 3ARTA 2AXGB 4X9FA 1XGYL 1KS8A 1NANH 3UTQB 2YPKA 3JWOL 3ZDXF 3T3PF 3REWB 1DQDH 3GSUB 3IFLL 4W4OA 2JF1A 1GZQA 2F19H 4HIHA 5HHPB 5M7IA 4Q2BA 2DWEB 3N1MC 3E3QC 1QPPA 1MFEH 1KTDB 3KPRA 4V2CB 4DTGH 3B83A 5KSBE 4NUGL 5BRZB 1X6LA 1AGCA 3D25A 1KFAL 4K23H 4KGJA 3HR5A 4WFGD 1GGIH 4LGRB 3S4CA 3O6ML 3QULA 2GK0A 3MA9L 4POZC 3VG0H 4HIHB 5DMIH 5BW7C 2VMFA 4WI5A 5DA0B 1J8HD 3MJ6A 3L3IA 1JFQH 4YDVB 3TA3C 4ZUVA 3TVMA 2AHGA 3KPRB 4M4RA 5DHVB 1BJ8A 3O11A 1S8DA 3T0ED 3W82A 2C7UB 4X5LA 1I3RA 2HH0H 3MUZ1 3D25B 4FXGA 4R4FH 4Y4KB 3HR5B 1NCDL 3LD8C 3OBAA 3MROA 4XVSL 3F7RA 3ZSTA 3UTZB 1TPXB 3IB4A 1CLYL 1FP5A 2GK0B 4MMXC 2W9EH 4FTVE 2RCSH 5I1GL 3UZVB 4N0UB 1XFPA 3IDGA 2VRAA 3QDEA 1FGVH 3CVHB 4ZFGH 3TH2T 3GSXA 4JO1H 1WWBX 4XP5L 1CWVA 1G7QA 4O2EB 2X4TB 4D8PB 1FL3A 1XZ0B 2ZCLH 3MV7D 4DCQB 4OSUH 5GJSL 5GS1B 1I8MA 4XAKD 5C0BD 4RQQB 3NTCL 3DMMC 3IDXL 2Y5EA 1FFPA 1B0RB 3P4MB 4JM2F 5DVKA 4WJ5B 4GO6B 2GY7B 1A3LL 3B9KD 4XCNB 6FABL 1YQ2A 2D3VA 1ZV5A 1RZKL 2ORBH 4Q74A 4LSTH 4UV7L 2VZOA 2NPLX 1S3KH 4JRYE 4WUUD 4KRPC 4UINH 3SDXA 1CVSC 1IBGH 3BAEL 5CFHA 1NFIA 4U1HA 1Z5LA 5CJXA 1FL3B 4FMFA 2ZPKL 1I8MB 5IW6A 2Z35B 3OL2A 4NQSA 2HRPH 3EJYC 2Q3ZA 5J06A 4MVBD 2JJVA 3TN0D 4O51A 1FIGL 4AL8L 3ULVF 4NQUA 5HXMA 1JGLH 4OFYA 4F9PA 1A21A 1S78C 2QADC 1PZ5A 5GY3A 3FQXA 3ISWA 4UILH 4Y1AA 1ERNA 2ICES 4Z0XA 3FB5A 3EZJB 3A6BH 2G9HB 4Z7VF 3B2VL 1GPOH 5HI3D 3SDXB 1KREA 2CDFA 1D9KA 5CBAA 5F7KC 1Z5LB 4DKFH 5I1IL 5C0JA 2D7QA 2VH5L 3GMNB 12E8L 2DF3A 4U05A 1VGKA 3O6FB 4QLRA 4OM1H 5DO2D 2UWEE 4NQSB 2XI9A 1F3DH 3S5LA 3LIZL 2OM5A 3H3PL 4EI5C 3CFEA 5HYSA 3G6DH 1IGYB 2A1WL 1I4FA 1CE6B 1MEXL 1QFHA 5I1DA 1AJ7H 5D2NC 4XVTH 1ZLWH 5LGJA 4KTPA 4PLJD 5BVJA 2P5EE 1D9KB 4KFZC 5IKCA 4F9LC 4L3EA 1G7IA 1ZS8A 3LCYA 5FV2A 4NM4L 5I1AA 5DR5H 4I0PD 1MHHB 3LSOB 1EUUA 2CUHA 1CS6A 1U8PA 2NY0C 3OKDA 3VXSD 8FABB 3T0VA 3GMMB 4PP2B 2YPLA 2GCYA 3SJVE 5BS0A 5D71L 5FYLE 3WIFB 3S5LB 4KKBD 5EWIL 5L9DH 5GZOD 3WFEH 4AQ1B 4ELKA 4OQTA 1D5XB 1EIBA 4QOKB 1BD2A 3SO3B 3FQUB 5BVJB 4J3TA 2P1YA 3MSPA