2VN4A

Glycoside hydrolase family 15 glucoamylase from hypocrea jecorina
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
599
structure length
599
Chain Sequence
b'SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Three-Dimensional Structure of an Intact Glycoside Hydrolase Family 15 Glucoamylase from Hypocrea Jecorina.
pubmed doi rcsb
molecule tags Hydrolase
total genus 212
structure length 599
sequence length 599
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2008-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2vn4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vn4A02
3OBAA 4JM2A 3U9PL 2IJ0C 3ANJA 5GJTL 5C09A 2B5IC 4X8JA 1FL5A 2FATL 3Q6GH 3QIUC 3TNNA 3SKMB 3QIUD 4Y4FC 5IP4A 4JRYA 4Y4FD 4M7JL 5A2LH 4NC1C 4FFWC 5F9AC 5DA4A 3BH8B 4FFWD 4NCC2 1E4XI 1L4IA 2VL4A 1ES0A 3PWLB 4J6RL 3WSQH 1WAAE 5I1AA 4HUNB 5EB9A 1FN4B 1FQ9C 4LSQL 1DBJL 4HPOL 5HHXH 1L0XA 2OQJB 4NZRL 5BXFB 2XZCH 1WV7T 4AT6B 3CUPB 3B6SA 5F9OL 4M8VA 2MCPH 2OJEA 1XR9B 3NGBB 3BH9B 2NXZB 1TTGA 4XMKH 4HT1L 3C09C 5GS1C 1HH6A 1UGNA 1NSNL 2XNAB 3MRQB 1UXSA 4W6WB 2OJZH 4OCYH 3I84A 1RIUL 2NTSP 3DO7B 3CXHJ 4WFFD 3VFRB 1UH2A 4Y4HC 5D7IF 4H0IA 3UMTA 4AIXA 4Y4HD 4LCYA 4PRPA 1AD0B 4MNQD 1WFUA 1FNGA 4LLYA 4OZFB 2EDTA 3GJFK 4Q2ZB 1NL0H 3SKOB 1TZGH 4NHCH 1P2CB 5T1LB 4BFIA 5DJ0A 3BO8A 3SOBL 4OM1L 4X4ZA 4EUPB 1MHPH 4G80A 2OK0H 1HHHA 2DYPD 1QQDA 1VKXB 1QLFB 1DDHA 5I71C 1FZJA 2F5BH 4OJFH 4WHTA 1RUKH 3PNWB 3FB5A 3HG1D 4S1SL 2D0HA 5ICYB 4JO1L 4PGEB 2VR5A 3IJHA 5D7KD 1FG2A 2DLHA 3ARXA 3ULVE 1XH3A 5I6XB 2MHAA 1IGTA 4YXKH 1K3ZA 3WFBH 4PJ5E 5EZOH 2O26U 4TSCL 4PJEE 3HZKA 4IJ3C 2FLRT 4Y19B 1T66C 2F5AH 4Q9QL 4QXGL 1A1MB 5GGQL 4I77H 1R5IA 2Q86B 3RNQB 1EHNA 1RI8A 5IV2B 5FUZH 3WDJA 1MAJA 2VDQH 2VDLL 2DQIL 1TXKA 4GRWH 3GMRA 4IRSB 4MLSA 1CF8H 5GGVL 2JIXB 2YEZA 3NGBC 1GAFL 1Q9LA 2NXZC 4JANA 4PJIA 5F1KC 4FQPA 2QR0A 4HC1L 1QR4A 1CR9L 1CLZH 1PKQE 5I18L 4Z7UE 2F58L 4G6KH 5FIEA 1OCWH 3SDXA 5AZEH 3MRFA 4R26H 2C4FT 2CJUH 1R0AL 3MRPB 2G75B 4DUWA 3O4LA 5DRXA 4JFFB 1RFDH 5C9JB 1Z3GL 4NKMA 1RZFL 4JY6A 1FV1B 4NQEB 1T21A 2R56H 4HWBH 35C8L 5SX5K 3I6GB 3RU8L 5H35B 4Z78A 2IC2A 5T1LD 5ICXA 4I5BB 1S7XA 3GNMH 3BGFC 3N06B 5DJYB 3TV3L 1BGXH 5I8KL 3Q5OA 2NY2D 4B7LA 2FNBA 3F65A 3G5XA 4WW1B 2DQCL 4I3RH 4FQXA 4D0BA 4OLVH 1YY8A 1Q9OA 2Y07H 1VCAA 3IU3A 3WEXA 4U1GB 3RWDB 1W8OA 3SBWA 1OARH 5I6XC 3BEVB 3A67L 5BCAA 4R3SB 5L8JB 3HNVH 2ZP0T 4J3TA 5DRNA 1RK1A 3MJ9L 4KKCD 3MRCA 3S3SA 5JHDE 3O3DB 2OTWA 3VXMB 1I85A 4PLJC 4Y19D 4PLJD 1REIA 3MZGB 3VFVB 3X11A 2BVPB 4YZFE 5AUMA 3IFNH 3DSFL 1XF5A 4AQ1B 1HQRA 4F7CB 2OM5A 4PG2A 3L3KB 4UDTA 5H37H 4BUHA 1TQCC 4IRSC 1AGDA 4IRSD 1H3GA 4NNXB 4CADB 5J12B 2D7TH 3MRMA 1UXWB 2JIXD 1NDGA 3CX5J 3RUGB 3FO1B 4PD4K 1XZ0B 4WFED 3STZA 3I3EA 1S8DB 2G5BB 4P4KA 4LFHD 4FQQA 5IM7B 1BBJA 2H2SC 1HDMB 3WN5C 4U1HA 2H2SD 4X4XB 2HP4A 4M8QA 2VUYA 2IFFH 1F3RB 3IDMA 4JFFD 4OD3H 1FL6B 5J1AB 3N85H 4NQED 2GFBB 5GSVA 5TDNA 2NY0B 3G6JE 1S7VB 4ZFOL 4G8IB 2DLFL 1VFBA 4DCQA 4XP6L 4WVAA 5EZLB 4OZIB 5EZIH 2YD9A 1ZHBB 4JFDE 5D71H 5I66A 3C6LA 1QNZL 3PWVB 4CU7A 3QEGL 1NMBL 4U1GC 1RZJL 3VRJA 4OQTA 1KF9B 3BIAX 3RHWF 4NM8H 2JG0A 3EYSL 3LN9A 2X4SA 3T08A 2AGJL 4V1DB 4F37F 1OQXA 1FNEA 1SEQL 2E9IA 4NGHL 2V7NB 2BX5A 3IDJB 2WLYA 3ORJA 4OCRH 1KCRH 1IL1B 2IPTH 2F53A 3I75B 2FX9H 3VXMD 4KZEH 5KS9F 3RY5A 4WFHD 1JPGB 5C7XL 1FZKA 2YHGA 2AXGA 2FO4A 5EWIL 2I9TA 3QIUA 1EPFA 2YRPA 4RFOH 2OI9B 2WWKO 3P30H 4JN1H 3RGHA 4E5XA 1U3JA 4O2CA 4P5KA 5I1IL 2ESVD 2GAZA 4P9HC 4BQ6A 4GUPA 5IHZA 3QWOA 3EOTH 4QO1A 2YN3A 2QQLH 3AMKA 3KPPA 1N64H 3EQAA 2VXQH 3F5WA 4LHQB 1WBXA 1ORSA 2RCSL 4L8DA 1MQKL 3ZT5A 4ZTPL 5I17A 5DEFA 4U6XB 4UBDC 3OR6B 4JZJB 4PIRF 5IEHB 2ZCHL 3H0TA 4UBDD 4XP1L 3WLBB 1NAMH 1RMFH 4HIHA 4Y4HA 5C6WH 1X9QA 4KKNA 3WUWB 3LN5A 3CJJA 1MCDA 4N0RA 4X7TA 1R5WB 3U4BH 5CA3A 4JFOA 3TBYA 2RFXA 4OM0L 1ZLWH 3AXLB 5ADPH 1C1EL 4Y4KB 2HJFB 2JJTC 1V05A 2QADC 1QFUH 4GRWB 4NNPL 4POYA 1AGCA 5IWLC 2QADD 5I1KH 1ADQA 1JZ5A 1SYSB 2DYPA 2EDQA 1CFVH 3REVA 2YD2A 4U1NA 3U46B 2KPNA 4TOYL 4S2SB 3S5LA 4V1DD 4MCZB 2IQ9H 5TE6H 1MCLA 3HZVB 3K4AA 4L29A 4PJFB 1XIWB 3MC0A 4U31A 3QEQB 2BY3A 3IF1B 4R2GB 1JTOA 4NZJA 3ULSB 1P7KA 5DQDH 1X5ZA 3O3BB 2OMBA 3VI3E 4M61A 4M62L 3P73B 4PJHB 4DW2H 4PV8A 4UT6H 4JO2H 4KDTC 5TH2A 3WKML 1O5DT 3OJVC 1E4KC 1ZVHA 1LEGB 3RL1B 4CJ1A 1J88A 2R4RL 4NKIL 4M48L 1L7TH 1B2WH 1CTNA 2UWEB 2VQ1B 1G7IB 4AT6A 2ZBLA 4UQ3A 3P4OA 2X09A 2N7BA 3ROLA 4D9RE 2BDNL 4LEXH 4OGXH 2EDWA 1J1XL 3JUYA 5HDQL 3FAXA 4F80A 5F7YC 3MRQA 1M4KA 4HKXA 4KHTL 5IB5B 4JZJC 4XP5H 1EHLH 1IKFH 3UP1A 5D8JH 1ZK9A 4B5EA 3EDFA 4BH8B 3ZE0E 5GGVY 3JV6B 2XA3A 4U1LB 4CVWA 3RTQB 1JK8B 4G9FB 4OZFA 1ZA6A 4Q9BA 2FHFA 4O4YH 5I15H 1DQLL 3GSWA 3QZWG 4NFBA 3V6OC 1WZ1H 1DL7L 2ZUXA 3MJ6A 4ODVL 2DMCA 3BESR 1GZPA 3AS1A 3E1F1 1S5HB 4BFEA 2MQ0A 4HCRL 3MNVB 4OFVA 2B1AL 4PBXA 4X83A 1CU4H 3U7YL 1UACL 4KTDH 4XHJC 1NGYB 5HI3C 4XHJD 2LU7A 5HI3D 3F7VB 1JF5A 1F6AB 2W59A 2ED7A 3HPJB 3IS0X 3RKDC 4WY7H 4H5SB 3RKDD 1ZWIB 1D5MB 5ICYA 1XIWC 1D3CA 5E6IB 1XIWD 2D9CA 4R2GC 3BWAB 5DJ6B 3THML 4ODTL 4R2GD 3RWIB 3SO5A 1S7SA 4TNVF 1ONQB 2LABA 4DUXA 3MBEA 1AXTH 1HWGB 1DBBL 3JWNC 1TCRA 3OAZH 2RHEA 3H3BC 4MGXA 4MB3A 4XC3H 2VYRE 3SO3B 4GG6A 1WK0A 2A6DA 4UMGA 3VGAB 3DJ9A 5B3JE 4WI7A 1CFQA 1MCNA 1MQ8A 2X4QA 4WU0A 1HILA 4MD4B 4TRPL 2HJLA 4XNUL 2WIIA 2VITB 3U0TB 3P9LB 1AC0A 3OGOE 1G0XA 1OQOA 3RDTA 5IGXH 1CL7H 1H3PL 3F12B 1SQ2N 4JY4A 1CFTB 2BHZA 2DWDB 4WUUE 3P40A 1K6QL 3EO0A 1YJDL 4OKVB 1OGTA 1A7PL 5FYLH 5H2BB 1VACA 2X4NA 1CLCA 1NXCA 1T0MB 2ZUUA 1T4KB 2L7JA 2BXYA 3WN5A 5IB1A 4UTAH 1IGYB 4MSWA 3ZKXB 4JFFA 4Z0BH 1KFAL 3QUXB 5I16A 4G9FD 3U6RA 5GGUB 1DSFH 4GAJH 4NQEA 2R23B 3MJ8A 3TNMB 1KIRA 3I6GA 1BBDL 1MJ7H 1FRGH 5CINH 5HHOB 5ANMA 4N8CL 4Z18A 4LCIL 1QOKA 1MCJA 5DTFA 1I8LC 1FZOA 1ZT7B 3MRDA 2AK4B 5IUSA 4CVXA 1PYWB 1UWGH 3X12B 2AABH 1Q0YH 3TO4A 5E6IC 1EEZB 1XGYL 2EIZA 1TENA 1XGQA 5E6ID 1MLBA 4Y1AB 1GVIA 4WI9A 4P2OB 2C7UA 4KJQC 1YC7A 2VC2H 1BQLL 4R3SA 1LP9B 2VIRB 4J23A 4J3WA 5T5NF 1PG7X 2GK0B 5D2LB 4GRLB 3EYUL 3GUTB 3RSYA 3T2PA 3MRLA 4XNXH 1RJLB 1IAII 2Q20A 5TF1H 1KEGL 2ARJQ 3UYRL 2BVPA 2A83A 3DV6A 4BZYA 2MPAL 1IC5L 4D0CB 3GMOB 5J1TC 3SDAB 2DB8A 5C09E 2Q3AA 2ESVA 4OFPA 4ZQKA 1IILE 5ALBL 2XWBA 1S9XB 1BVKA 2P48B 3OKKA 3P2TA 5DMIH 4BSWA 4GG8A 1RZ7H 4OKDA 4YR6A 4JRYE 3L5JA 4F2MB 4POUB 4F8QA 1B4JL 4RGMB 3LY6A 4M00A 2GCYA 2IAMA 1TNMA 3X17A 4IDJH 5E2TH 2X4OA 3RBSA 2YWYA 4NQCB 4O2FA 1JP5A 1QACA 5JNYB 1GA2A 1UM6L 4X4XA 3TFKC 3HI6H 3RWJB 4EJ1C 3SQBA 3ZKXC 3TFKD 1R3KB 4PRDA 4WI8A 2BSRB 4PBWD 1FNAA 4ZOCA 2GSGA 5J1AA 2YZ1A 5JDJA 5HTSA 1F6LL 1I9RH 2W38A 4JRXB 2ORBH 1JWMA 3MROB 4LHUB 4G8IA 1EFXD 1VFUA 2MMXA 4HK3J 2PR4H 4PRPE 2AK4D 3MRGA 5E8EA 4QRQA 5JIHA 5IVXA 1KEMH 3CFCH 2JJTA 5IWLA 5KW9L 4I18B 3DVGB 1XF3B 5ILTH 2YD4A 4LMQE 3NIGE 4P2OC 1Z0NA 5DUBA 1HK6A 4XUVA 2VDRL 4V1DA 4Z7NE 3WXVL 1I3VA 4OIBA 2WMPA 1W72A 1B9ZA 4KFZC 1RZIB 2GQHA 3VFTB 3A3VA 1RAMA 3QBTB 4GRLC 1W8NA 3IDJA 1ZGLA 4GRLD 2DAVA 3STLB 1B0GA 4CKVX 3AAZB 3WL9A 2JLLA 3I75A 4HIIA 1JPST 4P3DB 2WV3A 4LKCB 2XQBL 5CEZH 4EXPX 4DOEA 1T1XA 4QTIL 1IM9A 1QEWB 1N2RB 1DUZA 4X4ME 2NX5D 3N0PB 3WKHA 1QLEH 4PS4L 2VH5H 2VZ1A 4NSKB 4O2EB 3SDAC 3PQYB 3LKSB 4OLUL 3SDAD 5E8DH 2FBAA 4MD5B 1E4KA 1XMWA 5J9PB 4NQSA 1F11B 1FAIL 2Y06L 3U9UB 4RGMC 4RIRA 1KB5H 2AAVA 2EDYA 2JKXA 2QBWA 3WUXA 4U1MB 4LF3B 3RWEB 2R2HA 1YZZA 4JHWH 1DQDH 2Z07A 1HKLH 4PP2A 5M7IA 1JGEB 4NPYB 2Z9TA 5D70H 1CLYH 2PN5A 1H3WM 5IMOB 1X4YA 1PQZB 4W6YB 2AXFA 4PJIE 5MEQB 4DZ8B 1P1ZA 2Y36H 4K8RH 4M5YL 4MJIB 1JI1A 3U0WH 5CD3B 2WNGA 1BEYL 2FUZA 3SDXE 5C71A 1AR2A 3W0WD 4PJXA 3QHFL 1SYVB 2MTPA 2QHRH 4XCYB 3WD5L 1IBGH 3O4LE 4JFYA 3V6OA 2HJFA 5EBMB 3ZDYE 1AD9A 2C9AA 4Z7QF 1A02N 4IS6B 1FFNB 4N0YL 3MLUH 4MA1B 3QFYA 2KKQA 5T3ZL 1VADB 3GBMH 4MHHG 1MCPL 2EYRA 1DFBL 4KJYB 4U1KB 1A6AA 1U8LA 5B22A 2BVUA 3V6BR 2QJDA 2Y1VA 1X5GA 3KAAA 2UZIH 4I3SL 5T3ZE 2Z93B 2ZSWA 1T20B 3R8QA 4JO4L 1RHFA 3BN9C 2VZSA 1RUQH 3BN9D 5EU5B 3QDGA 5GZOC 3UPAA 5GZOD 1T3FB 4DVBB 4XXCA 1U8JB 3MRJA 2W9EL 1DBKL 3IAPA 4Q58C 3ZE2E 5CBEB 2AJSH 1TQBB 5I30L 5L8KB 4Q0XL 3KPTA 1ZKAA 5D7IB 3QDMB 4GW1B 5A2KH 1A6WL 4HD9A 4E41E 3R1GH 4MDJB 3BP4A 3K74B 4PJGA 3KPQA 1KJVB 3H9SA 1B6DA 1JWSA 4XVUC 3BIBX 2IPUK 4XVUD 3LIZH 2OTUB 2P5WD 2J88H 1QHOA 3O81A 4LSTL 1I7ZB 3MNZB 3P4LA 4NQVB 4ORGB 1LE5A 4QHMA 4RGOH 4ZS7L 1LILA 3P4MB 4BH8A 1BJ1J 4MJID 1ZEAL 3MRNA 3U4EA 4LASH 4X5XB 2P47B 4TVSa 3O3AB 2BCKA 4KV5E 4NO5A 4YHKH 2WUCH 4LP5A 1MJJA 1MRDH 2Z8WC 4F7EB 1SMAA 1V8HA 3TVMB 2EDFA 4JPKL 1TPXB 1YNTA 1A4KB 4MA1C 1I8LA 1K4DA 4CMHB 1ND0B 5KSUB 3QXAB 2A9ML 4NJ9H 4U0QB 3DVFA 4H26B 1KLUA 4NZUL 4OQTL 4TSAL 2ADIB 2DF3A 2J8UF 3CIQA 5FYLD 2P8LB 4Y5VB 2VKXA 1AO7B 3CCHB 1NCBH 1N5AA 3X14B 5CJQL 3LN4A 3RWIA 3GSVB 5J7CC 1D5IL 4WCYH 3N1PC 1TVBA 5DJ8A 5JUEH 2X5PA 4FXGB 1UJ3B 1S78C 3KHQA 3UTTD 4YXHL 3V5KA 5FO8A 3CVIH 1NC4B 3ZHLA 1LK3H 1KJ3L 5CJ5A 1F97A 3OG6B 4UOW0 1HSAA 2CKBH 3TC9A 3QDMD 2X70B 1WCQA 4X6EA 3F12A 5EA0L 3FB6A 4A2MA 2VKWA 3ME0A 1CFNB 1V3KA 4PRIA 3TT3L 4XVJL 1KPRB 4KU1A 4XP9H 1CE6B 5ELIA 3V0WL 4DN4L 4EI5B 4WTZG 2M1KA 5L2KA 1OP5H 5DUML 3KPOA 5IQ7L 4EBQH 1IGYA 4L4VB 5HYSB 4FQLH 5DMKA 4EN3C 2P1YA 1G84A 3DX9A 2JB5H 3K4ZA 4EN3D 2N4IA 3FAWA 4AYRA 2H32A 1E27B 4XP4H 1IAIL 2HFEB 3UC0H 3TVMC 5C2BL 4DFIA 3F8UB 3TVMD 2ZOLB 1EFXA 1U6AH 2J2ZA 4QHKJ 3MGTA 1TPXC 4H20L 2VISA 2P42B 4CMHC 1C16B 3RWFA 3L5XL 3SN6N 1F6FB 5FA4B 4DOHB 4Q9RH 4PG9A 4TUOA 3P3YA 3RJQB 1TIUA 1AO7D 3GSUA 4IHOB 4WEBH 5DVLA 1LF9A 1QRNA 5F96H 1NCTA 3GDBA 4Y16D 2CLZA 5SWZB 5IW6A 3QH3A 1NUNB 4ZO8A 1LD9B 5HGHA 2DLEA 4OZGE 5D2LA 4GRLA 2VN4A 4NDMB 3CMGA 3P11H 3FN3A 2UV3A 1NAMA 2ZOKB 4FFZL 4PY8J 3C8KB 3D39E 1MHHA 2NX5A 4NWTL 1SHMA 3MV9E 3QQNA 3GMOA 2JCCF 1YECL 4PJDF 4HK3N 1JPFA 1IQDB 1WIOA 3L3IA 4ELMA 1MRCH 3VH8A 4NYLA 5EU7E 3OAYH 4L4TD 1MH5A 1BOGB 3MLXL 4LPYA 1S7UA 1T83A 3BPCA 1FLRH 3MOQA 3QG0A 5SWSD 3QDJE 4EI5C 3QCTH 4QRRA 4XPBH 5EIIB 2Q8BL 4EI5D 4K3GA 2VQUA 2CIIB 3WHXB 1CK0L 5EOCH 5I1HH 3GO1L 4ONFL 4HKBB 2B4CH 5CEZD 3I6KA 2DQUL 1A3LH 4Q74A 4HFWA 3SJVD 4HKZB 6FABL 1D5ZB 5E2UH 1MWAH 1TMCB 3TWCH 1W0VA 4YBLB 3W0WA 3BFOA 5DWUH 1D6EA 5ESVB 3SY0B 2GITB 4JGJA 1IGIH 1NFIB 5JDSA 1A7OH 3QUYB 5FKPA 3OV6A 1OAYL 1QFPA 1AE6L 2YPLD 4HS8H 3HRPA 5EBGA 1KNOB 2LVCA 5KS9B 4HXBL 1YYML 5IBTL 2CO6B 3D6GA 1FPTL 3ZKMC 1NEZG 1PG7L 1U95B 3ZKMD 3L3HA 1KOAA 5IVOA 3P2CA 3CNKA 5SWZD 1U2HA 3NIDF 3VFGH 1A47A 2CRZA 1U42A 2DL2A 3QA3B 4K8RC 2DRSA 3R06B 4K8RD 4KZDL 4QHNB 1EUUA 4ZXBD 1EA9C 3IDUA 1PGRB 4HS3A 5CBAA 5I1CL 4NP4H 3KLAB 2FV1A 3FFCB 4PGCB 3FT4A 3ARZA 1HN1A 1IC4L 3L95A 3FN9A 1YDPB 3VFPA 3GI9L 1ZANL 3CFBA 4GG6E 4M43L 3CDGB 3BZFB 4L5FH 4OLWL 4XBEL 4I4WA 3BKCH 2W9DL 3IKCA 2IADB 2BSTB 1S7TB 5D72L 5C0BE 4OIAA 3V6FB 4U1MA 3MO1A 3FQXB 3KR3H 4MCYB 3RRQA 1A14L 1XR8B 1M7XA 1I7TB 3K8LA 4ZUVA 1C5DA 2P5WA 3TPKA 1A9EA 3BAEH 1EVTC 3EOAA 2MOVA 2V5TA 1EHXA 3T2NH 4CL7A 1A3QA 3E8UL 3SE3A 2GSIA 2YD8A 2A9NH 3MACH 4FZ8H 3MYJA 4HJ0C 4D94A 4P2YA 1SYVA 4FN0A 4HJ0D 4Q88A 5C1MB 2X4RA 5DD1H 2ICES 3MLWL 1IAKA 3O41A 5F3HA 1YQVL 2BNRB 2FL5B 1FBIH 4MZ2A 4LIQL 1BWWA 1BFVL 5LXGH 1A21A 3KWWB 1R24A 4G7VL 3I02A 3L7EB 5ANME 4PREB 1GSMA 4WI3A 2ADFH 2F19L 5HDOA 2HWZL 1S7RA 3VG0H 5HHNA 1NC2D 4EEEA 3BEWA 5I76A 2XQYG 2ITDA 5F7DB 5TPWH 1I1FB 1VD5A 5C0AB 3QI9B 1T20A 3E6FB 4KXZH 5E70A 1Z5LA 4G43B 3UTTA 3C60B 3VA6A 4RFEA 4NO0B 2OS7A 2K9UA 3FFCD 1GRWA 3V4UH 1EEQA 3ARWA 1OD9A 4ZUTA 3QFJE 2SEBB 5D6DC 4UB0H 2AJVH 2DI8A 2AJUH 3MUGA 5IJVA 3MLYH 4PB9H 5D7IA 2OZ4H 1MFDL 4BFGA 4WHCA 2J8OA 3WO4B 4P9HL 2R1YA 2ITCA 1KXQE 3FB7A 1T2QL 5EORL 1UWEL 3T0AA 3P0VH 3EDEA 4F57L 1B3JA 5KJRL 1KJVA 4GAYB 1FNSL 3TJHC 3TJHD 2ESVE 2P8MB 1KIQB 4OCWH 1FORL 3D25A 2EAEA 1G7PB 4N0UA 5IEKB 1I7ZA 3W2DH 1X5XA 1HOCB 2Z8VC 3LZFL 2LQRA 1OWRM 3NIFE 2MKLC 2R0LL 2ZG1A 4EN3A 5CD2A 1XGTA 4K23L 5E4IA 1C12A 1MJ8H 2CUIA 3LV3B 3TO2B 3H8NA 5KVFL 4OF6A 2NW3A 4LCWB 3BKML 2BNRD 3FTGA 4JFQB 3WSQL 3WFCL 4PJEF 5ISZD 2W60B 3OG4B 5HY9A 4NQDB 2Z35A 4TF4A 1BZ7A 3M1BB 2R2EB 3BDBA 4ZO6A 5FM5O 5GISL 2VZUA 3QXAA 4OIIH 4DQOL 4OZ4A 3PV6A 1U8QB 1A7RH 3TT1H 2ADIA 2P8LA 1AO7A 1RZGA 1K8DB 3EW3B 3B4NA 4M6NH 1W72L 4S1QH 4HWNA 1NGQL 5DQJB 4Y16A 5IVXE 1G87A 3CSYA 2BFVH 3QI9C 3H7BB 4BKLB 1LNUB 5C0AD 3QI9D 1MIEL 3CFJA 3C60C 1P4IH 4LQFL 3L3JA 3C60D 4TUJB 1TETH 4NN5B 4ZOAA 4Z7UF 4NO0D 3MX0A 1BVLB 3C8HA 1ETZB 3G6DL 3BKYH 1MWAB 3DROB 4OCMC 2PYFB 3HNSH 1NL0L 5C0EA 3AS3A 4DKEH 3WO4C 2YXMA 4HDIB 5GPRA 1WJ3A 1MFEH 3QXWA 4JFXA 5D7JB 1CFNA 2AHGA 2ERJB 4U1SB 1NCCL 2F5BL 4KKBC 2W1NA 1RUKL 4L4TA 4KKBD 1KKTA 1FYHB 3QJFB 4P5TB 1KPRA 2ICEB 5DD0H 2EEAA 4UTBH 1KIUA 3PXJA 4L3EB 4WWID 4PJAE 5SWSA 2FSEB 5IVZB 3VDAA 2PW2B 4NKQB 5DK0A 2PXYB 1IVLA 4AENB 4YXKL 5BRZE 3WFBL 4N0FA 3FOMA 5F71A 3SJVA 4XNQA 1PEWA 1GGBH 3B3IB 1ZGLP 3MREA 1IZJA 4I77L 4PYHA 3FO0L 4LCWD 2C3VA 4ZUUA 1RQ5A 5TFSL 1M7DA 5KANI 2VDQL 4GMTH 1KPVB 2YPLA 3IJSA 5GJSL 1S5IL 3QIBB 4K94H 1YEEL 2VLJE 1CF8L 4HGWB 5B3NA 4FOMA 4PJXE 1KB5A 2XPGA 1GOFA 3KJ6L 3T3ME 4IHOA 3U7WL 4YDVB 1AGFA 3OF6D 1H0DA 4BH7B 4KMQA 5FYKE 5JLZB 1BQHA 4G6KL 4GW4A 5E0QA 2YC1B 1JGVH 4ZG8A 1LD9A 2B4CC 4H1LA 2MQCA 2CJUL 4NRZB 4NN5C 4NDMA 2AQ2A 5DO2C 3GKWL 2ILLA 4ZXBA 3PGDB 5DO2D 3RFZC 1X6LA 4QXTA 4MAYB 2P0VA 1LO5B 4RZCA 1TNNA 1IC7L 1VGKA 1FC2D 1ITCA 4F15B 1CL7I 3I9GH 2PYEA 4LCCA 2DTSA 2VLKB 5E99H 5KAQG 1BGXL 1IQDA 1OSPH 3QDGE 4L0GA 2ERJC 4GT7A 4I3GA 4I3RL 2R0KH 3ARDB 1CD1A 5FOJA 2MKWA 1A6PA 2X41A 3G6JF 2Y07L 4P5TC 1F3DH 1BOGA 1I9EA 4P5TD 1ZLUK 1NANH 3VU2A 5TE4H 2FYYA 4ZYKA 2HFFB 1MVFA 1MCOL 2R0ZH 3M07A 5KTEH 5DK3A 3O11A 4MNHA 4F58L 5IHUL 4QOKD 4XAWH 1DLHA 1CGSH 2B8OT 4HWZB 4R96B 3OJMB 3H9SE 2VB5A 1Q9KB 1T22B 4YAQA 1ZT1A 4YBQD 2HG5B 1BFOB 4HEPG 1S9WA 2J4WH 2XRAH 5D2NA 3RWGA 3DUSB 1H8SA 4OZHA 1VFMA 3REWB 2WQ8A 3RVUC 4XCEB 3V0VA 3ECBA 1EHAA 3B2VH 5KVEL 3QIBC 1R3IL 4DVRL 4WHYG 5K9KA 2YMXH 5DHYB 5DJZB 2R8SL 1G7HB 2XOTA 3GMNB 2Z31B 3PP3H 3U2SB 1G7LB 3GMLA 1RUAH 4KVCH 5ID0B 3T65A 1NAKH 1T0PB 1KYOK 3GEWB 1NC2A 2BP3A 3DXAB 3IFOB 3QA3A 3QHZL 5M94B 1A7QH 4FFYH 2F8XC 4S0TD 1UKSA 1VFOA 4QHNA 1TJHH 1JUFB 3OKYA 4QCIA 3E6UA 4YHPB 4F15C 2DJSA 3N85L 5JQHC 3IFPB 4O5LL 2AEPH 3BYTA 2WIMA 1BIIB 4Y88A 1F2QA 1MCCA 2DWEB 5DXWA 2VLKD 4BSVB 5E8PB 4ZFZA 2DQHH 1T5WB 3VFNB 5ERWA 1NFKA 3GBNH 3BZFA 3MJGX 3ARDC 3ZTNL 43C9A 3T1FB 3ARDD 5D71L 1JZ6A 3C6SB 4KQ3H 3VFOB 4RMSA 1X5HA 2IADA 3LSOB 1MFNA 1FVDA 2D03L 1CDCA 3FMGL 2DQDH 4OB5L 3BJLA 3VW3H 1P7QB 1UB5B 3QT9A 4OCRL 4ZNEE 4PRIE 4Z77B 2IPTL 2XY2A 2R1WB 1MLCB 4YDKH 1JNLH 4KZEL 4P59H 4ELKB 1GGYA 3IRPX 3QWTA 1I7RA 2R29H 1N3NB 5L2KE 2NNAB 1TZIA 1A4JA 3CIHA 3RVWC 2GW5A 3P30L 4JN1L 5ACZB 4KI1A 3NCEB 1FZMA 1NCUA 2K1MA 3UCRA 2CKBA 3BIKA 3VI3F 4D0DA 2CQVA 3B5GA 3GJFH 5ISZA 3QIWB 4Y5XA 1HQ4A 4P0DA 5BOZG 2WP3T 3I2CL 2VZTA 3J7HA 1IRAY 2Z31C 4PRHE 1S9KC 3QSPA 2Z31D 2D31A 1JGUL 1N64L 3MV11 3BVNB 2PCPA 3L7EA 4JHAL 4XAKE 3OMZA 1T04B 1A7NL 3PJSA 1N4XL 2HRPH 3DXAD 4PJ7A 3INUL 3RWHB 2NTFA 5E00B 2XFXB 4U6VL 5F7DA 3G5ZA 4JPWH 3QI9A 2E6QA 2I60H 3E6FA 3WFDL 1X3DA 1EO8H 4KPHH 3U7AA 1QRNE 1IAMA 4UUJA 1NMCB 1NAML 4NO0A 2HJKB 3ZTJH 2VE6B 4FQ1H 3U4BL 3LEYL 5FO9A 4W6XB 1GIGH 2O5XH 1T03H 5ADPL 3QUKA 4L8SC 1NKOA 4F9LC 1QFWH 3AREA 1CN4A 3IT8D 1FO0H 1K3IA 2NX5E 2YR3A 3WIRA 4GAYA 5D1XA 4MMXC 4NRXA 3FOLA 1UA6H 2ATKB 4ZSOB 3TJEL 2NQCA 2OCFD 4ELME 1F4HA 1SJXA 4HHAB 3H9ZA 4CDHA 5D4QA 4YPGA 4U6HB 3HMWH 2HH0H 4F8TA 3OKNB 1HXMB 3IFLL 3KYAA 4X9BA 2J8UB 4QRRE 4O51A 1MELA 2YKLL 3VWJD 4DW2L 2XY1A 3MCKB 1XCQB 2OL3H 3MV7B 4JRWA 1J0ZA 5CWSB 1XCTB 2G60H 4ODWB 4FA8A 1FAKT 5C0GB 1H54A 3S35H 3VXTB 3VXRE 2B0SH 3ZMRA 2W60A 1BD2B 4EOWH 5SX5H 1L7TL 5I8CA 1B2WL 1H3XA 3LAFA 2C3WA 1A6ZB 3NCJH 2NPLX 3OKLA 1DQTA 2FX7L 1J8HB 1U8QA 1L0QA 3R4DA 3LEVH 1KREA 3B5HA 3MV8B 5DDHA 4FQIH 2RQ8A 4LEXL 3OXRA 3OB0K 5C70A 4Z9KB 4KVNL 2AEQH 2PW1A 3SCMB 1HHIA 1U58B 3T0BA 4WO4B 1A5FH 1IKFL 2QSVA 5D8JL 2OX5A 1DTUA 3STBA 3U9PH 5GJTH 5A40E 1YMME 5HGDB 3FO9B 4GRMA 2FATH 1ETZA 2YSSA 5IROC 1WSST 1MWAA 1FVEB 3WIHL 3DROA 2QKIA 2CDEA 4PGBA 4JPIA 3RRSA 4K7FB 4J6RH 4K94C 2R0WL 5E03A 4YHIB 4LSQH 1DBJH 4HPOH 4KTDL 3J8F7 4EXKA 5L6YL 4PFEA 3PP4L 4WVBA 1G6VK 3CU1A 5F9OH 5C08A 5DD5L 4WY7L 3QJFA 1V7VA 2YUZA 2X40A 4HT1H 5LGHH 5SX4H 2PF6A 3O45A 2P46B 3PWUB 1BZQK 1I3GL 4H88L 4QOKA 2Z92A 2AK1L 2Q76B 1AXTL 1RIUH 3K2MC 3ES6A 4OBSA 4ONHA 3MLZH 1PZ5A 3A6CL 4PJCE 1QZ1A 3V79C 5CZLA 2E6JA 1YNLL 2V7HB 1U92B 1UZ8B 5DK2B 2P5WE 5JR1H 1RZKH 4TSBL 4NT6A 5JHLH 5DJXA 3OXSA 3CK0H 4XC1L 1A9BB 1PDKA 5BJTB 4KKLC 5HGBA 3GSQB 3F7RA 4KKLD 5IGXL 3HE7B 3BP5A 4PP1C 4PP1D 3OR7B 4LLUA 2FBJL 4WFGD 1J8HD 1ZSDB 3ULVH 1LO3H 2OMNA 4JM2F 4LNVA 1KC5L 3E2HB 3MV8D 2MNUA 5EU6A 4S1SH 3U0PB 3SCMC 5FYLL 2JCCB 2MJWA 4PJDB 2GJ6A 2X4UB 3SCMD 3LS5L 4NO3B 2DDQH 4AEIH 4LKXA 1WC7A 5MHSE 3PL6B 3TA3B 1KSDA 1T1YB 4NRZA 1FFPA 5CKAA 5JOPE 2E7MA 5BVPL 3QNZB 4U7MA 1AQDB 5DZLA 4HLZG 3VRIB 3LKQB 1I8MB 1OAUL 5EFIB 4ZUSA 4TSCH 4Q6IB 4GAJL 3MCG1 1I1CA 3UTSB 3OKOA 5GGQH 1RZ8B 1S9YB 2Y25A 1FRGL 3G5YA 3PWPD 3UTTE 3DIFB 2VDNL 3DGGB 3GJFB 2W07A 4RA3A 5J11C 1QRKA 3DURA 1LE9B 3ARDA 2R69L 3EYVA 1UWGL 5GGVH 1UYWH 5E5MA 3IDXL 4YO0B 1GAFH 4LRNH 3PGCB 1MI5E 1CR9H 1OF2A 1MFAH 4XRCB 1E28A 4LBEA 2VC2L 2AJ3A 2F58H 3TH2T 3U4AA 4AG4L 2BRRH 1T5XB 4HEME 2FJGA 3KJ4B 2P7TA 4JHBA 3NIGF 4NRYB 1R0AH 4QF1A 5FUOH 4NQUA 5JOFB 3NFNB 4ZH5A 2KQMA 4XNXL 2QV2A 1DJSA 4L8CB 5FGBA 4N0UE 1Z3GH 1RZFH 3AUVA 1YQ2A 3PMMA 5AWNL 3RI5K 35C8H 5KVGL 3HE7C 4GJTB 4UT9H 3HE7D 3L9RA 5DS8B 2OZ4A 3JTSB 4QKXB 1FH5H 3FQUA 3QJHA 2JJBA 1FO0B 3E2HC 3QDEA 1AJ7L 1OT2A 3QXUA 3W7WA 1MAML 1HINL 2P5ED 1DLFL 1OL0A 3HHRB 2RAMA 4MJ5B 4X0KA 3PL6C 3TA3C 3VFUA 2UYLB 3PL6D 4JFPB 5JXEC 5JA9A 2X9XA 5JXED 3HI6L 1ZLSL 2JTDA 3HC0A 2XZAH 4LCUB 5I8OL 3MJ9H 2FR4B 4N8PA 3NN8B 5AG9A 3UTSD 2OL3B 1CEMA 4PJIF 1X5FA 1BIIA 3DSFH 3VXUB 3AY4C 5E1AA 3O8XB 4UT7L 3ZDXE 5TDPA 1WIPA 2VLRE 3T1FA 3SDXF 2IALB 3C6SA 4L8SA 1M1SA 5A2JH 3SDDB 3MOAH 4LPXA 2A6JB 3LSOA 1IAOB 3TIEA 4H8WH 1P6FA 5DJDA 4E0RA 5CGTA 2X7LA 3HE6C 4UILL 3T8XA 3VGEA 2UY6A 4P5MB 4OF3A 3ZDYF 3HE6D 4A6YL 3S8WA 1T2XA 4P46B 5FV2A 1IMHC 1AGEA 4OCSH 1MAKA 1MIMH 4HG4K 3CLEL 3LKOA 3T4AB 5E94B 5SWSE 4DKDC 3UTPE 1EMTL 3VWJA 2X2YA 2VAAA 5HDLA 3JBG7 4DODA 2DLFH 4OD1H 3CGTA 4XP6H 3SJVE 2KZWA 3IGAB 4P9ML 2IPKA 1KB5L 1KCVH 1QNZH 3MGOA 3ZE2F 5C07A 3QEGH 1NMBH 1QBMH 1RZJH 2AHFA 1QYGL 4L9DA 1T04A 3M17B 3EYSH 2AGJH 2YPLE 3TCLB 1YEGL 1SEQH 4KUZH 1E4WH 1CLYL 4NGHH 1QSVA 2E3VA 4X7SL 1A7BA 3C2AH 3DWTA 3KNBA 3U0WL 4XZUB 5C7XH 1GCFA 1EX0A 2HJKA 3FO2A 2COQA 5EWIH 2VE6A 5IROA 1EBAA 5DI8A 3O8XC 1NQBA 1BJ1H 2QHRL 3O8XD 5HVWA 4WEUD 1QFOA 3IYLW 5EH1A 5I1IH 4P57B 5IBLC 2AJYH 4YDJB 3SDDC 3WIIL 3O4OC 4KV5F 4NUJA 5IBLD 5F7HA 4XX1G 4HLJA 2D7MA 3KDMA 1XF4A 3O9WC 3SDDD 5KSBE 3BD4A 3N1MC 1QPPA 3RIAK 1ZT4A 3O9WD 2DBLL 1AGMA 2Y72A 3QDHA 3T77B 2DIAA 3MLUL 2PYEE 1JGLL 3EFFB 2Q87A 3D18A 4RQQB 1Z6JT 2FGWH 1SBBA 1CDHA 2CDFB 2F8OA 4OFIA 4PJ5B 2RCSH 3V52L 4LLWA 5GRWA 1MQKH 4PJEB 4DJMA 3ARGB 3EDJA 1H3VA 3PDOA 4ZTPH 1EEYB 1CICB 1RU9L 3G6AB 1NGXA 4CW1B 2XT1B 2X4TA 1HXMA 3CDFA 4XNMB 2WSKA 2ZCHH 4YIQA 4OAWA 2J8UA 4W70A 4U6YA 4C83A 4TYUA 5I1DB 4X9IA 1U8HA 1D5BB 1GPOL 2R1XB 2VLLB 3P9MA 5FXCH 1LEKB 5EC1B 5CWSA 3MRBB 1UQSB 3FQRA 4KC3B 4LEOA 2AJSL 5J13B 1UB6A 1KN2L 3RY4A 3BZEB 1BFTA 1EIBA 1PKQB 1U91A 1RVFH 1FDLH 1C1EH 1I8IB 4Z7UB 5D2NE 4OZHE 1MCWM 2C1PA 5TQ2H 1IT9H 4MX7A 3N1QC 1R5VA 4TOYH 2E7BA 2XG4A 2RGKA 2XWJB 3DX8A 1L9MA 2J88L 1GZQA 4KXZI 1EO5A 5I1GH 4ERSH 4NOFA 4RMQA 5ITFB 4RGOL 2VZVA 1LWRA 4WHDA 2XIDA 2GH4A 4Z7OE 3ILPB 1RZKC 5CIPA 1X5JA 4HF5L 5M7YA 4M62H 2UZXB 1G0DA 3QG7H 2EKSB 3HCVB 1IAIM 2KQNA 3ACSA 1MRDL 1U8NB 2I5YH 3HMXA 3PWPA 1G6IA 3EKCA 3UPRB 1T7VA 3QEUB 4M48H 3ULVC 3OX8B 2GJZB 3ULVD 3CSGA 3RNKB 2F54A 2XN9E 5C0JA 5TE7H 1WT5C 1WZLA 1CD9B 4PJ5D 5JHDB 5KVMC 1NCBL 3JWDL 3ARGC 1FP3A 1CQKA 1WBZA 5KG9B 5HDQH 4Z7VE 4JPVH 1CICC 6CGTA 2XXMB 1MHEB 2Q76A 4QRPE 5EPMA 1NCDH 2F74B 1A6TB 4ZAKD 4TNWK 2WANA 1LK3L 3ARBB 3IDGB 5DJAB 4JDVA 5DD6B 1ACZA 1DQLH 3CC5A 1KIPB 1HE7A 3GSQA 2CKBL 4QTHA 3WS3B 4ODVH 4AK1A 2B1AH 1YYLH 3U7YH 1GYAA 1CG9B 1UACH 4GW5B 2GI7A 1F02I 2N56A 2CLRB 2CQSA 1WZZA 1T6WA 4G6AC 2P5EA 4I0CC 3BQUC 5EO0B 4XP9L 4G6AD 3BQUD 3IDNB 4H0GA 2C1OA 4FTVE 3ZYZA 5CJXA 4ONGL 3L7FA 3THMH 4WVRA 3PL6A 5ESAB 3S4SB 4EBQL 5JXEA 2VL5A 3PABB 3G6JB 1U3HB 5A16A 4MHHI 7FABH 1JN6A 4R7DB 1T80A 4K3DL 4JFDB 4KRMB 3UTSA 1R3JA 3WKFA 4XNUH 4KRPB 4LLMA 4KY1L 1HWHB 4ZFOB 3AY4A 2VABA 4HUUB 5BW7C 2YPKA 3GJFA 1H3PH 4NKDB 2V9TA 4X6FA 3K4DA 3NOIA 3QQ4A 3TLRA 3IETB 4C55A 1HKFA 1K6QH 1QP1A 5JHDD 1YJDH 3MRIA 5F96L 4OZFG 1A7PH 32C2B 4JJ5A 1H13A 1WGOA 2EYTA 3HE6A 4O9HL 3U83A 2JB6A 4PJ8B 1OAXL 4YEEA 3CZFB 5C0DB 2H2PC 2F9BT 2NY1D 1KB9K 2H2PD 4EUPG 3H9HB 3RBGA 3P11L 3NFNA 5D7SH 1ROWA 2FWOA 4M1CC 4L9LA 1JYVA 5MERB 2Y9RT 4M1CD 1BZ9B 5I1LB 1XF2A 3WNLA 3MLRL 1BBDH 1QVOB 1JNHB 1A2YA 3QNYB 5TGBB 4MA7L 3HS0A 2DI9A 2BVQB 1PLGL 5DS8A 4RNRB 4LCIH 4MQ7B 1C08B 2IBBA 3MLTB 3GMPB 4FP8L 1MRCL 4H8WC 2GJJA 3LQMA 1K5NB 3EGSA 2J7LA 4GG6F 5K33A 4K3HA 1X5LA 3V95A 1UJTA 3WIQA 2D2OA 2CLVB 2FB4L 2Y5TA 4JFEA 4XI5C 1IFHL 4JFPA 1BQLH 4XI5D 5EOCL 5DQ9A 5I1HL 1U3HC 4HV8B 1U3HD 3EYUH 4APQB 1JGDB 3VXOA 1ZS8B 5GRJL 4HIXH 3RZCB 5CAYB 2BSSA 3DVNB 4JFDD 3JV4B 1KEGH 4GXVL 3C5SA 3IDYC 2W91A 3QWRD 4RMWA 5CSGA 4LFHG 2O61A 3DHJA 1A7OL 1LO2H 4Z0XA 3Q48A 5ALBH 1K9TA 4OUUB 4WI6A 3O9WA 1RZJC 5EN2B 3D2UA 4M03A 4BK5A 1AGBA 1IGMH 1B4JH 1F3JA 1VFAB 3WMSA 4IRJD 2CDGB 5D1QB 2LE9A 3BYYA 4P5MA 4PJ8C 1DQQB 3K7UA 3FJTA 5FYKU 1KS8A 1UM6H 4ZODA 3N9GL 1I1YB 3VFGL 2CMRH 2DQTL 1G7JB 1WU6A 1YN7B 5C08E 3NZ8A 2ARJA 2YBRB 3OGCB 2HTKC 1WAAA 4L1DA 4Y7MA 3MRRA 1XT5A 4YHLH 4J12A 3GSOB 4QOKE 5DRWA 1A1NA 5D96B 3CSBA 5T3XE 1WLHA 3SPVB 3KYMB 1IKNA 5AYUH 2IH1B 5GGRY 3G9AB 4YE4L 5T1MA 1TCMA 1ODAA 4WUKL 3LKPB 5FDWB 1Z9SA 3FQTA 4YHNB 5KW9H 3NFSL 1RURH 2DJ4A 5MENB 3EYQC 4NBZB 5FFLA 3EYQD 2VDRH 4P23A 3WXVH 1J9CT 3WKIA 3BAEL 4IMLB 3MMEA 5JO5A 4JGMA 1IEAA 3OKDA 3ARPA 2DLTA 4UDUA 5EU6E 5IW3A 4NFDA 3W9EB 2GJ6E 3MACL 1VA9A 4QTIH 1T7ZA 2D7QA 4FZ8L 3TBVA 3OKEA 1UG9A 3ILQC 4JKPH 3UDWA 4N5UA 3ILQD 1F9DA 2HVJB 3UJTL 1TF4A 1S3KL 5D9SA 1LMKA 5DD1L 4EVNA 3WJLA 1SEBA 3QFZA 4N1EA 1AP2A 3NIFF 4YDJA 3DRTB 1FAIH 3AU1A 2Y06H 4HXAH 1ED3B 4D9QE 1MCBA 1TTFA 2HRLA 3EO1A 5LXGL 2DKUA 1DVFC 3D0VA 3LCYA 1DVFD 3QXVA 4MD0B 1Y6KR 3PHOA 5E5UB 4OV5B 3S35X 4PJ5A 2ADFL 2AKRA 3VG0L 3QQ3A 1JL8A 1MREL 5F8QC 1ZGLM 5IK3A 5ALCH 5GZNC 5FEBA 5E8OA 5GZND 4D8PB 3CFDB 3NCYP 5FF6B 2CUMA 3EBAA 1F00I 4M5YH 5IVXF 4ZAKA 3GIVA 5D96C 1BEYH 4UU9A 5F7KC 4HAGA 5KSAA 5EC1A 3QHFH 4R4BB 3IXTA 4WUUB 4R7NB 4UB0L 2UVEA 3QPQD 4UQ2A 3WD5H 1MSPA 4Q2BA 4WU7A 1UADC 1Z9OA 2J12B 5C0CB 1QPXA 2VQTA 5HHQB 3WJJA 4QRUA 2XA8H 2EYSB 4MZ3A 4N0YH 5DJ2A 2FECI 5T3ZH 1WTLA 4JKKA 4LLDB 4LLQA 4LSRH 3BQUA 1IGJA 2E9JA 3IJYB 3W2DL 1Y6MR 3HB3C 2C4XA 1NDMA 1QR1B 4QT5A 2ICCA 3HB3D 3BRFA 2VWEE 1KLGA 1INQB 4YDIL 1W0WB 3C2SA 4HGKC 4NUGL 1MJ8L 3HCVA 5EG6C 1QFWI 3DMMB 2W9EH 5E2VL 5JW4N 1DBKH 1U8NA 1YMHB 4D9LH 5BQ7B 1EAPA 3OX8A 1A6WH 1CFSA 3GSRB 5J57B 4G8FB 3K0WA 1ZHLA 3HAEA 1YEDA 3TT1L 4AIZA 5A3IC 2XXCB 3NPSB 5A3ID 2JF4A 1X5YA 1M7IA 1K4CA 5GRZA 4M6NL 1VDGA 3BXNA 4GKZB 4PJXF 1H9VA 4LSTH 5MEOA 3S36L 2JK5B 5HXMA 4U49A 5F1NA 4I0PA 1X7QB 2YD3A 3GGWA 3MGAA 3T3MF 2J6EH 5ESQB 2OKXA 3W82A 4ZS7H 5EUKA 1MRFH 2CIKB 4JM2B 3VXQA 1A64A 1TETL 1ZEAH 3S98A 5C09B 3GM0A 4X8JB 4R9HA 1FL5B 1S7WA 1GOGA 2AV1A 3O3EA 3TNNB 5IMMA 4U2ZA 1DQML 1LVEA 4OFKA 4PRAA 3QB7C 4JRYB 5GQBA 3UTOA 4WUUD 1YEHL 3NABL 3NCFB 2YWZA 1ES0B 3QEQE 5DEGA 3MFFA 5ID1B 5I1AB 4UI2A 2NY6B 4JPKH 5I8EA 3L5IA 5LBSH 2EIDA 1YJDC 1WEJH 9CGTA 3B6SB 3HZYA 4NZUH 4TSAH 5EOTA 2OJEB 3QAZC 5DD0L 1HH6B 5K93A 1KWFA 2MCG1 4F9PA 1D5IH 1KB9J 2Q6WA 1UXSB 2Z0BA 5C07E 3ZT6A 5TQ0L 1HHKB 1U3HA 3EYOA 4YXHH 4LCYB 4R7DA 4PRPB 3L5WA 3DMMC 1FNGB 3DMMD 4PJGF 1KJ3H 3WXWL 1U8KA 4LLYB 4JDZB 5M7QA 3QFDB 1KCUL 3UZQA 1XGRA 4GMTL 1GLMA 1UCBL 3U1SL 3QDAA 5DJ0B 5EA0H 4EDXA 2EEBA 5T1DL 4G80B 4EI6A 4HJJL 1QQDB 5SX4I 3LH2L 4YFLF 5AG8A 3NPSC 3TT3H 1ACYH 1LGVA 3RX5A 4WHTB 5JPMA 4XVJH 4BZ1L 3FB5B 5CJBA 32C2A 4NC2B 4IRJA 5ITBL 2AJZA 3KXFA 1FMIA 4JAMA 3V0WH 3IJHB 4DN4H 5H37G 1FG2B 4KK9C 2Y7QA 1Z2KA 1JGVL 1YNKH 4IM8A 4PRBA 5C0DA 4KK9D 5DUMH 4JM2C 1XH3B 2MHAB 1IGTB 1DL2A 5F7NC 1NUFA 1RJYA 5C09D 1JYXA 5EDXA 2WLZA 4ODBD 1BM3L 5E24E 4JRYD 1BZ9A 3GLYA 3HZKB 3I9GL 1ZE3C 1QVOA 1R5IB 2C3HA 5IFHH 5C2BH 2NY6C 4ZTOH 5EIQA 3Q6FA 4IBLT 3KPNB 3NA4A 4RNRA 2BNQA 3SE9L 4RISH 2ZUTA 1OSPL 2EDBA 4H20H 5DZNA 4M7ZC 3U30B 4J2XA 3PWNA 4Y2OA 3WIFA 2R0KL 3ZT7A 4CN6A 1OSZA 3QO0A 2YEZB 4WEMB 2GTWA 1FNLA 5CJOH 1Q9LB 4JANB 4PJIB 1OPGL 5TE4L 4HUXA 5C2UB 3MLVL 3ET9F 4TUKL 4FRWA 1RIVL 2CLVA 3LEXA 1W2KT 5KTEL 4XAWL 3SDXB 1CFBA 1CGSL 25C8L 1V3JA 3GIZL 4LOUC 4CNIB 5DSCA 3O4LB 2DIBA 5DRXB 4GQPH 4LOUD 3DX6A 2J4WL 1BJ8A 1KT2A 4NKMB 2WZPD 3TZVA 4JY6B 1YC8A 4CVZA 5GSRA 1T21B 3RIFF 5DJCA 1SJEB 4QHLA 5ICXB 3HMXL 5IW1A 5JW5A 3S34L 4U1JA 1S7XB 4ZDHB 4HKJA 3X3FL 3TP4A 1WVZA 4LARL 1VGEH 2FIKA 3FZUC 3FZUD 3G5XB 4ACPA 4FQXB 4D0BB 1Q9OB 4CU6A 4RRPG 1DVFA 2CDGA 3MLXH 1FBOA 1DQJA 3WEXB 3OSKA 1NAKL 1F42A 1KJ2H 2DROA 2VUOA 4PGDB 1CK0H 2NY3D 1M71A 1U8PB 1G7JA 2F54E 3ARUA 1RHHA 4K3EL 1A7QL 4FFYL 4ONFH 1RK1B 2BMKB 1TJHL 5LQBL 2DQUH 2YBRA 4GKOA 2HVKA 1FIEA 1XGPA 2OTWB 2W65B 3DVIA 6FABH 4LPWA 4KHXL 5C8JA 3GSOA 2I26N 4LSPL 1SMOA 3X11B 1EV2E 1RJZB 1QD0A 3KYOA 1X4ZA 4RAVA 5AUMB 1QBLL 1XF5B 3D3VA 3MXWL 3RVTC 4JREB 4HH9B 1HQRB 3MA9H 2YIKA 3RVTD 4UDTB 3PWJA 3U30C 2DQHL 1LP9E 4OLYH 3W9DA 5HJ3A 1VEPA 3WNNA 1AGDB 1AE6H 4MXVE 4HXBH 1I1AA 4GQ9H 3MRMB 1YYMH 5IBTH 4WI5A 1FPTH 1FJ1A 2CSPA 1NDGB 4FFVC 3VFSA 2DM4A 3JV5A 3STZB 2P4AB 1JJUA 2X1WL 4P4KB 2V2TA 4FQQB 4X6CA 2EEDA 1BBJB 1QKZH 4U1HB 4WJ5A 2B2XL 4HQQL 3HI5L 4M8QB 3V6ZA 3O4LD 2OR9L 3IDMB 3ARFC 3HPLA 3QZWA 1TITA 3VWKA 1MCFA 3VH8G 4ETQA 3ARFD 2WBWB 3TGXA 4ELMF 4G7YL 2R29L 1FVCA 3KHOA 2EDJA 2V2XA 5TDNB 8FABA 1G7MA 1VFBB 1ZANH 3CLFH 4DCQB 3B83A 4OLWH 5I66B 1Q72L 1WTGT 2W9DH 3H3PL 5T3ZD 1KPUA 5EOCJ 4MD0A 3CVHA 3VRJB 3SBWC 2A1WL 1A14H 2X4SB 1HEZA 3F7YA 4JRXE 1FNEB 4I9WE 1G1YA 3ARYA 4OQ1A 4M6OL 2AXHA 2F53B 4IRZL 1I85C 3PHQA 4E41D 1FZKB 1CXIA 1QG3A 2AERT 2AXGB 2FO4B 3GZKA 4XMPL 3ON6A 3PG2A 2I9TB 1JS4A 3QIUB 4F7TA 4WUUA 1HCVA 4E5XB 1AIFA 4O2CB 4P5KB 1GIGL 1OAKL 1VEOA 4NN6B 2B1HH 1YQVH 2GAZB 4XNYH 4GUPB 1YEJL 1ZLVK 5IHZB 4LPUA 1U93A 5HHQA 3SE4C 1BFVH 1T1WA 3QWOB 1ZVYA 3KPPB 4G7VH 4P4KC 1UA6L 3F5WB 3DTXA 4G8GA 1JPTL 3GJEA 1WBXB 1ORSB 2HWZH 3FKUS 3WKNA 3PQYE 3DV4A 4L8DB 3EUUA 2X1PA 4XPFL 1HHGA 5JXAH 4NHUA 1UM4L 5I17B 3HMWL 5AAWA 5DEFB 2JJSA 5KANG 4UV7L 2BC4A 4AEFA 5HHPA 4JFEE 4HIHB 1INQA 4Y4HB 1OAQL 4PY7A 4A2LA 3O6FC 3S4AA 3O6FD 5DUPL 4AM0B 3DMMA 4PJCF 3W11C 4X7TB 3W11D 4M93B 3S35L 3TBYB 2ED9A 1QA9A 5CILL 4OI9A 2RFXB 2B0SL 1KGCE 1MFDH 1M6OA 1OP9A 4CU8A 1AGCB 3NCJL 5IHBA 1T2QH 4XXDA 1UWEH 4KDWA 3REVB 2VXSL 5KJRH 3LEVL 4U1NB 1FNSH 4QXUL 3D5OF 5ICZA 4WWKA 4ORZC 5I71B 4W81A 3S5LB 2FEDD 4L29B 3WFEL 3K1DA 1ZLUH 1EXUA 5C6TH 3K2UH 3NACL 5J1SC 5ESQA 5LWYL 1OW0C 3MYZA 2CIKA 3QULB 3UPCA 1B88A 4P3WA 3MV9B 1P7KB 2X10A 1ZTXL 1JIBA 2R0LH 2XKNA 2P49B 3JXAA 4M61B 3MFGB 2XTJE 1F4YL 1OM3L 4K23H 2P43B 4PV8B 3DSNA 4IJ3B 4NN6C 5TH2B 2EDRA 4XCCL 5KVFH 4MNGA 3BKMH 5ID1A 1U41A 2EE6A 3QDJB 3WFCH 4OLZL 4P2QD 5FGSA 1CS6A 1QLRB 5IR1A 5GISH 4DQOH 5HBBA 4UQ3B 3P4OB 3S96A 5TJWK 4P2RE 3ROLB 4X8XA 1D5XA 5LGHL 5BV7L 5AD0A 1W72H 5FCUH 1NGQH 3B8SA 2AP2A 3WFHA 3BKJH 1OHQA 4HKXB 2DRRA 1GHFH 4J3VA 3W7UA 1HHKA 3MLZL 1MIEH 1IZKA 4HUWA 3L1OL 4LQFH 3IS1X 4RBPK 1BWMA 3G6DH 4O02L 5JR1L 4G3YL 1FHGA 1RZKL 4KTRA 5JHLL 3WV0A 3CK0L 4IOIA 1ZA6B 4JDZA 4M93C 3RIAF 3QFDA 3T0ED 3GSNA 4Z76B 3GSWB 2HKFH 5F97E 5LKNA 1L6XA 5I0ZA 4U1IA 1GZPB 4QHKI 3BGFB 4U4BA 2NY2B 4JQIH 1TVHA 3MQIA 5AAMA 3ULVL 1LO3L 4RMUA 3G9VA 3VXPA 3QQ9C 1NCCH 4XCNA 3ZSTA 3QQ9D 3CX2A 2DDQL 4AEIL 4J3OC 3D39D 2F8VA 4JFHE 4X4MA 1S7SB 4YHYB 4UNTA 3MBEB 3MV9D 3V5DA 3SGJA 3SKJH 2A38A 1TCRB 4CMMA 4GG6B 1MCWW 2A6DB 4HZLB 1CFQB 2X4QB 1HILB 5EU7C 1HSBB 4JCMA 4PY8I 2HJLB 3FO0H 2WIIB 5JA8B 4AYQA 2ZKHH 3QDJD 3KPNA 5TFSH 2P24B 2UVFA 3RDTB 4JJHA 1V3MA 5FYKH 1TQCB 4JY4B 5GJSH 1S5IH 1YEEH 1UYWL 4QY8A 2VNCA 1EFQA 3KJ6H 4LRNL 4MJ6A 3OWEA 3EO0B 2V2WA 4CJ0A 1MFAL 1OGTB 3BISA 3DOSA 3U7WH 3OHXA 3UYPA 4Y2DB 3NMEA 1GGUA 1GGTA 2BRRL 1VACB 2X4NB 4IOSD 4JB9L 3WN5B 1KN4H 5IB1B 5FUOL 2Q7YB 3L3OA 4MSWB 3GKWH 4CNIA 3OAZK 2YRZA 1J05A 3ETBF 4WRLA 3I3DA 5I16B 3ARFA 1IC7H 2GT9A 3U6RB 1X9DA 3C5JB 3MJ8B 3N1FC 5GGTA 4KUCD 3U36A 1KIRB 3MODH 5LCVL 4UT9L 3WNMA 1SJEA 5EO1A 3IU4L 5ANMB 1FFOA 4ZDHA 5T1KA 2AJXH 2NY2C 1N6VA 4HK0A 5HYSG 5DTFB 1FH5L 4WV1B 1FZOB 3BD3A 5C3TA 3MRDB 4KDVA 5BS0D 2F15A 4CVXB 4DGVL 4YX2L 5B39B 1QSED 2GK2A 3TO4B 1H5BC 4P2CG 2APVA 5J0BA 2EIZB 5HYJA 1GXEA 1XGQB 1MLBB 3BRGC 1MCOH 2C7UB 3ZL4L 4I13B 4PGDA 5IHUH 4F58H 4YHYC 3MBEC 1U8PA 4TNWF 3EZJB 3MBED 1P4BL 3MSPA 3VXSD 2XZAL 4KKCC 2Z8RA 2BMKA 3BP6A 3W7XA 3BUYA 2ZG2A 2W65A 3MRLB 4JM4L 4E41A 1NCAH 1RJZA 5B38A 2A83B 3DV6B 1KTKE 5C0BD 4HH9A 3RDTC 4XWOC 2DKMA 3RDTD 4XWOD 4ZPVA 3X13A 4FXKB 5KVEH 2ESVB 1R3IH 4DVRH 4ZQKB 5LG1A 4MA3A 2XWBB 5EZJB 1BVKB 3OKKB 4Z4JA 4BSWB 3MOAL 4GG8B 4JR9L 4X7EC 4YR6B 2R8SH 1LQSR 4M1DL 3SE4A 4H8WL 4Y2DC 2GCYB 3ABZA 2IAMB 4Y2DD 2X4OB 4O2FB 5KSBF 1JHLL 2QSTA 4BSJA 4LPVA 1V7NH 4HW6A 3OB0H 4M9OA 2J6EA 3QHZH 3AM8A 4OCSL 1JE6A 3E3QE 4PRDB 1MIML 1DBML 4JO3L 3QUMA 1PG7W 2GSGB 1T1ZA 3KPLA 1TVDA 3DLQR 4O5LH 2DD8L 1FLTX 5KKBA 3O6FA 4K2UL 4M3KB 5EULV 1JWMB 1SBSL 4GSDL 4OD1L 5DMYA 1F3DJ 4WV1C 3OJDA 3ZTNH 3MRGB 5E8EB 4QRQB 5IVXB 2QADB 1CTOA 1KCVL 4G9DB 3TO4C 2QQNL 3JWOH 2YPVL 3TO4D 4JZNA 1QBML 3C9NB 3SKUD 2D03H 3RWCA 2H6PA 5DUBB 2HAZA 1JHKL 1IC1A 2VDPL 4HGMA 3FMGH 4OZHF 4OB5H 4KUZL 1E4WL 1W72B 5C9KA 2DQGL 2IBGA 1ZGLB 3GHBL 3QFJD 1B0GB 3WL9B 4HIIB 3HFML 3C2AL 1OW0A 1LK2A 5HD8C 1CT8A 4EL8A 3KXFE 4UOW1 5HD8D 3FQWA 4B41A 1T1XB 1SJVA 1J7VR 1IM9B 4LMQI 3QXDA 3SQOL 4U33A 1DUZB 2H32H 1Z0MA 3CH1A 2WYNA 1J0HA 4PJ9B 4Z7OF 4M4RA 2AJYL 4XVSL 5GRUL 2HA1A 2HLAA 4NQSB 4P2QA 3I2CH 1UWXK 4RIRB 2IAMC 1JGUH 2IAMD 1HYSD 5BRZB 2PKDA 4JHAH 2FGWL 2R2HB 2BNQE 1NBZA 1FCCA 1A7NH 1B0RB 3OTTA 1N4XH 4PP2B 1RK0A 3INUH 1IEBA 4U6VH 2DBJA 2AXFB 2YRLA 5E9DD 4XBPA 2W0FA 3WFDH 1P1ZB 1FC1A 2DRUA 3O3UN 4Z7VF 1KCSL 3BGMA 3GSXA 4K7PL 2NXYC 1FYTA 4XGZA 4AM0A 2NXYD 4HBQA 4RWHA 4PJXB 4Z5RA 3LQZA 3T0EA 3LEYH 3IXAB 1FG9C 1RVFL 4JFYB 1FDLL 4ZD3L 3EYFA 1AD9B 5KSVA 4I2XE 3DI2B 1UENA 5FYJE 1V7ML 5TQ2L 3TBWB 2AQ3A 4OZGA 1IT9L 3T1WA 4IIQC 2PETA 5T5FH 3T09A 3P77A 4Z7WA 1OP3K 2EYRB 3ARVA 3TJEH 1A6AB 1AI1L 1U8LB 1ULVA 1MHCA 5I1GL 4ERSL 3D39A 2D9QB 3E6HA 1EJOH 2R39A 3BDYL 1DBAL 1KJMA 2JJVA 3BE1L 4X98A 5DT1H 3QULA 4C54A 3MV9A 2ZSWB 4PR5A 4W4NA 3IFLH 3M45A 3QP3A 1IM9D 2IH3A 4GXUN 1IQWH 3QDGB 3QG7L 2YKLH 1HIMH 2R4SL 4PJ9C 5DFTA 3MRJB 4PJ9D 3AFLA 2I5YL 5FK9A 3QDJA 5F93C 1JZ8A 4PJ7F 4F7PA 1Q38A 3OPZH 1QLRA 3SGKA 4KJPC 1CE1L 2DN7A 2FX7H 3BP4B 1N59B 2KUTA 4KJPD 5BRZD 3D3VE 4PJGB 2QL1A 3KPQB 2BVOA 5TE7L 3IVKB 3H9SB 1JWSB 4JKLA 5DMGC 4KVNH 1KJ2A 5DMGD 5INDA 4JPVL 4HBCH 3M8OL 5CP3A 3KPRA 2EECA 4ISVA 1LE5B 1IEHA 1U8IB 4QHMB 5FKAA 3NCMA 5GRYA 3ELAT 1NCDL 3MRNB 3U4EB 5SWQA 4UV4L 4X6CE 2VLJD 1INDL 2BCKB 4NO5B 3UJJL 3WIHH 5CUSH 4F37K 2UUDH 4HJGA 1WQVT 4FNLL 4Z76A 4YQXL 2BVEA 3PGFH 3IRZA 1MJJB 5FYKD 2H1PH 2R0WH 2XV6B 1YYLL 5DURB 2O93L 1YNTB 5BO1L 5L6YH 1K4DB 5BS0A 3PP4H 5DEZA 4QGTA 4I0KA 3CVHL 1LO4H 1KLUB 1QSEA 2D0GA 5DD5H 5BZDA 2B39A 5A2IH 1H5BA 3BP7B 1N5AB 4YDLB 3KYKL 3TN0A 3LN4B 3CXDL 1I3GH 4UOJA 2CGRL 4H88H 1TVBB 4JY5H 2AK1H 4G42B 5DJ8B 4RWYL 1WZMA 3VXSA 3A6CH 4CN4A 4NQDE 3ZKSD 3G08B 2ADGB 3A6BL 4P4RA 3HKFA 7FABL 1YNLH 2YA1A 3I6LE 2HFGH 1KBGH 3QDGD 5IB4A 3ZYIA 4HZLA 3V5KB 1V5DA 5HYQA 4XXCC 4K9EL 5FO8B 3RQ3A 3BSZL 4GKSA 1HSBA 1TZHA 2VOTA 4OFDA 4TSBH 5GIRA 2EDDA 4YJZL 1JTPA 4XC1H 2DQFB 1ITBB 3O2DA 5C0BA 2NW2B 3ZDZF 2EO1A 4TPRL 4ZUWA 1HSAB 5DRZB 4U0RC 2EDLA 2D5JA 2P24A 1WWBX 4X6EB 1Y6NR 2BVTA 3W5MA 3FB6B 4OCNC 2FBJH 3OJ2C 3H9SD 4PRIB 1KC5H 2X1QA 4Y2DA 2PTUA 3NVQA 1OB1A 3LS5H 3NA9L 5L2KB 3KPOB 5FO7A 1AQKH 2RBLA 1BVZA 5BVPH 2Q7YA 5DMKB 1OAUH 4G8GE 1IARB 5D7SL 3EO9H 4TVPE 5JTWA 3DX9B 1HXYB 3C5JA 3RPIA 1G1CA 2H32B 4X6BA 3K80A 4PRHB 1Q94A 2VLME 3BT2H 1RJCA 4L3EE 2OLDA 1PD6A 3RGVC 1EFXB 3ISWA 3RGVD 3MGTB 2R9HC 5DURD 1OAZL 2VDNH 4LVOC 2VISB 2R9HD 4WV1A 4C56D 4UINL 3RWFB 2ARWA 2R69H 4PD4J 5B39A 3IDXH 4PG9B 4TUOB 1MUJA 4YHOL 4LK4A 2I07A 3CFEB 4YDLC 4JN2A 3GSUB 1QRNB 4R4FH 3MUY1 1YEIL 5T5NG 4AG4H 2CLZB 5IW6B 3QH3B 5GXBB 2A0LC 4XVTH 3TIDA 5HGHB 3QFJA 1U9KA 2A0LD 5C0RH 1MCRA 1NGWA 1KTRL 5J6GA 4HIXL 1NJ9A 3GMMA 4U3CA 4WNQA 1NAMB 1O7SA 4FMKA 2X05A 1YPZA 1I3RA 4FQHA 4ZPTA 4AY0A 1DEEB 3JV0A 1MHHB 2NX5B 3NAAL 5AWNH 5IB3B 5KVGH 1LO2L 4FXKA 1CDYA 1JPFB 4F7MA 5EZJA 4CN1A 4YC2B 1DCLA 3JWOC 3L3IB 4ELMB 1AJ7H 2A73B 3FT2A 3JSSA 4MXWL 4PRID 3R8BB 3VH8B 4NYLB 2FLBT 1IGML 1RUML 3FRUA 1MAMH 1MH5B 3B9EA 1HINH 4MNGE 1S7UB 2VDKL 3BPCB 1DLFH 1N0LA 5C92A 3QHTC 4QRRB 4NFCA 5L2KD 1J87A 3HI1B 3S97C 4FQJL 2CMRL 5GS2H 1ZLSH 2RR3A 5L88H 3G04A 5I8OH 1FSKC 3WNOA 2WK2A 5E9DA 3I6KB 3DO3A 4HFWB 4S11A 4XH2B 2PNDA 4N8VB 4YHLL 4RX4A 4PRHD 4PLOB 1W0VB 2CQTA 3W0WB 1D6EB 2H8PA 3GSNL 2VO5A 1F4AA 4LQ1A 4UZGA 4XAKD 5JDSB 5AYUL 2BXZA 4UT7H 3GBLA 4GXUM 5FKPB 4FS0A 3VGFA 2AEWA 3MRHA 5E6YA 1BFSA 4XBGA 5C86A 4G9DA 1RURL 2K7QA 3C9NA 4WENB 3L3HB 1QRND 3MTRA 5HPMA 4IIQA 4UILH 4K7PY 1YMMB 1LEIA 4A6YH 5I75B 2DM7A 1WFTA 3KPMA 4O58H 3QRYA 4QRTA 5GGSY 4AEHL 1G9EA 1MFBL 3CLEH 4NQXA 1NLDL 5HYIA 2ZCKL 4HS3B 3L3GA 1NGPL 1I4FA 5CBAB 1EMTH 4JKPL 5IOPA 3FT4B 4CGTA 3L95B 1L7IH 2FHCA 4PJ9A 3UTQA 4GOSA 3VFPB 1RIHH 1VERA 1HCFX 4NO2A 1HYRC 3CFBB 4YC2C 2O5ZL 4PJAA 2AQ1A 1EBPA 1T7WA 4HXAL 2BOCA 3X3GL 4P9MH 4I4WB 4OD2A 3IKCB 1T83C 4M3JA 5D5MA 4GBXA 5BRZA 2NY7L 4PJCB 1QYGH 3MO1B 4MMZC 2EXYC 3CD4A 4JZOA 4QRRD 2EXYD 4J7RA 1B0RA 4F3FA 4ZUVB 1YEGH 1C5DB 1EGJA 2P5WB 1A9EB 4KK8C 3EOAB 4KK8D 2NY4B 3LDBB 4H1LH 3DPBA 5ALCL 5IMKA 1V5JA 4X7SH 3VXRD 1A22B 1S9VA 2GSIB 2GUOA 5CP7A 4KWUA 3ANIA 2WBJC 2VLJA 2WBJD 3MYJB 1I3UA 4WW2F 5GGTL 3CH8A 4ZNCD 3DRQA 1S7QB 3IXAA 2X4RB 4POZC 3SEPA 4POZD 1IAKB 3O41B 5F3HB 3WIIH 3L5HA 4Z7QE 3FHAA 1JHTA 4R97B 2DBLH 3TBWA 5KZCB 2BY1A 2XA8L 1JGLH 1R24B 3DECA 1XFPA 4XTRC 4HWUA 1TDQA 5I75C 1YMMD 3I02B 4XTRD 5FGCE 2BERA 2Z8SA 4LSRL 4M7LL 5F7UA 3IAQA 2IBZX 3V52H 1ZAGA 1S7RB 5HHNB 5FB8A 3BEWB 5I76B 3VJ6A 3VCLA 1RU9H 2ITDB 1G9NL 3F7QA 4RCAA 2ICWA 5HYJE 2IEPA 2VXUL 1CDUA 1Z5LB 3UTTB 5SV4A 3ROOA 4RFEB 1GPOH 2OSLA 4PUBL 3N1GC 4ZUTB 4XCFL 3BHBA 3QEHB 1ZA3A 3D85A 5CZKA 1CI5A 4D9LL 2CRYA 1KN2H 4NZDA 4YUEL 2WWMC 3MUGB 5IJVB 2WWMD 4HIJA 3CDCA 2R1YB 2ITCB 4C4KT 3FB7B 5IHLB 3AROA 1N59A 4OT1H 4S0SD 3IVKA 5DHVA 3GRWL 5E2WL 1UH3A 2YZ8A 2NY4C 3D25B 3LDBC 1RPQA 1KG0A 2NY4D 4N0UB 3RA7L 1ORQA 1U8IA 2J6EL 3SE3C 1MRFL 2WINA 4WDIA 1BLNA 5JIPA 3QUML 4HF5H 2EZ0C 3ANKA 1AKJD 2EZ0D 4EN3B 4HUKB 3LKRA 8CGTA 4QWWC 4J8RB 1XGTB 4QWWD 1C12B 1WISA 4LP4A 5F88B 4PB0L 1QSFA 1Y18A 2NW3B 3CPLA 4V2BA 1A3RL 1UM5H 3FTGB 4R97C 3RGVA 5HY9B 4LGPB 5MHSD 2Z35B 5LGKA 5KZCD 3QO1B 1N8ZB 4N90E 1BZ7B 5LBSL 3T2OA 4C56A 3VMPA 5JOPD 2Q8AH 1RD6A 1WEJL 4OZ4B 3PV6B 3HR6A 4GMSL 3BP7A 1RZGB 3JWDH 1QBBA 1FL3A 4Y16B 5I74B 4G42A 3CSYB 2XZZA 2E9WA 3B8YA 2ADGA 3CFJB 3G08A 3RP1A 2ZUWA 3L3JB 2VLRB 2R2BA 1PX3A 2DQFA 1IGFL 3S7GA 1MI5D 2EE2A 2NW2A 5DRZA 5C0EB 4MDIA 5CGMA 2FGZA 1VESA 2X6MA 3K8MA 4YHZL 5IJKA 4JFXB 1K8IA 4ZNEA 1CYGA 1ACYL 2ED8A 5I73B 4L4TB 5F6HJ 3FB8A 1QHPA 2IQAA 2IMNA 5B4MC 5SWSB 4A6YB 5LGJA 4P2QE 5B4MD 4DWHA 4ONGH 5H8DA 1YNKL 5DK0B 2A6KA 2J1KA 2ZUYA 1AFVL 2NLJA 4G6JH 4N0FB 1JNNL 5FUCE 3FOMB 3SJVB 3NH7H 4XNQB 1HXYA 4JQVC 2LU4A 5IESH 4K3DH 4PRHA 3MREB 5IFHL 5EBWB 1YEKH 1GGIH 2C3VB 4KY1H 4ZTOL 4ZUUB 4I1NB 1M7DB 4RISL 3TESA 2YPLB 3IJSB 4YWGL 3MRKA 2Z4QA 1FYTE 2EC9U 1KB5B 4DZBB 2XPGB 4X9FA 5CJOL 5H94A 1JZ3A 3T0EE 3T0XA 3CFEA 3GMQA 4FG6C 4GLRH 5E7FA 5CHNA 4MXVF 4FG6D 1AGFB 1JV5A 1H0DB 3LKNA 4Y16C 3FRPA 3QYCA 5I74C 1BQHB 4O9HH 1N26A 4GW4B 4JLRA 4R0LA 5GS2D 1OAXH 4H1LB 2VRAA 4Z7WE 1J1OL 3C08L 2VLRD 3T3PE 4ZXBB 5KOMC 4QXTB 3RL2A 3HN3A 4RZCB 1DEEA 5KSBB 3QG6A 1VGKB 1JCKA 3W39A 1I8KA 5IB3A 2JCCE 2PYEB 3MLRH 4PJDE 5DYOA 5IBUB 1BF2A 2P8PB 1Q8MA 4LCCB 4MA7H 4Y0GA 3HUJA 5IG7A 1PLGH 4ETYA 5IIEA 1VGEL 3ZKNC 3ZKND 4DN3L 4FP8H 2JJWA 4YGVA 2A73A 1CD1B 43CAA 5I73C 2I27N 5ETUA 5HHVL 2EDKA 4L8BA 5HSFA 1SM3H 3HLAA 2XACC 2FYYB 3WE6A 4ZYKB 1KJ2L 3UTPD 4NZTH 2APXA 2FB4H 4GAFB 1IFHH 3HI1A 1YEFL 3O11B 4MNHB 2ICWI 5GGRB 2ADJA 4O00A 3I50H 1DLHB 4XB7A 2AV7A 5GRJH 4YAQB 3VXRA 1ZT1B 4XH2A 4N8VA 1S9WB 4LPTA 4PTTA 3JTTA 3P4NA 4GXVH 3KPRE 5D2NB 3FT3A 4Y5YC 3RWGB 1UVQB 4OZHB 2E8YA 4X80L 2WBJA 5FHBL 5FA3A 5DVOA 2EE3A 3MA9L 5F1IA 3V0VB 3ECBB 3CMOH 4KGLA 1RUPH 4OLYL 5K9KB 1QFWM 5E95B 4X6DA 1N7ML 3Q0HA 4GQ9L 4OSUH 3R0MA 2EXWC 2EXWD 3ZTJG 2A6IA 3GMLB 1YMMA 3O6MH 3T65B 3BPNB 4LVEA 4YFLI 2V5RA 1QKZL 2JE8A 3DYMA 2VDOH 1NC2B 3N9GH 5BS0E 4PYGA 2DRQA 1U0QA 2DQTH 4JVWA 4YFDB 1Q0XH 4K07A 5T3XH 4ZXBC 1QSEE 3DBXA 3DNKA 4FABL 1A0QL 1MJUH 3O6LL 5B8CC 2H41A 4QCIB 1PSKL 2VZ3A 3VI4E 3BW9A 1IGCL 2CKNA 3WIHA 4OLEA 4M7KL 2PYED 4ZFFA 4LCCC 3O2DL 3VXSE 4HX1A 2XN9B 1JPSL 1NUGA 2WQRA 3CLFL 1P5VA 4ZFZB 1BHGA 4HSQA 5ERWB 4YE4H 4WUKH 43C9B 5F44A 5JZ7C 3HR5A 1WBYA 4KRLB 3E0GA 5JZ7D 3NFSH 4PJCA 4W4OC 1FVDB 3LRSB 4KH2A 4QRPB 1XGUA 1O0VA 1YN6A 5F1OB 1AR1C 3VXUE 1N6UA 3UAJC 1AR1D 3SKNA 1MY7A 3UAJD 3MUZ1 1HZHL 3RVVD 2H9GA 1EDQA 3AC0A 5FOBA 3EFDL 3UZVB 2JF1A 5J6HA 3VFWA 5D2NC 1NLBL 1I7RB 1WITA 1EERB 3LPGA 1AKJA 1TZIB 1A4JB 3V7AE 2EIBA 3PE9A 1S7QA 1AXSA 2FJHA 5GRVK 1S3KH 3UJTH 1FZMB 4PRNA 2FJFB 2CKBB 3BIKB 4XNZB 2B1HL 4OF7A 4XNYL 2XZQL 4WI2A 4D0DB 5ISZB 4FTVB 4Y5XB 1HQ4B 3MCLH 4NKOA 2D31B 1YUHA 1BF8A 4JKWA 1U8OA 1WAAF 2PCPB 1C5CL 1UH4A 3BPNC 3SDCA 1HHJA 4AH2B 3PJSB 4FHBD 1U8MA 4J1UA 3QXQA 1IM3A 4PJ7B 3H2WA 2GYSA 1MREH 2NTFB 3TYFB 5JXAL 4KROB 3G5ZB 3TBTB 4C57C 2ID5A 4UUJB 1G7QA 1A6VH 3U48A 2H45A 3MXVH 4L3CA 3GM8A 1F45A 2H26A 2Z91A 3QEHA 2XN9D 1MI5A 1P53A 1P84K 4X4YA 5FO9B 1JF1A 3EIFA 3NCYS 1BPVA 2DOCA 12E8L 3RX7A 3QUKB 1YPZE 4NNYA 3AREB 3HRZA 5F89A 4DAGL 1DE4A 1RULL 2ZNXA 1I1RA 4QRPD 1SJHA 5D1XB 5HVFB 3JWDC 5F21B 4NRXB 5HDBE 3FOLB 4Y89A 3PIQA 3FQNA 4GAGL 5C6TL 4X7DC 2YA2A 1CXFA 3K2UL 4XMLH 5EUOA 4YPGB 5IMLB 4BJLA 4CUCA 5MEPA 2R2CA 4O51B 3ULVF 1WWCA 4YDIH 5IFJA 4J8RA 4PJBE 4NUGH 4JQVA 1KTDA 1Y0LA 4X5WA 3WYRA 5E2VH 5F88A 4XNZC 5K59E 2FEEI 5E9DE 5J06A 4Y5XC 2CD0A 4FTVD 1T66D 2WWKT 3QO1A 1N8ZA 5I8CB 3IDIA 2X1XR 1G9GA 3OKLB 2FZ3A 4LDEB 1QO3A 4I48A 2E7LA 1INEL 2BNUA 5DDHB 3ULUL 3OXRB 3ZKQD 2PW1B 5FCUL 1HHIB 4KROC 2VXVL 3BKJL 2NXZD 3S36H 4KROD 1DOGA 1GHFL 1EZVX 4CDGC 3ALXA 3DUUA 3MUHL 3ULUE 2PO6A 5HHME 2VLRA 4GRMB 4PV9A 2YSSB 3HZMA 5HVGB 1DQMH 5DVNA 2QKIB 4HIEA 5GS3A 2CDEB 1D9KA 1YEHH 1O7VA 3EDDA 2H3NA 1J0IA 4PGBB 1JZ7A 2HKFL 4JPIB 3LB6C 3NABH 3LB6D 3AREC 3ARED 4JQIL 3LVEA 3RAJH 4HS6A 5D1XC 2PTTA 2HFTA 1B6UA 5FYJU 5D1XD 5EOQL 3FCTA 1J0JA 2A74A 4L3AA 5C08B 1G9ML 3MR9A 4A6YA 3O45B 1EGJL 5AZ2L 4QOKB 3V0AC 2Z92B 4ONHB 3ES6B 5TQ0H 5D5ME 4PBVC 5D7LA 3SKJL 3UYOD 1PZ5B 1RY7B 4HH8A 4DGYH 1FGVL 4GO6B 3HAEG 5E1HB 5L2JA 4NT6B 5DJXB 3OXSB 4XPAH 4LNRA 3WXWH 4Y5YA 5EBWA 1OGAA 1KCUH 2ZKHL 3RZWA 1I7UA 1UZ6E 5HGBB 2CR6A 1R3LA 1UCBH 2W0PA 3BP5B 3O2WH 5FYKL 3U1SH 3SDYH 3VGBA 4YZFF 3AB0B 2XQYK 5T1DH 4LLUB 3C5ZA 4DZBA 3VXDA 5CMAA 4HJJH 3LH2H 1AY1L 5EU6B 4BZ1H 2XG5A 3HC4L 5FECA 5ITBH 1E6JH 1GL4B 2X4PA 2GJ6B 4JFZL 2BVYA 2DLIA 4LKXB 1WC7B 1JYNA 1FFPB 1KN4L 1G6RL 2L0DA 3LPFA 2VSCA 3TBSA 2E9BA 2VAJA 3KPSE 1OWWA 3B9DA 4ZUSB 3PDDA 1BM3H 5KSBA 5B8CA 3BZ4A 2NY5L 3FONA 3DYOA 3OKOB 3MODL 1H15A 4ODUB 2P8PA 3UBXA 3S4SG 3G5YB 1JFQL 3N50A 5C0FA 3SE9H 2AJXL 5CSBA 4K3JH 5DHXB 5CEXA 3DURB 3NCCB 3EYVB 3RY6A 5E5MB 1HNGA 4DK3A 1JYWA 5C08D 1ZLVH 1IA6A 5L9DL 5FHAL 1OPGH 2YD7A 1OF2B 1X5IA 3MLVH 4W4OA 4TUKH 1UKQA 2OXHA 1RIVH 1J5OL 1E28B 1ZXQA 4LBEB 4LSUL 4QYOA 2AJ3B 5GGRA 4EIZC 5FAAA 2FJGB 2P7TB 5T3XD 3MZTA 25C8H 4QF1B 5CEYA 4YBQC 3WHE1 3GIZH 1WWWX 1NCWH 5CIPH 1J0KA 4E42A 1NCAL 1UVQA 3LHPH 4CAGA 4X99B 1KELL 3HMXH 3S34H 1F4WL 3FL7A 3L9RB 5LAXB 3AB0C 3X3FH 4Y4FA 5CJ8A 3F6IA 5EC2A 4LARH 5I2IB 3FQUB 3QJHB 2DQJL 4C59B 3EOBA 5J12C 5EU6D 2ZJSH 1QSFE 3T2QA 2GJ6D 3NCBB 4Q7DA 2VERN 4X0KB 4MB4A 5EU3A 2FIRT 2EICA 3VFUB 4C56E 1V7NL 3MA7A 4MLIA 5C0IA 5E5RB 3HC0B 4K3EH 3TH3T 5LQBH 5GS1A 4JG1L 4N9GA 1JRHH 2VZOA 3SGDH 5I1JL 3HNTL 4KHXH 4D9QD 1ZHNA 1P9MC 4LSPH 5GS0H 2VDMH 5KN5A 1QBLH 5F6IB 3MXWH 2XN9A 3D69A 3GB7A 5E1AB 2YOCA 4K71B 2ZSVA 5TDPB 3B5TA 4MNQA 1R3HA 2NY0C 5MEHA 3CFKA 1CLOH 2O5YL 1EJ6A 1NFDA 2NY0D 4Z7VA 4HUVA 4WGWB 1T0NA 4L8SB 3JWOL 1FAEA 2C4FU 1F58H 3TIEB 2XKUA 4M7LT 4WW2B 3LRSA 4QRPA 5DJDB 4E0RB 1E4XL 3TF7C 2X7LB 5F3BA 3T8XB 2CRMA 1ZVSA 3RENA 1C7SA 4H25A 2OYPA 4QRSA 4FUSA 2B2XH 3G5VA 4HQQH 3HI5H 3HG1A 1AGEB 2ATPA 2OR9H 2BOBA 5FGBC 3LKOB 4UIMA 1ZHKA 4G7YH 3DYPA 1I9IL 3VWJB 2VR9A 4JQXC 4RBPH 1P84J 2VAAB 2DMKA 4AL8L 5LVEA 2FJFA 3SKMA 2OI9C 2N1KA 5HGAB 4FTVA 3TYGH 3BH8A 2RIKA 5J89A 1Q72H 2IPKB 3NZHH 5IF0B 3H3PH 3MGOB 3PWLA 5C07B 1FN4A 2VWEC 5L8LB 4AYPA 2OQJA 4KAQL 4HFUH 1F8TH 4AH2A 2A1WH 5BXFA 2JELH 5C6PB 3WIWA 2UZYB 3CUPA 1L6ZA 1XR9A 3TYFA 4DKFL 3BH9A 5ENWB 3TBTA 4M6OH 5DFWH