2VN4A

Glycoside hydrolase family 15 glucoamylase from hypocrea jecorina
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
599
structure length
599
Chain Sequence
SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDRFTETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGPALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVANQHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSVLTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSIYGVNKGIPAGAAVAIGRYAEDVYYNGNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVSTYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSALHLTWSYASFLTATARRAGIVPPSWANSSASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQFGQTVKVAGNAAALGNWSTSAAVALDAVNYADNHPLWIGTVNLEAGDVVEYKYINVGQDGSVTWESDPNHTYTVPAVACVTQVVKEDTWQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUCOAMYLASE
publication title Three-Dimensional Structure of an Intact Glycoside Hydrolase Family 15 Glucoamylase from Hypocrea Jecorina.
pubmed doi rcsb
molecule tags Hydrolase
total genus 212
structure length 599
sequence length 599
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2008-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2vn4A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vn4A02
1MIMH 5T1KA 3H3KA 1AJ7L 1GH7A 3E1F1 2JK5A 1E6JL 3KPTA 4HZLA 4P49A 4HJ0C 4MJIB 5F89A 4CL7A 2N4IA 3J8F7 2YWYA 4X6DE 5FGCE 4NKMA 1ZWIA 2Z35B 4QHMA 4JRYB 3D85A 4WVAA 4U2ZA 1LO0L 5TH2A 3JV0A 3RIFK 5MEQA 4BSWB 3PWNB 4Y8AA 2AHFA 1L0QA 1QSFE 4APQA 1CD9B 4O4YL 3AFLA 2DMKA 2OMNA 1YA5A 3KYAA 3RL2A 1A64A 2W0KA 3MPCA 3HNTL 4Y2DD 2ARJB 2APVA 4JZJA 2Z31C 4G9FA 1EZVX 3CK0H 1KRFA 4FFVC 2I27N 2V17H 5EU4A 5HGDA 2YD5A 1JRHI 5D4QA 3RWJB 2WIIB 3B8YA 4N8VG 3PWPB 1MFNA 2A6KA 2LQRA 3L6FB 3VFPB 5BS0D 2X4SA 2ED7A 5FYKL 3SO3B 1L0XA 4P4RB 4PV9A 5E8NB 4L29A 3CC5B 3S4DA 5K9KA 1JTTA 3AB0B 4JPVL 2PUQT 4RAVB 2XV6B 5F1KC 5E1HB 1I7ZA 4JRXA 4YH6A 5IHZB 1YPZB 2CIKA 5EOTA 4LVEA 1HKLL 4JGMA 1KXVC 3C60B 1YEHL 4X9IA 4ODHL 5GGUA 1LP9E 3MJ6A 2DKUA 3F12A 4FQCL 3JZ7A 3SGKA 5CEYB 3VFMA 3HE7A 5HJ3A 5KVDL 4CKVX 3VH8A 2XIDA 3LY6A 1FC1A 3SDYH 1CXLA 1AIFB 1QLRA 3VFSA 3LIZH 3GSVB 4OCWL 4Z7UE 4DKFH 3BH8B 1OP5K 1JZ8A 2EABA 5C09B 4A2MA 3PWUB 4UNTA 4HX1B 5B22A 3O9WB 4EI5A 3ZE1E 2P44B 5DRWB 3PL6D 3FMGH 3W39B 2GH4A 3NCJH 3QISA 4I77L 4OKDA 1IL1A 1XR8B 4XGZA 1OB1A 1MFEH 3EFDH 1WISA 3MLUL 4RGND 4RIRB 3WEXA 2NXYC 3ZTJH 3VWKC 1MCCA 4JPWH 3QSKB 2VQ1B 3QA3A 3QDJE 3QNZA 1OCWL 4HUUA 1MRDL 3K2UH 3SDAC 3SBWA 1KXTB 1G7QA 1FYHB 4PGDA 1MEXH 2X1PA 4MMXC 1D9KD 2GIYA 3JVGC 3KVQA 4JLRB 1HINL 4P2YA 3QULB 1NC4B 1G9NL 5C0IA 4XZUA 5IW1A 5KSVA 4L6XA 2NY2B 3U2SB 1QNZH 2GTZA 1XW2A 2AXGB 4PGEA 4OZ4B 3AM8A 3Q48A 3FT4B 3V6OA 4U33A 4OB5H 3DV6A 3HI6H 4Y4KD 3RY5A 1ZHNA 2ZOLB 1CK0H 3KJ4B 3QUYA 4XX1E 3NN8A 3VXMB 3BSZH 3RKDD 3U4EB 3K1KC 1UWEL 4PREA 3H9SE 3BESR 1PY9A 3G6DL 1Y0LB 3BH9A 1A5FH 1JGEB 2YC1A 3HCVA 2WV3A 4UOW1 3RZCB 3OG4B 3K46A 4HJJH 1I1CA 3DROB 1KJ2L 3U1SL 5CJQH 3SJVA 3CX2A 5I1CL 1MHPH 1A7NL 3VFGL 1NDMA 1XIWA 4PRID 2R8SH 1OAXH 3WLBB 1G6RA 5F96L 4OGAD 3DETD 2F6DA 3HE6A 1P5UA 4HJGB 1A8JH 5F6IB 1K4DA 3IS1X 5SV3A 4CE7A 2VYRE 3ZHLA 4F33A 3MLTA 1WU6A 3BQUB 4RCAA 5JQHC 3UYRH 2AK1L 3MUZ1 1GGUA 3D0LB 1KS8A 3CFBB 1JZ4A 4OCSL 3WIWA 4P23B 5B39B 2R1XA 5C0ND 3OKKB 3TA3A 3FB5B 5IOPA 3BOVA 3AXLB 1QO3A 3DARA 4FTVD 1P9MA 3FB8A 1FFPB 5AWNL 3MOBH 2FX7L 5EOCH 3OZ9H 4EOWH 5GGTA 1YEJL 3JSSA 3MJGX 2Z93B 4BH7A 2I07A 1NANH 1T5WA 1VGEH 4QRRE 2DAVA 2V2WB 3V4UH 3O8XA 4WCYL 1XWTA 4LLQB 4HMDA 5CIPH 3FQWB 4CDHA 1JZ2A 5C0BE 1GPOH 1MCWM 4LIQE 3B2VH 3QH3A 3VD5A 3ETBF 2GJ6A 4XNQA 1EX0A 2QEJA 1TCMA 5DO2C 5ACMA 1EJOH 4LIQL 1TJIL 1H3PH 5KW9L 5JW4M 2AJYH 2Q20A 3VFOA 1I3RA 4XNUL 4Z5RA 3O3DB 3RA7H 4RQQB 3IFLH 1IEAA 5BVJB 1H14A 3RBGA 3UYOD 4LCCC 3UTSB 4NRXA 4L3ED 1AI1H 5L7XL 3GKWH 1K5NA 2DOCA 3PP3H 1SYVB 2F8OA 4AM0A 3RDTC 3TIEA 3HI5H 4XP5L 1X5ZA 3E2HB 2O5YH 2LVCA 4Z7NF 3BP6A 4C56D 4R97C 1C5CH 2X9XA 4Y5YB 4FZ8L 1Z0MA 4WRLA 4UB0H 1TZHA 2CLZA 2JCCE 1NLDL 4RGNC 1NQBA 1CE1L 1RIVL 3OJDA 1R5WA 4KTEL 1KCRL 5CZXC 2CXGA 4XBEH 3TBWA 3DMMC 5IMLA 4QHLB 5GGQH 3MQIA 4ZG1A 5JZ7D 1MCNA 5I2IB 1A2YB 4OZGE 1J0IA 3VXRB 1PSKL 4WJ5A 1CLZL 1FAIH 3RNQB 2BJMH 5FK9A 1UYWL 3CVIL 5T1LD 1RZFH 2VUOA 1DQJA 4P2RE 2XG4A 4YDVA 4BSJA 4B7LA 5JOPE 2OR9H 3E6HB 3LKNA 3BPLC 3LZFH 4G7VH 4F7CA 5C3LD 1NBYA 4KDTC 4AEEA 2QQKL 1FCGA 3HA0A 3RKDC 3DHJA 1RUKH 5H8DA 3U0WL 4WUUB 3VWJD 1DJSA 1FNAA 3D48R 2DBLL 2GAZB 1IA6A 3SO5A 4NQEB 4RMQA 5D7JD 4G6FB 1QPXA 1ORQA 4NPYB 5SWZB 3KJ6L 5KJRL 1W2KT 1AYXA 4MNGE 2EXYD 1MCOL 5JXAL 4OGAC 3DETC 3IDGB 2C3VB 4G7YH 2OMBA 1NGPL 2CH8A 4YAQB 4XBPB 2GT9B 4HCRA 3MMEA 4MA3A 1YY8B 1NMBL 4BK4A 1HQ4A 1VPOL 1IC4L 4FN0A 5JW4Q 1IEHA 4JQIL 5KS9A 3K4AA 4KZDH 1UCBH 5TDNB 1KB5B 1JFQH 1JI1A 4PUBH 4E0RA 2IANB 2Z4QA 2RBLA 1Z9SA 4DUXA 1XGYL 4NT6B 3RX5A 1LD9A 4QHUB 4FABL 1AXTH 4ODSH 7CGTA 3T3ME 5BV7L 4BUHA 3U83A 3WNOA 1X5GA 4GMTL 3ARFB 3BRFA 1YYML 2NLJA 4F7EB 2EAEA 32C2B 3SDCB 1TNNA 5ID1A 3PGDA 2IBZX 4R8WL 5D93C 5E99H 5HHOA 3T77A 2CK0H 5KS9F 4KAQH 4WGWB 4PR5B 1PDKA 4JDZB 5HGBA 1KBGH 5ICXA 4AENB 3BVNB 3S9DB 2E9IA 3HRPA 2F74A 5F7WC 2HH0H 2OS7A 1IBGL 1U8QA 4OCXL 4PJHE 3UDWA 4N0CC 4TNVF 5DRWA 2VLKD 2VH5L 3MCLH 2GITB 5H37H 3T0XA 4NNYA 1U3JA 2XPGB 5DD1L 4KPHH 3NAAH 2VNCA 1HHHB 5TDOA 4OF0A 4FOMA 1MHEA 1FVEA 2R2HB 1IVLA 5HI5D 4MA7L 3V2AR 1I7UA 1SBSL 4C59B 4TVPD 3ZSTA 1M6OA 1TTFA 12E8H 1P69B 2DQTL 3D2UA 1BBJB 4FG6C 4L9DA 2B4CC 3MLWL 1UEMA 4IRJC 1G6RH 2Y07H 3UXFA 5ALCL 5HTSA 5LWYH 4HWZB 4K3HA 1QLEL 3WIHL 2B4FA 1CFNA 1U8HB 3V5HA 4HPYH 3U2SA 1ZMYA 3BD5A 2C1PA 3QXAB 1WGOA 4ZTPL 3FN0H 3KDMB 4HIHB 1M05B 3L3JB 5I76B 2AQ1A 2AEPL 4N8PA 5C6TL 4OZ4A 2PYEB 2DLGA 4Q9RH 1YDPA 4G8IA 1NC2A 1ES0B 1H13A 1GJIA 3OXRB 4ONFH 3VXMA 3MFFA 1L7TL 2Z8RA 4LHUG 3WHE1 3UX9B 1ORSA 2QKIA 1YNLH 5IWLA 4LCUA 1BX2A 2F8XC 4HAGA 5FXCH 3MO1A 1S7SB 3QDAA 3WS6C 3REVB 1PW3A 3BRDA 3RNKA 2OQJB 4MAUL 5JMOC 1FHGA 4GXVH 2UZIL 2FYYB 3WLBA 3MRKA 4CUCA 4M1GH 5DK2A 4HKBA 5KKBA 4OZIB 3J7HA 4PJIB 5DJ2B 4GLRI 2V9QA 5D2NC 4MSWB 2BVUA 1GZPB 2QSVA 5I6XB 1MFCL 2KUTA 2BSTA 2DLEA 3IXTB 4GW5A 3OJMB 1F11A 2Z9TA 4P59L 3S37L 3BQUA 3QEGH 4JJ5B 4YHKH 5EU6A 4L4VA 5JW3L 3UBXG 4FP8L 2DQJL 4I0PD 2EXYC 2WLYA 2VXSH 1B0RA 2WUBL 1HWGB 2A38A 2EYRA 5GS0L 1I1RA 5GISL 2ZG1A 3FB5A 3OAZK 4X4XA 3ZYJA 3TFKD 3QFYA 1KFAH 1D9KB 3V52L 2DQHL 1MAML 1G0XA 3KYKL 1S7WB 3CFDA 2Z93A 3AC0A 1HHJB 3EYQD 4KK6D 1R5VB 2YPLB 3T65B 2BY0A 2GZ6A 5I19L 1ZLUH 3DURB 3QEUB 2WBJB 3WFEH 4YDKH 1BM3L 3BJLA 4O51B 3DVIA 4ZQKA 2E7LA 4HUMB 1S78D 2ARJQ 1QLFA 3GSWB 5I30L 1P4IL 2Z8VC 3HKFA 3U30B 3WIFA 4KGLA 1QFWH 1U3ZA 1HDMB 1FE8L 1F3JB 1CDIA 1IS9A 5JORB 4JG0H 1XCQA 5H35A 2NX5D 4LHUB 4KKBD 4MJ6A 4NWTH 4OSUH 4M7JH 3QUXB 2DI9A 2FWOA 1JUFA 5SX5K 1ZLWK 1PG7L 4LNRA 5EBMA 3PIQB 2QQNL 1SYVA 3BE1H 3RJQB 1MAKA 2W60A 1A6ZA 2W9LA 1G7MA 3V7MA 1JF6A 2X5PA 2Z31A 1FBIH 2GK2A 3DX7A 5DHVA 5HI3D 4M6AA 3STBA 2VITA 4XNMB 2X10A 3D39E 3P2CA 4R90L 2WW8A 1SYSA 1OARL 5KG9B 5GGRB 1DBMH 4KC3B 1RULH 1ETZB 4H88H 2Q7NA 4X4YB 1ACZA 2OI9B 5ID0A 5I66B 3SDXA 1FZJA 2X1QA 2R2EA 4D94A 3AMLA 3HMXL 4W6WB 3VXRA 3OJVC 1A6WL 3B4NA 5K93A 3EBAA 5ISZE 3VW3L 2P46B 4Y5VA 3P4NB 5I9QC 1N0XH 4HCRH 4OFYA 4U6YA 5GS2D 3WL9B 3BIKA 5F9DC 4K23L 3H7BB 2ED9A 3SKNB 1JGLH 3SKMA 1AGFB 1CGXA 3SDXF 1KKTA 1VFUA 2X89D 3EYVA 4KRPB 4WUUA 1PLGH 2EH7H 4H20H 1FFNA 1I9RH 2A6IA 4OLXH 5J1TC 1Y6MR 4NQEA 2RGSA 2APTA 1AFVH 2XWJA 5DEFA 1MCEA 4I3GA 3QXFA 2H6PA 3V5DB 4K8RL 4NZUL 5DMIH 1S3KL 2KPNA 5C0FB 4OV5B 1WAAE 4G8GA 4CVZB 1ZGLB 5ANMB 4ZOBA 1AO7B 3SDAA 3NCYP 2CLRA 3RAJL 4JEGB 1OM3H 1G9GA 5FB8B 2XWBB 3SN6N 1KLUA 3X17A 4NZDA 2PW1B 3JVGA 3FQXA 5DFVD 1JWMB 4XB7A 3X3FL 2EDNA 3QZWG 1JYXA 1QFHA 5DUPH 4Y4HB 5DA0B 3ARWA 4LP5A 1KC5L 5LCVH 2VC2H 2X6MA 4S0SD 1X5FA 5EBLB 1CFVH 1NAMB 1QYGL 3OL2A 3WO4C 5IVXE 2B5IB 5TDNA 3BEVA 1Z5LB 2BSSA 1BFVH 2H2PD 4ONGH 5IEKB 3VMNA 1I3UA 2H45A 1ZKAA 4QNPE 2PW2B 1VFBB 1Q0XL 5TGBB 1D3CA 2WMPA 1R3JA 2JIXA 4WEMB 3QEQA 5LQBH 1A7RH 3EDKA 4ERSH 3EYQC 2HT2D 5LKNA 4RMTA 2CUMA 3HFMH 4ZFOA 3P9WB 4ZXBB 5L2JB 3O4OB 2DRSA 2B2XH 3MV8E 2XZCL 2KL6A 3MXWL 5BXFB 2HTLD 3JWDL 1P2CB 4PS4L 3G6JE 3CDYA 5GRVL 4O2CB 3QXQA 5CBAB 2IADB 2W0FB 1Q1JH 4YK4C 1G9MH 4M5YL 3BT2H 4R2GD 5DEGB 3VWJB 5AG9A 4KKBC 5EOCJ 3Q2CA 3CXDL 2AV1B 3RWFA 4XTRD 3WJJC 1QFUL 1LDPL 5D7JB 2EE6A 2CQVA 2VE6B 5DUBA 4MWFB 1W72A 2YPVH 3F5WB 1V7XA 1QRND 4W4NA 2RJMA 5JUEH 5SV4A 5D7LB 1OAUL 1REIA 4WDIA 3FO2B 4Y2DA 4NQDE 4C54A 5IHBA 2QHRL 5HI3C 3MRIB 4D0DB 2P8PA 1MCHA 1EBAA 2WINB 3FN3A 4LCWD 3TGXA 4XI5C 4OM0L 5FYLL 1U8HA 1D6EB 3CGTA 1XGPB 3L5JA 4YWGL 5BS0A 3KDMA 1ZT1B 1TIUA 3L3JA 1V5JA 2FV1A 4I2XA 2ZUQB 4JY4B 4D9QE 4OCRL 1FG9C 2DRUA 4WHYG 3KPQB 4LVOC 2NY5C 4P5TC 4Y1AE 4HD9A 2K7PA 3SE8L 1KN2L 4I9WD 2RB8A 1ZGLP 4YX2L 4X4ME 1NCAH 1MJ7L 4R0LB 2WANA 3WSQH 4RFEB 5DK0A 2J8HA 1HCUA 2VO5A 1NMAH 1PAMA 3C09B 3VXDA 4LCCA 1NCNA 3UROR 1OWRM 4PJ5E 4LVNC 1ZHLB 3LD8C 1ACYL 1NBVL 4UV7H 1A6VL 1KJ3L 1P1ZA 1JWUA 1YEFL 3PWJA 4KV5F 2YD1A 5EO9B 5GZND 5HHMD 4OZIA 2V7NA 4IRZH 4PJIA 2VLKB 5J13B 3PL6A 4PG2C 3ZZ1A 1PQZB 3EUUA 1MSPA 4R26L 5MERA 5FYJH 4HDIA 1WBXA 5GGVY 3TBVA 4CVWA 4G80B 4NUGL 4U6XB 3NFSH 2VB5A 2VABB 1KV3A 3T04D 4OTXL 3RP1A 3C5JA 4XT1C 1QSFB 3RY4A 2R69L 3C5SB 1A7QL 4FQHA 1XGQA 4FNLL 4OZIF 4PJIF 1XGRB 1D9KA 4BSVB 4TQEH 2I60H 5DFVC 3I02B 4ZPTA 4OGYH 1I4FB 2GK0B 3MZGB 3O2WH 3C5ZB 5DHVH 2C7UA 5A2IH 4OIAA 3AU1B 2OR8A 5C2BL 3RIFF 4F7PA 1F4XH 5IB5A 2WQ8A 1BEYL 1H15B 1UZ6E 3VI4F 4GT7A 4JO4H 4PIRF 1ITCA 1IEBA 5DFTA 2H2PC 5TDPB 4Y4KA 3VG0L 4I18C 1F4YH 2VRAA 1F58H 3SGEI 4Z7VE 1C1EL 4C83B 5C7XH 1WT5A 1JGVH 3IDIA 4NWUH 3CFJA 3EJYD 4M00A 1IGFH 4TULL 4PJXA 4UNUA 5EU5A 4RBPH 5KN5B 1KTLB 3IDUA 2X7LA 2NY6B 3NTCH 3U6RA 5ICYB 2EDYA 3UYPA 1LP9B 1S9XA 1A14H 3UC0H 1UT9A 3L3KA 4X7TB 4JO3L 4PRIA 5E1AA 2GSIB 1YEDB 1FL6B 2DKSA 3TBTA 4Z7UB 3ROLA 5T1MA 3V5KA 4Z77A 3C60C 2E27L 2WIMA 4FQIH 3S96A 4PJXF 4PJFA 4XTRC 3F58H 3OKDA 3TNNB 2FR4A 5KANI 2V5TA 4YHLH 1PD6A 5GHWL 1OAKH 2RQ8A 3FO1A 4NQUA 1M7IB 2AXFB 4I0PB 4NRZA 3O9WC 3WFHA 3MXVL 3EGSA 1KYOK 4OLVH 4X6EA 1F5WA 3TF7C 2VDPL 3O0RH 3QDJB 4FTVA 4WU5B 4MCYA 3NIDF 1XF5B 2UV3A 1F6LL 4KQ3L 4MS8D 5F9OL 3EYFB 2DYPB 2R29H 4KQ4L 4HIJA 4KK9D 5EZOH 4KKCC 2NNAA 4M4RA 3ARZA 3P4NA 4LCYB 2R4RH 4PJFF 2CR3A 3NCYS 4PP2A 5F7EL 3WL9A 3WUWA 1SMAA 3IDYC 5EO0A 2F58L 1JPTL 1A6AB 1FZOA 3PE9A 3HZYB 1XGUA 1DZBA 4LSPL 4NQSB 1V7MH 1AGFA 3VFUB 3W9DA 1U8PB 3BYYA 4HIEB 1KGCE 2Y06L 3W7UA 4MD0B 2H8PB 2YKLH 2YN5A 1XCTB 3O6MH 3BISA 3MRHB 1HZHL 4UUJA 4PJBE 1T6WA 5T3XD 2ZG3A 4P9HC 1RUPL 4JZNB 1KJ2B 1HH9A 5K9QI 1H8OA 2OZ4L 3OKLA 2QLVB 1I3VA 4L3EA 4L5FL 2D2OA 1OQXA 1AGEB 3GHBL 4I1NB 2UYLA 4GAJL 1YY9C 1NCCH 4WGVB 3I9GL 1R3KA 3KWWB 3U46B 4YO0A 3M45A 2UUDK 2Q8BL 4U1JB 3TCLB 2WUCL 4C56A 1VADB 4QYOB 3FOMA 1JHLL 1EAJA 1FLTX 1ULVA 1KUMA 1A1NA 1RMFL 4TSCL 1NCTA 4EDWL 3HTLX 3MBED 1FNSH 3GSUB 3I85A 5HDBF 1MIEH 3FO0H 1NAMA 3QO1A 1GC1L 1MCWW 1S5HA 4UMGA 5E2UL 1MREL 2FEDC 3H3PL 1Z5LA 5ALBL 4M1CD 5IEKA 1QEWB 4R4BA 4PB9L 4ZSOA 1FFRA 4EUPA 4JY6B 3FL7A 3T1FA 4F7TA 1P4LA 5T1LA 3WFCL 4DAGH 3G9VA 5IB4B 4LQ1A 3OAYH 4MNHB 1C12B 1S7VB 4U1LA 5ADPL 3I2CL 3WS6A 1KIRA 4QRRB 1MY7A 4OD1H 2CIIB 2BNRD 2AJVL 2BXZA 5DSCA 1F6AB 5C0BB 1JZ5A 5F7YC 4FMFA 4S2SB 3TBSB 3VXQB 3EJYC 4DK3A 3HPJA 3T2NH 1O0VA 2Q87A 4PV8A 3LRSB 2X4QA 5TE7L 1X4XA 2CQSA 4BFGA 1KACB 1PFCA 5BRZD 3UJTH 3HC4L 4KMQA 3VCLA 2R56H 5CUSL 3VFRA 4XBGA 4GRMA 4X99B 1CGSL 2QJDA 2VR5A 2C3WA 4M93B 2AXJA 2MCG1 2FB4L 5I8CA 3BI9X 5GZOD 3K0WA 3H7LA 2FATL 1B4JH 1BFOB 5EZJB 2DIJA 4GG6A 3GJFB 4D8PB 3VGEA 2OTWB 3LPFA 4JHAL 5INDB 1U2CA 1J1XL 35C8L 2AK4D 1LO3H 3V0VB 5IB3A 2JCCB 5IJVA 3QFJE 5HYJE 4NSKA 5D1QD 3E2HC 5ABDE 2H9GA 3OGCB 5HGAA 5JPMB 4DGIL 3T08A 5F7DB 1KIPB 5EUOB 4U1IA 3K4ZA 4UT9L 4KK9C 5GJSH 4JRWA 4OZGB 1RUML 4GG6F 2C3XA 3CDCA 1QR4A 3UAJD 2VL4A 2AV7A 1L7IH 3BPOB 3O2DA 4P2RB 1JZ7A 1QA9B 5F3HB 1QHPA 3I75B 2CD0A 4FHBD 4LRNL 4I3RH 1CDYA 1GIGH 4ORGA 3NCFB 4BQCA 2VLKA 3QIUB 1T03L 1I9IH 4WHTA 1P4BL 2VLMD 4DZ8A 4Y16B 3F7VA 1H8SA 1D6VH 3UTPE 5E2WL 5FYKU 3MTRA 4PBVC 1XAUA 3GIVB 3UTTE 5D9SB 1DQLH 3MLYH 4RAUA 4U6XA 4ZUWB 4CMMB 1K85A 4X8JA 3K81A 2COQA 1KB9K 4M7LT 1QSEA 5MENE 1SEQH 1SM3H 1PYWA 4JM2D 2J5LC 2P45B 1SJHB 4K71C 1CD1B 4JFDE 5CILL 3EO1B 1IRAY 4E41A 4MNGB 2VR4A 5C07D 1I8LC 4LKCB 4YC2C 4OLWH 1NFIB 1BVKB 1P7QD 4Q9QH 3HG1D 3MBEC 2VAAA 4NZRL 2NXZD 4E42B 1EGJL 1U3HD 3ROOB 4KH2A 5CJ5A 2FH6A 1BZ9B 2PF6A 1EPFA 3ZDYF 4KKLC 5C8JB 2B20A 5DLML 3MUGB 4U6VH 4YDIL 2XZAH 4ZS7H 4LSRL 1CDHA 4M1CC 2UVEA 2PNDA 4Z78B 2CJUL 2ZCKL 3JUYA 3SQBA 3ULUD 3WCYA 3KPSD 4J6RH 2H32H 3CLEL 1QRKA 2ZSVB 3QAZB 3WE6A 1I8IB 1S8DA 5BV7B 2EC8A 1JF1A 4GSDH 4KTYA 1BBDL 1TITA 4M3KB 3VW5A 1Q9LB 4Q2ZA 5K59F 3CMGA 1IGYB 3B5TA 1CFTB 4OBRA 1A0QL 3BGMB 2L4OA 5E00B 4F57L 4X5XA 5EORL 3S98A 1FO0B 1MCPH 1WLHA 1A3RL 3TP4A 5JNYB 5ESQA 5F7KC 1V7NH 2DMBA 2A2QT 1EEUA 1RUQL 4L3AA 1WQVT 4ONHA 5EFIB 1BZQK 5CCKH 2DLFH 4XPTH 1AP2A 2F5AL 2RCSH 4PJHB 3ARFC 3EYOA 1IAII 4NHCL 1K9TA 5SX4I 2X4TB 1FV1B 5EUKB 3BUTA 1KPUB 2I9TB 3KPLB 1UVQA 3MUY1 3HZKA 1JN6B 3S4BA 1WBZA 4WFFD 2DRRA 3D18B 5HHNA 5DRZB 4P5MB 4TUOB 2NY4D 4O58L 2QR0B 1BQHG 4MA8H 2P24A 2VZOA 1DN0A 5GZOC 3UJIL 1HHKB 1UXWA 2HFGH 1CFSA 4H1LA 4HFUH 1INEL 3PHOA 3S3PA 2FGWL 2JB6A 5MP6H 3ILPB 4PG9A 4ALAL 1X6NA 2OCFD 4CADA 3ULVL 1NEUA 4NNXB 4XXDB 3GHEL 1DEEA 3SE4C 1PZ5B 3WKIA 1O7SA 5D1QC 3QI9B 3WDIA 3ZDXF 2AQ2A 3QWOA 3O3EB 3RVTD 1J0KA 4GKOA 2FH8A 4J3WA 4BFBD 3OPZH 4HK3J 3TIDA 3WFDL 1XCTA 5CZVH 4XCYB 2VLRD 1FYTD 5C08D 2BDNL 2BXYA 1FVDA 2NX5A 4PRAB 4EUPH 1G7JB 2OKXA 5ACZB 3G04B 4FA8A 3SKOA 4JZNA 3UAJC 3BEWA 2XWTA 1N64L 4UT7L 3GB7A 3ZE0F 3GSXB 3G5VA 3WJJA 1RZ8B 2ERJC 1F02I 2CKBL 4YR6A 2ZP0T 3TN0D 2AABH 3Q6GL 1OQOA 3EOBB 1HHGB 3L7FB 4M5ZL 4OLZL 2P8MB 2VL5A 3KWWA 5D1ZB 3U46A 3TCLA 3O41A 1CT8B 4CN4A 3LPWA 3V4VL 1RJZA 2CO6B 4NKDB 4NFCA 5IHUH 1J0JA 3S4SG 3WKFA 2YUXA 3KYMB 5CSGA 4Y19A 3L5XL 1CGYA 2GCYA 1U8LB 4IOFD 3SQOL 3IU3B 5CHNB 2FL5B 5CJBA 1CGWA 2P7TB 4KI5C 4FQQA 1QEWA 5I6XC 2KBGA 3RPKA 1N5YH 4GBXB 1I8KB 2NR6D 4N0FA 4DW2H 4F15C 4M48L 2ZUUA 5LJYH 2D3VA 4L8CA 3PWLB 3PHQA 2NXZC 4GKNB 3VXPA 4LSUL 1U3HC 5FUZH 1S9YB 1JGUH 2ICCA 1H0DB 4MNHA 4NDMB 4OQ1A 5GGSB 3IRPX 5K9JH 2ZKHH 3L7EB 1DUYB 4HUVB 3P73B 1BIIA 2IH3A 6CGTA 4HH9A 2FJGB 3QCUH 3IJYB 6FABL 1HN1A 3ULUC 5DRXA 3QUKA 1GGIH 1WZMA 1LO4H 2X89A 1B4RA 5FIEA 2P5EE 1KN4H 1T0NA 3MZTA 3KPPA 4XAWL 1S7TB 3ARDB 5D2LE 3VD3A 1DQDL 3BPNB 2XG5A 1NUGA 3IDXL 3JV4A 4XPAH 2WBJC 4V1DE 2FEEI 5EO1B 1X9QA 4DEPB 1U6AL 1ODAA 3L3GB 3OHXA 4PRNB 4M62H 5I1IL 4WV1B 4OUOA 2R0KH 1MUJB 3NOIA 4JDTH 4QRUA 3O2DH 3RWCA 2APFA 5FOBA 4DJMA 1KEMH 1E28B 2EYSA 4Q74A 3PQYD 5IMKB 2D31B 5B8CA 4OI7A 4QY8B 3IXAA 4IS6A 1YQVL 3FAWA 5AYQA 4YPJA 3AVEA 4MQXD 3S4SB 1NAKL 4HWEH 4AIOA 4S11A 5LXGH 3D39B 3LKPA 1WITA 3EZJB 4J8RB 1F8TH 1FBWA 1YMME 2MOVA 5AZ2L 2VIRB 3MREB 5GSRB 1R3IL 5GQBA 1AD9B 3TJHD 4TVPH 5ESAA 1T20A 4LPCA 3ALWA 3U0PA 4I18A 3TBYA 4M7LH 5DR5L 4IIQB 2BVYA 3O6FD 5F7DA 4GAGH 3K8MA 1KIPA 5EUOA 5GGRY 2IALB 2ORBH 4FFZL 4MJ2A 1HILA 4JPWL 5KSBE 4O2EB 4Q2BA 4NN5C 3RGVD 3W7SA 5ISZB 1BJMA 1IGMH 1V8HA 4N90D 4PY7A 3ARGB 5ERWA 1MI5D 1T7WA 1WZ1H 4EBQL 1MEXL 5BVPL 1FL5B 3G5ZB 3C08L 4AEHH 3VXSE 4XUVA 3HPLB 2E7MA 2X1OA 1J0HA 3P4MA 3GLYA 3ALPA 4G43B 2OL3H 5DZNA 1KPRB 4L8DB 1MPAL 5FHBL 1UB5B 3MRFB 3AUVA 1AQKL 1FL3A 5EUOF 1DDHA 5IESL 3DSFH 1CI5A 1DSFH 1A1MA 4NQCD 2BFVH 4LPYA 4QT5B 4NJAL 2OP4H 4NYLA 4MXQD 4UU9B 4JZOB 3TN0C 4OLUL 2O61A 4R7DB 2PTTB 1QRNA 4XCFH 1KREA 3MRNB 4O00A 1C5DA 3GSOA 1A5FL 3GMLB 3R0NA 4XVTL 3RI5K 2YD9A 5GS3A 4J1UA 3U0TA 1NFIA 5IBUB 2YD3A 4LCWA 2X4NA 1G0DA 5SWSE 1FZKB 1ED3A 4HH8A 1OAXL 4IOFC 5GSVB 2ZPKH 4FZEH 1BLNA 1IGCH 5CMAA 5HVHC 3U9UA 1T6VN 4Z78A 3G5XB 3OKYA 1U8JB 4WY7L 2DWEA 3BP4B 3PWVB 4XNXH 1DE4B 2VLJE 5EBGA 3QXDB 2V7HA 2VXUL 3BWAB 5FHAH 2NQCA 5AEAA 4H1LH 3VXUE 5HHPB 2W91A 4N8VA 5FYKD 2I9LB 1GZQA 1BGXH 5D1XB 5I18H 3W0WE 1J10A 3IDJB 4KJWD 3PF2A 2C26A 4JE4B 1MWAB 4X6CE 3UZEA 3GMOA 3QCTH 1HQRB 4H8WC 3OZ9L 3CUPB 4PJCA 1VENA 4K3EH 4WVBA 8FABB 1VEMA 5D8JH 5JIKA 1MFDL 3QT9A 4MXWL 4JN1L 3WIIL 3RVVD 3PUCA 1YNKH 2X4TA 3L3IB 4QGYA 1N6UA 2DQEL 3S36X 3U7WL 2P1YA 1EJOL 1KPUA 3I84A 4BH8A 4PTUA 5CD3B 3DO3A 5J11C 4HSQA 3QNYA 1ZTXL 2VDMH 5CSZB 3BP7A 5DRNA 4JM2B 2ITCA 4X7FC 4HF5H 3RA7L 3TYFA 1H3XA 1I85A 2QR0A 4PJCF 4PLKD 1K6QH 5ENWB 2QNOA 1AGDA 2C9AA 3FB7B 3IDNB 2UWEA 5L88H 1N5AB 4NQDB 1JV5A 4M61A 1N7MH 1UM6L 4DZBA 2E5EA 4MQXC 1RHFA 3ILPA 4FS0A 3P4OA 4TPRH 5J4MA 1UCTA 4ZFGL 1FZMA 4P4KC 2F54D 4MZ3A 2A0LD 5K9OA 4ZO7A 4KZEH 1HYSD 1SY6A 4OD2A 3G08A 1IZKA 3M17A 4HGWA 1S7UA 1QBMH 5DYOB 3OAZH 3V6FA 2NY5H 2UWEF 3LAFA 4KRMB 4H5SB 1A7OL 4Y1AB 3FT2B 5SWQB 3FHAA 2BSED 4LBEB 5ACZA 4GS7C 1WFOA 4EIGB 4X7SL 3D9AH 3T2OA 1W0VA 3BZFA 2B0SH 2FX8H 2M1KA 4G9FE 1BECA 3GSXA 2VDRL 5JXED 5GS2H 4A6YA 5EA0H 4DTGH 5IV2A 5IBTL 1E6OL 2YEZB 1UWGH 5HHVH 3FQUB 3X13A 3BD3A 3HZMB 5I1GL 4NKDA 3H9SD 4JKMA 3QQ3B 3C09C 4G7VL 2V6HA 1BOGB 3DTXB 4HG4K 4X8XA 4JRXE 4YE4H 2BMKA 3CMOH 1NBZB 4V2BA 5DS8A 5E5RB 4HPOL 4QO1A 1CFQB 4WIQA 4Y5XB 1J1PH 1ZLWH 1CXIA 5D71H 1VACB 4L9LB 1NJ9B 3JWNC 4K7PY 4GKSB 1TQCB 2AXHA 3P30H 1EEYB 3WD5L 4Z0XB 5JOFA 3PWLA 1FIEA 3D3VD 4KROD 2CSPA 3L5WA 2XYCA 4QF1A 2WYNA 4NDMA 3SGDH 4W6YB 3P9LB 1NGYB 1MFAH 2X4OB 3RVWD 1A4JB 5TQ2L 1C16A 1WSST 5TE6L 5IK3A 1G7LB 3QRFM 4J5TA 1B0GB 3GBNH 2EDRA 5D7KE 2EO1A 4HBCL 4CGTA 5MHSE 2GQHA 4NJ9H 5I1KL 5DXWA 3MNVB 4ELKA 5C08B 4EL8A 1ND0B 4YIQA 5GRJH 3WXWL 4KZDL 2W9DL 5DJ0B 3MUJA 1UCBL 4Z7VB 1A02N 3ULSB 3P11L 3T0EB 2BCKB 2X40A 3V8CA 1J0YA 2CKNA 2VZVA 1ONQB 4ODUB 4ZPVA 1AR1D 1NANI 4J3UA 3ZTNL 1AXTL 5FM4A 2CRMA 3RRSA 1Q9KB 1N59A 4AH2B 5FECA 4KMTH 4WW2B 2YPKB 5IMKA 4OZFH 4HW6A 4YHIA 4NGHH 3NBNA 4NKOA 4HXBL 2R1YA 3V6OE 3RVVC 1DEDA 1T1WA 3SPVB 2PKDA 3HR5A 2NY6C 4U1SB 3HNSH 3WN5B 1KBGL 5DQJB 3MBEA 1TZGL 2E6PA 3F6IA 2D7TL 2R23B 1DLHA 2V5YA 4O9HL 5T1DH 3S5LG 1YJDL 1GGCH 5I16A 2ITDB 1UJ3A 3MCLL 1RU9H 4X80H 2C3GA 3FZUD 1T0MA 1G7IB 2VISA 3BKJH 1X9DA 4QHNA 3SJVE 1YN7B 3RTQD 3EDJA 4XC3H 3UTQB 3AY4C 3MRCA 4ODXB 3MNZA 3VU2A 4F3FB 3MV9D 3LQMA 3V8OA 4L0GA 1T1XA 3FRPG 3MRLA 2DMCA 4JKPL 2Y07L 3HPLA 2IPKB 1HYSC 4HFWB 2OSLA 4EVNB 3G6AB 2BNRA 1FIGH 1NCUA 1CU4H 5GRUH 5HGHA 2HJFB 1G9NC 2J4WH 4H0HB 5DWUL 3NZHL 2P5WD 1D5MB 3V6BR 1SEBB 2DQGL 1KJMB 3QNXB 3CIHA 3QUMB 1UM5L 1G7HA 4PJBB 4RRPG 4X6BB 1TQBB 3REWA 5BRZA 4D2NA 4P9HH 4X98A 5CP3A 4UU9A 5JXEC 43C9B 3SDDB 4WFHE 4FFYL 4RA0C 3HC0B 5HVGB 3GMLA 1BQLL 2W0LA 3GUTA 1LK2B 5HPMB 1U93B 5GGTL 5A2KH 2R4SH 3QHFL 1I1AD 2VDLH 1MLCB 2GJ6E 3ELAT 4OCYH 5F1OB 4Z7NE 5E94B 3ZL4L 2X05A 1CN4A 2AK4A 4M6OH 4M1GL 3ARSA 4D0CB 2PYFA 3SE4A 2GTWB 3IS0X 3PGCA 5D1QA 4LSVH 5C9JA 4M7ZB 3G5XA 4JFOB 1U8JA 2IQ9L 2HWZH 3OR7B 3UJJH 3PWVA 1T04B 1BD2E 4MB3A 5HYSG 1B2WH 3D1MC 5IMMA 4PRHD 3QIWB 4HS8L 4RA3A 1C08B 3LRHA 1O5DT 3I6LD 3PDOA 3DO7B 3HHRB 1QBBA 3RGVB 2VR9A 2VLLB 5D72H 2XTJD 3QIBB 4ZD3L 2F53D 4JFED 3RVWC 4CW1A 3NZ8B 2ADFL 4IHOB 1FN4A 4PJ8B 4P48A 2YS4A 5IQ7L 4QRTB 2AJUL 3MYJA 1SY6H 1ZA6A 1PKQA 3BDBA 1I8MB 2QSCH 3ZHKA 2CDGA 3WFEL 4YDKL 2PCPA 3ON6A 1FQ9C 4FXKB 3TH2T 2ZZUT 1AR1C 2O5XL 4NCC2 3SE9L 5T33L 4JKWA 2F5BH 4YHZL 3AAZB 5IBLD 1JHTA 4JM2A 4GRWF 1HNFA 4A6YH 4OSUL 2QQQA 3LN4B 2VZSA 5ENWA 1KT2B 3EZ8A 3P0GB 5C07A 1EERB 3AREB 5EBWB 1DUZA 1CZ8L 5ADOH 3TT3H 2CDFA 4QCIA 1P7QA 3HG1A 4MVBC 1U3HA 1OF2A 4OF3A 4HUXB 2AI0H 3B6SA 2IJ0C 3MJ8A 4ODWA 5CEXA 4QOKD 4OUUB 1ZLSH 2AJXL 3MRQB 1FBIL 3R0MA 5GGVL 2AERT 2W59A 4WW1B 4QRQA 5HYFA 4PB0L 4XRCB 3FZUC 2WBKA 2NCMA 4JM2F 2C1OA 5J06A 3VGAC 1JMXA 4H25B 3QFJB 5HYJB 3L5HA 1Y18A 3KPSA 2L0DA 3CVHA 3K80A 2GUOA 5IKCA 3QEHB 2VXVL 4WFED 3LMJH 4X4ZA 2YD7A 1DVFB 4LBEA 2HVJB 4NKIH 4UINH 2ZCHH 4YEFA 2DLHA 1KELL 1U8KB 4HIXL 1IGIL 2YWZA 4OFIA 5F71A 2DLIA 4YPGA 4LF3B 1JPSL 2EO9A 3ARBD 1MHHA 2A1WL 3WUZA 3EJZD 1N0XL 5E56A 5C2UB 3NFPB 3ULUF 4HUWB 5KS9E 3CD4A 3MBXL 2OJEB 1IGJB 4HS6B 3S88H 4X6FA 4JO2H 4IOIB 4Z7OF 4GXUM 2BRRL 3WIRA 3MJ9A 3TO4D 1NCDL 1KCVH 4DQOH 4PJDA 3KNBB 5IM7B 4KHXH 4WI7A 3MLXL 4NQTA 4K9EL 1KLFA 1KFGA 2XQYG 3UTTB 4EN3B 3O3UN 1Z2KA 3GSNA 3DRQA 5F70A 4J3TA 2ESVD 5C0GB 4X83A 1LHZA 3H42H 3QIUC 4R4FH 5MENB 4AIXA 3C6LB 3S4CA 3KYNB 4ZDHA 5IF0A 4JQVC 5E8EB 1U8NB 5HHOE 1CR9L 1YEIH 1MJUH 3WXVH 4AL8H 5FM8A 1MJ8H 4LPXA 1QKZH 1VFMA 2DIAA 2UVFA 4XMLL 5DMIL 4PLNC 1HH6B 9CGTA 2H2SD 1E0OB 1S7XA 1ZXQA 2M26A 5C09E 5L2KD 1FCEA 4JHWL 4PJDF 4TN9A 3P9LA 3VFTA 3C8HA 2F54B 5GS0D 3UBXA 4HKZA 1D5XB 3DX6B 4RDQG 1OVZA 3S4AA 4XMKH 3NA9H 4YFDB 4X9HA 25C8H 2VC2L 2VLRA 1FYTA 1ND0A 4Q97A 2ADJA 5BZDA 3X3GL 3ULSA 5F7FA 3Q5OA 3SY0B 3JTSA 4ONGL 2VDOL 3BD4A 1AE6L 1LK3H 5F3BB 2J8UA 5D6DC 1GVIA 2G5BA 3S34L 3TN0A 1CE6A 4TRPL 1UWXK 1HHIA 1MVUB 1RV6X 1FC2D 3BAEH 3ZMRA 4KWUA 5GRWA 1A9BA 4NN7B 2LE9A 2Y6SD 3WJLA 4OLYH 1YEEH 5B3JF 5BV7C 1BIHA 2EE2A 3TNMB 4OJFH 2Y36H 1QFWI 2PTUA 3OKMB 2EH8H 5DQJA 5GY3A 2Z8SA 5FKAB 5FUCE 3VXME 4PPTA 2AFAA 5MEHA 1E27B 1I1FB 2AW2A 4OCMC 2W65A 2J8UF 5IBLC 5CP3H 2C5DC 3BUYA 3IAPA 1XF1A 1MH5B 2JLLA 3ME0A 3SCMD 1DQTA 5L0QB 5IT2H 2X9WA 3WNPA 1N26A 4N5ED 4U05A 4LAQL 1CL7L 4MD4A 4IJ3B 3IRZA 4XVSH 3MRRA 3GZKA 3HAEG 1ZHKB 2UUDH 1JMZA 2W9EH 4U49A 3I3BA 2GFBA 3DYOA 2BOBA 5IFJA 2YBRB 4HMCA 2EEDA 1CLOH 1I75A 4K3GA 2P8LB 5I75B 5JO5B 3ZKNC 5IR1A 1CGTA 2Y5EA 2VUYA 3IAQA 1FNEB 3VXOA 1C7TA 5L8JB 3JTTB 3DUUA 3CXHK 4MQ7B 2BVQB 2NW3B 5EZIH 1ZT4B 1DBBL 2IPKA 2VWEE 4HFWA 4BM7A 2J3SA 4EVNA 1Q94B 3QHTC 2EDLA 1CD8A 1BJ1H 3D6GA 4YDLC 3IETB 2RFXA 4KRLB 4N0YL 2NY0B 5EU6E 3N1MC 4L4VE 5E2TL 1TPXB 4QXGH 5F9JA 1K72A 3L3HB 4M6ML 4N0UA 2PETA 1PX4A 4YUEL 5B38G 4X6BA 3VMPA 3KYOB 1L9MA 3QI9C 2CKBB 2YUWA 4ZAKB 2DS4A 3Q1SH 5I1DA 3NPSB 2X4UA 1U91A 5F44A 4S1QH 5GRVK 4AEIL 4UIKL 5KVMC 2Q7YB 3ARBC 4OKVB 4J4PD 3I6KB 1ADQA 4GRWH 3DRTB 2A6DA 1KENL 3PQYA 4LLWA 1T1YA 2J6EL 2Y9RT 1OSPL 1M4KA 3C2AH 3TO4C 4FQ2L 3VFWB 2CLVA 4K8RD 4YHOH 3LDBB 3B2UD 5DQ9B 4I13B 2ZUVA 4PRDB 4WI9A 5FYJE 4DVBB 2JKXA 3IGAB 2XZQL 4LLUB 1VKXA 2A6JA 5EU7C 4NO3B 4XC1L 3RZWA 1WC7A 4ZUUB 4PD4K 5EU3B 4HT1H 5EPMB 5CEZH 3MCKA 1EXUB 3O6FA 1Y6KR 4WUKL 3PJSB 4OGXH 2FSEB 2B1AL 3RIAK 3L1OL 2H2SC 3HMWL 1C08A 4Z6AT 3GSRB 3RGVA 3S36H 3QZWA 4P2OB 5DTFA 2VLLA 4OM1H 2E7CA 4XH2A 2DQDH 1MI5A 2VDQL 4M6NH 5GS0C 4TQEL 5ITBH 3WDJA 3CFCL 4GBXC 2MPAH 4DVRH 4BZ1L 3S97C 1QBLL 1JTPA 2FJFA 4NC0B 5C0DA 5CKGA 3DV4A 2Y25A 3ULUH 4U1HB 3CVHH 1S5IH 3VFVB 1K8IA 1R3HB 4N5UA 3IFOB 4LLDB 1RK1B 4NQCA 3SDXE 2J88H 5TE4L 3Q3GB 5D2LB 2WSKA 3SE3A 1RAMA 3CSYB 3VXRE 1L6XA 3DBXA 5LGJB 5JDSA 3THMH 4V1DB 1IM3A 2Z8WC 2EYTA 3AAZA 3GO1L 4FQXB 4FQJH 2GJZB 4NWUL 2Y6SC 4QRSB 2D0GA 1KT2A 3ARDC 5JHDB 3NTCL 3BPNC 1EHLL 2ICEB 4WFGD 4R96A 4F2MB 4HGMA 2R2BA 5C0CD 1NEZB 4RMRA 5DJYB 4PRBA 5DD6A 1CXKA 4NOBA 5FM5M 3FB6B 3MJ9H 4N1CA 1T83A 1AGCB 3LS5H 1RK0A 3GBML 5FF6B 3QRYA 4WUUE 5I1HH 1QACA 5ETUB 2ZCLL 5FV1L 4WW1A 1LE5A 5JQ6L 3SCMC 4PRPB 3M1BA 1FFOB 5KOMC 4L8BA 3EYSL 1YMMB 2VZ1A 4NQEE 4N5EC 5C92A 5IMOA 2A9NL 2Y7QB 5DJXA 3DLQR 3W9EA 1U3YA 8CGTA 5FYLD 1RJYB 3AGVA 1IAMA 1IQDB 4DN4L 5FCUH 5ITFA 1XH3B 3RVUD 4G8GE 4XPGL 4Y88A 4PY8J 3KR3H 5IGXH 4XMPH 5KSBB 2WQRA 2PXYB 2VXQL 3TPUA 1X3DA 2EZ0D 4JFEB 5JLZA 3QQ4A 4HWBA 4JFHE 4XPHH 3GI8H 4P57A 4PJGB 4PP1D 3VXNA 1A6PA 3QPQD 3DIFB 3RJDA 4RWYH 1MLBB 4WEBH 1AHWC 3VXSB 4OBSA 3K74B 2R4RL 2LU3A 2MCPH 1IAIM 3VD4A 4P46B 2KKQA 1DANT 1X4YA 4PJ9D 4MX7A 3HNVH 1RIUH 1Q9OA 3ZKXC 5DT1L 2Q6WB 5L6YH 2HKHH 4JFYA 2ADIB 3QFDA 4QWWD 3BGAA 5ECJE 4FQ1L 3GMQB 2LV4A 3DGGB 4L3CA 1NCBL 2P4AB 5IM7A 1LEGB 5DD5H 3LN5A 5IROA 1IC1A 3PV6B 4MB4A 1RZGB 4S1RH 5DMKA 3OKOB 3O6ML 3QEQE 5E5MB 4MA1B 1UH2A 4R4NC 2V5RA 4J4PC 2Q86B 1YNTA 2NTFB 4BYHA 2OK0H 1OLZA 1AKJD 2DQFB 3GNML 5HXMA 4YQXH 1TCRA 5IW6A 2NY1D 1JNLH 3MR9A 4CU7A 2R39A 4UTAH 4ZFOL 3AY4A 1CG9A 4L8SC 4K8RC 4LDLB 2A74A 4NRYA 4KXZH 4EXPX 5HY9A 2DQUH 2DIBA 5AUMB 1LO5A 1H5BB 2EKSB 3I3EA 4P3CL 1XF2B 4JY5H 2F54A 2MQCA 4Z7WB 2OJZL 1QSVA 1A3LL 3LKRB 1D5XA 2XKSA 4YXHL 2JJUA 3R1GH 4U3XA 4QKXB 3RWDB 5J56B 5J0BA 3QHZH 1J8HD 2AAVA 2MQ3A 3DI2B 3FO0L 1IQWL 2BVOB 3MJ7A 3RWGB 4TSAL 5F9WB 3HZVB 4IRSD 1HSAA 1CLYL 2XFXA 2VLJB 3SY0A 3QQ9D 4R7NB 4GMSH 3M8OL 1W72L 5BMFL 4FQPA 5AD0B 1VGKA 3VXUB 4N68A 5T5NG 2HT4C 1F4AA 4ZG8A 3CLFH 5JXEA 3W0WB 2ID5A 1QG3A 5TPWH 5GJTL 5BS0E 1X44A 3MOAL 4TVSa 4F7MA 3T4YA 4P3WA 1YN6B 4ODTH 1RJCA 4I2XE 3TNMA 4FXGB 5CIPB 1GAHA 3H9SA 3U7YH 4KV5E 5FKAA 3SKJH 3MRDB 1Q72L 2G2RA 1MNUH 1A6UH 3JWDC 1ZA3B 4RGMC 3S37X 3C9NB 1TMCB 1H9VA 3PP4L 4Z8FL 1LEKA 1YYLL 4MAYD 1RD6A 3QB7C 4JGJA 4I3SL 4HHAB 5KSAD 5DHYA 1R0AH 2AGJL 1J1OH 1ADQH 2WBWB 5LGHH 3RBSA 5T1KB 4LRIC 3VH8G 2YBRA 2IFGA 3D3VA 2X41A 3BDYH 4HZLB 4P3DA 5JO5A 1GCFA 4OZIE 5F89B 4OZHB 4PJIE 5FUOH 3WKML 5E6IC 1NGXA 5DD0L 2EDOA 4WO4D 1Z9MA 1Z0NA 3ILQD 4I5BA 2WNGA 2YK1L 1FNLA 4NKMB 1WWBX 1ZWIB 4JFFD 2JELL 4XP9H 3D85B 2YUVA 5E8OB 2H3NA 1FORH 3DVGB 5C0RL 3X11A 1DBAH 1FJ1A 5TH2B 3V6ZA 3IJHA 5MEQB 3RVUC 4APQB 3RY6C 2R1WA 5I8EA 4KDWA 2IGFL 1SVCP 4AT6A 4UTBH 2EZ0C 4KHTH 3RL2B 5IB2A 1EO8L 4NC1E 4JZJB 2O93L 1Z3GH 3A6CL 3QPQC 4JVWA 1HIMH 1QZ1A 1PG7X 5EU4B 5GJSL 5HGDB 2EDTA 1BAFH 4NQVA 4UQ3A 2B7DT 4CVXA 2FZ3A 3VFNB 5F1NA 2ZZRA 4PJ9C 4GAFB 4ISVB 4NM8L 4LKXA 2KZWA 3AFJA 3GIZH 4KTDL 4MHHG 3N85H 2X4SB 2VN7A 4QWWC 4PV9B 5EZLA 4L29B 2YN3A 5K9KB 4XP6L 3RENA 2FECL 5LVEA 1AJ7H 1J88A 3OWEA 4UILL 1E6JH 4PRDA 5I17A 4LPVA 1I7ZB 4JRXB 1VCAA 4PJXE 2CIKB 5EOTB 4OFPA 1IM9D 3OR6A 2DL2A 5IVZA 4OAWA 3C87A 2NY1C 5GGUB 4JDVA 3RTQA 1EEZA 3F12B 3VFMB 3HE7B 1CDGA 4QXTA 4PRIE 3MV9A 2PR4L 5HJ3B 1LVEA 1SM3L 1INDH 5JA9A 5GIRA 1QLRB 3VFSB 3NIDE 2IWGA 1MRCL 1A9EB 4O4YH 3MNWA 2HLAA 1HI6A 4EI5B 5FAAA 4XWGL 4GW1A 4PJFE 4Q9QL 3HNTH 1CWVA 4AZ8A 5KVEL 3LH2L 4PFEA 1JI2A 2P5WA 4NCC1 3OAUL 2I24N 1IL1B 4XGZB 2IG2L 3HLAB 1OB1B 1OY3B 1WU5A 4IRSC 4XP1L 3WEXB 2D03H 3PABA 4TF4A 2NW2A 3QA3B 4FTVE 3QNZB 4HUUB 4J6RL 1AR2A 5FYKH 1NGZA 1G7QB 4PGDB 1UQSA 5JHLL 1EMTL 3MX0A 4Y2OA 4HWBH 3QJHB 3U7AA 4JPVH 4BK5A 2PTVA 5C0IB 4XZUB 1KCSL 5IW1B 3MRBA 4WHYH 1IAKB 1KYOJ 2GTZB 1I1AA 2NY7H 1HKLH 4NM4L 1JNNL 4AIZA 3FONA 1YEHH 2FX9L 3HRZA 3EHBD 2VDNL 3FB6A 4FQCH 3DV6B 3LQZA 4OFVA 1ZHNB 1V3JA 3QUYB 3LV3A 5CCKL 5FF6A 3NN8B 3QCVL 4MAYC 5KVDH 4KI1A 4WI8A 3E6FB 1VEOA 2W1NA 5BO1L 4UBDC 4OCWH 3BH9B 1KIUA 4NZTL 4OGZA 3QDHA 5HDBE 4RMUA 3NCMA 2YC1B 3HCVB 3QO0A 5FDYA 4R6UA 3HI1A 4JPKH 4L3EE 1T7XA 1FVCB 3GGWB 3SJVB 4PRHA 4FMKA 3FQNA 3QT3A 4I77H 4Z76A 1NDMB 1XIWB 4AYFA 4G6ML 4I0CC 4YXLL 4C56E 3MLUH 1G6RB 2F53A 4JFEA 5GS1C 5IIEA 3WFBL 4WO4C 1S9KC 3O6KL 5EIQA 3GMMA 5C3TA 2FDBP 3ANKA 1OCWH 3MROA 4FFVD 3BKYH 1MRDH 3QUZD 4M8QB 1K4DB 1KF9B 3W7WA 2I25N 2DI8A 4J3OC 4F33B 1HINH 1BFSA 1G9NH 1I1YA 1WIUA 4N1EA 1JRHL 3PGFL 5E2VL 2EE3A 1NAML 1T7YA 2E9BA 2FIRT 4ZSOE 5CS7A 1EUUA 1J7VR 3TA3B 4ELMA 1KSDA 3OKOA 3CZJA 5CZVL 5IOPB 1QO3B 1L6ZA 3IAGC 5BW7A 4GKZB 3FB8B 5J3HD 4CMHC 4J12A 1YUHB 5DZLA 2DQFA 1BJ1J 1DQQA 2JJTC 2ICES 1P84K 4BH7B 2I07B 1UWEH 3Q5YA 4BQ6A 1T5WB 1IA7A 3G6DH 3MRGB 3O8XB 4G8EA 1VFAA 3UTPD 1DP0A 2N7BA 2GJ6B 1OHQA 3U1SH 4ZUTA 4XNQB 4QOKA 3EOAA 1SHMA 4ELMF 1A7NH 4Z7WA 3VFGH 2XQYK 2FD6L 3KXFD 5IHUL 1MCBA 3VFOB 1I3RB 5F96H 3D0VA 4JFDD 4Z5RB 4ZFFB 1IEAB 5E7BA 3BW9B 2FNBA 1MCDA 4NRXB 1B0WA 1S7QA 4KTRA 2FBJL 4I48A 1FGVH 3VWKD 1GC1C 1K5NB 3FFCD 4AM0B 1QHOA 3TIEB 5DURD 4M7ZC 4Q9BA 5MI0B 4DW2L 5HD8D 1YQ2A 5JIIA 3BP6B 2KQNA 4GG6E 4Z7WF 4OCSH 4KVCL 4YBLC 2DTML 3ARBA 4LEXL 3E3QC 5D70L 4EQ3A 1TZHB 2CLZB 4K94L 2QADC 5AWNH 2YD6A 2FX7H 3OJDB 1R5WB 4YHPA 4KJPD 3TBWB 3TO4A 4UQ2A 5E08L 3GM0A 3TJEL 3MLZL 5IMLB 1GGIL 4WCYH 1ZA3A 1U8IA 3QPXL 4PJ8C 1HNGA 4HKXA 4HHAA 4NKQB 3GSQB 4WJ5B 2ESVA 3B5HA 5FEBA 1T5XA 3DNKA 2EEBA 1K2DB 3K8LA 4YFEA 4LIQH 5FK9B 1TJIH 5KW9H 2DJ4A 1DQJB 1NL0L 1E4KC 4YDVB 4XNUH 1WWAX 1UXSA 3EHBC 2MWCA 3LKNB 4L4TD 5JW5A 5M94B 3F8UB 4JDTL 5L2KA 3B9DA 4F7CB 3EDFA 3K7UA 1NBYB 4OZHA 5DJ6B 4AK1A 2VLKE 3IYLW 5L7XH 1NC5A 3UCRA 1QPPA 2BNQD 2BHUA 5JW4R 4LFHD 1MCKA 4ZUSA 1KULA 1QQDB 3ZDYE 1BQHA 5DC4B 5E8OA 3DVGA 1J8HB 5HYQB 3H0TA 4TVPE 4U1GB 4K7PL 4FZ8H 3NGBC 2ILLA 1MRFL 4PYGA 1TVHA 3ULVD 1ORQB 3HN3A 3UP1A 1YEGL 1NLDH 2CDEA 2BZDA 1CE1H 1RIVH 4OZHF 1MCFA 4F58L 1LNUA 4KTEH 1KCRH 2K1MA 3P0YL 3PDDA 4OQTA 4E5XA 3TVMC 1KB9J 1GHFL 1MOEA 3QUZC 1F2QA 3MMEB 4MA3B 3VFNA 5CZKA 3TZVD 5HDQL 4ISVA 1PSKH 2QSQA 1HQ4B 1LMKA 3LB6D 2APBA 5IG7A 4WU0A 4POZC 5KS9B 4OF6A 1UYWH 3CVIH 4DUWA 4R3SB 4E0RB 2E6QA 1DR9A 2P42B 2Y1VA 2Z4QB 3BXNA 1W0WA 2ADGB 2AKRB 1T2JA 5DO2D 2EDKA 3W5NA 1AC0A 5J3HC 3U36A 1WWWX 5I74C 1LD9B 3SCMA 2QQKH 4Q6IC 1A22B 5ILTL 2HJKA 2X9YA 1PBYA 2NLJB 4AQ1B 1EDQA 3U0WH 3AMKA 5DA4A 4LHJB 2DBLH 5ID1B 3PGDB 3T77B 5IFAL 5HHOB 4ZUVA 5HGBB 1KSRA 5ICXB 4K7FB 4S0TD 4EN3C 1A9EA 4LVHC 3RDTD 2F74B 1EVUA 1U8QB 2IPTL 4BQ8A 3KJ6H 5KJRH 3KLDA 1MCOH 3C6LC 4J2XA 5JXAH 4NNYB 4WI2A 1OP3K 2DDQL 1NGPH 5TDOB 4GUPB 3HLAA 3B3IA 1MHEB 1FVEB 3ZDXE 4XPFL 1I7UB 4X5WA 4P0DA 3T0VA 1NMBH 5B39G 1M6OB 3LSOA 5CZXD 1VPOH 1IC4H 3DMMD 3D2UB 3WNMA 1T21A 4JQIH 5HD8C 3QWTA 3MV11 1R3LA 1UACH 4XNXL 2A9MH 2IC2A 3OKEB 3P77B 3QJHA 4J4PA 3ZE0E 3QDGD 1FDLH 1CFNB 1XGYH 1FGNL 3RL1A 3V5HB 1IAKA 5DMYA 4FABH 2C1PB 2P5ED 1F45A 4MQTB 2BSRA 1UGNA 3MLPA 3ARVA 4GQPH 4KJPC 4YXKH 4GMTH 5F7HA 1YYMH 4L8SA 3G5YB 1YDPB 4G8IB 1NC2B 3MODL 2HFFA 4R8WH 3B9KD 3MFFB 3E6FA 1JWSA 3GI9L 1WCQA 3MLSH 4BFEA 4U7SA 2E8ZA 1ORSB 1B90A 1L4IA 4HKJA 2QKIB 1IBGH 2AEWA 4LCUB 4OCXH 3NFNA 3WO3B 1BX2B 5J57B 3QDMD 5JR1L 1U2HA 3AS3A 2BVPB 1BZ7A 2VH5H 4JANA 1FVCA 3GGWA 3MO1B 5DD1H 1ZS8A 5E9DD 3RNKB 1ZSDA 2VDML 3GK8L 3RWEA 2ICWA 2LTQC 3DVNA 3MRKB 3RVXD 1K6QL 2AS5M 1SBSH 5DK2B 4HKBB 5KTEL 2VDKL 3PNWA 5E4EB 5I1LA 1CICD 2DQTH 3MLVH 1HEZA 2BSTB 4GW5B 5E24E 2ZSWA 4M8QA 5J9PA 3MLWH 3EFFA 5I1EL 4EI6A 5ALCH 1F11B 3TYGL 3QXVA 4WWKD 4ZNEA 1JHKL 1U92B 3WIHH 3ULVC 4E9LA 4RGOH 5EU6B 2ZWLT 1EFQA 4L4VB 4WTWA 1EO7A 4Z0BL 1B0RB 4ZTPH 3KAAA 2EYRB 2AEPH 1TDQA 5C6TH 1ZLVK 2HN7A 2MNUA 4X4XB 3MV8A 1OW0C 4GKZA 1T1ZA 2ATKB 4JFZH 2LFGA 3GMRA 2FO4B 4RWHA 1YUHA 4LP4A 2NY0C 3LEVL 1CCZA 3UPAA 1KTDA 3G6JA 3CFDB 1L7TH 3TZVC 1IE5A 1DOGA 3LB6C 5I73C 5FO9A 2G60L 3MRGA 1JJUA 1GGYA 5C0CA 4ZQKB 3EW3B 4XCCL 1J05A 4P2QD 1QLFB 2X4RA 1ZVYA 3WIFB 1UM4H 4X0KB 4N0CD 2UZIH 4LLMA 1XCQB 1YEKL 5H35B 1WZLA 4ZFFA 2W38A 3BFOA 3G6JF 4QRPD 4MJ6B 1MAJA 1FLRL 3BW9A 3PP3K 2FWOB 5C9KA 1MFCH 1JUFB 3MFGB 5D96B 3S3SA 4LNRB 2OBGA 1TJGL 4J3XA 3RY6A 5EBMB 3MOQA 2ARWA 4P59H 3S37H 2W60B 1RZJL 3V7AG 1A6ZB 3MLRL 4MLSA 5IFHL 1G7MB 3FRUB 1Y6NR 3BO8A 4FP8H 2DQJH 4FG6D 2Z31B 2WUBH 1CDUA 4IRJD 1U0QA 3DX7B 4NBYB 5DHVB 1MFBL 1V5CA 3H9HA 5GS0H 5GISH 2VITB 1FAEA 5EC1A 4PJ7A 3V52H 1SYSB 2DQHH 3EO0A 4PJ9A 1MAMH 3KYKH 4QTIH 4DK6A 4OI8A 5I71C 2IMMA 3VGDA 1QFOA 3GBNL 3JWOH 1HXYA 5I19H 2Q8AH 3MGTA 5ID0B 2ZOKA 4JR9H 5EUOE 2EADA 3KPNA 1FZJB 3SDXB 3S35L 2R2EB 1T66C 4PJ5A 3O11A 3QYCA 4LSSL 3GSQA 1JZ3A 4OQTH 1P4IH 4I4WA 1K2DA 4H0GA 4Y5VB 1AKJA 3D25A 1FE8H 4PJ7F 3UPRB 1SQ2N 1TETL 4U6YB 3BIKB 1OD9A 4RAHA 5DJAA 5DZOA 2HLFD 5DJZA 1RPQA 1KLGA 5DJ6A 3CX5J 1JPFA 3B9KC 4FQXC 3SKMB 1PG7H 5J7CC 3T33A 3ARUA 4Y7MA 1U58B 2QQNH 3EYVB 1UG9A 3FQTA 5FGRA 1QQDA 5T3ZD 2O5ZL 2HJLB 1FFNB 3NH7L 2A6IB 1J8HA 3GBLA 5HYQA 1J18A 2XWJB 4NBXB 5DEFB 1QRNE 2D4DA 5EOQL 1G9JA 2H6PB 3TV3L 4IRSA 4R90H 2NXYB 3GMPA 5FV2A 2FRGP 2VTFA 3ECBA 1OARH 4GFTB 4PGBA 3RVXC 3RFZC 4G8GB 4YHNB 3SDAB 2CLRB 4LCWE 4AY0A 1CICC 1KLUB 4AYRA 4Y4FD 3FQXB 1UH4A 2RR3A 5FGSA 2CMRH 1ZEAL 3MV7D 3TLRA 1QFWM 2BP3A 3HMXH 4WWKC 1A6WH 15C8L 1CTNA 3VW3H 1KJVA 5ICZA 3QWRD 1GGBL 4R3SA 2EKJA 3BEVB 3OBAA 2BSSB 1CU4L 4DUVA 1O7VA 4I9WE 2ADGA 2AKRA 1LO2L 4K23H 2HT3D 2B39A 4MAYA 3SEPA 2R2CA 1UZ6F 1R3JB 2JIXB 5KSAA 1UWXH 2HFTA 3QEQB 1HK6A 4D0BA 2ATPA 1AD0A 4AQOA 4OD3L 4MJ5A 4ZFOB 1U95A 1CLCA 2D4FA 4PJCE 4RZCA 5HHME 1FO0L 4K7FA 4K8RH 5GRYA 5FA4A 4BKLA 4NZUH 1S3KH 4WO4A 5DI8B 2XN9D 4PJEA 4LU5L 4JFFA 3RAJH 3MUHL 3DXAD 2DF3A 2J7LA 4GUPA 1I7RA 4M6OL 3RWFB 3A6BL 1B6UA 1H3UA 3LQAH 4TYUA 3IKCA 5F7MC 5CWSA 3X3FH 5DUBB 3LEYL 3WHXA 3FJTA 1QSED 1W72B 1ZVSA 1KC5H 3EAKA 2EDHA 2LABA 1QYGH 2UWEE 4WDIB 4Y2DB 4E41D 3SGDI 3A67L 4LQFL 1B2WL 2P8PB 3OKEA 3P0VL 2BY1A 2ZJSL 3P77A 4KY1L 4PJEF 2WLZA 4ZYKA 5J6HA 1AXSA 2AHGA 2JJTA 3T8XA 3T0BA 5BS0B 3V79C 3FFDA 1JPGA 1MQKL 2IH1A 4JHZA 4I2XB 1FPTL 5DGQA 5HVFB 1U8OB 3G5YA 4XHJC 5FOJA 1RZKL 5J12C 2NY3D 2XZCH 4HEME 3TEUA 5CINL 4EXKA 3MXWH 3BN9C 2QSCL 3JWDH 3I50H 1IM9A 3VG9C 4M8VA 5H2BA 3ZDZF 1PJ9A 1GLMA 5DK0B 4UV4L 2DD8L 2BVPA 4PGCA 4M5YH 3UTOA 2HAZA 4LCCB 4HC1L 2HLFC 5EB9A 1RFDL 4U31A 5CBEA 4GRLC 1P1ZB 1JWUB 1LDPH 1QFUH 4A6YL 3PWJB 2PO6D 3IFPA 2IAMD 4PY8I 2KDGA 1PEWA 2R0LL 2APXA 4JM4H 5C0AD 2V7NB 2MTPA 3S5LA 2EE9A 3BKCH 3PL6B 5JW4N 1OAUH 3S8WA 5E8PA 3L3OA 4RFNC 5MERB 4HDIB 3TO2A 3WIQA 1E4XH 4IMKC 2QHRH 1WBXB 4WTZG 3NMEA 3TBVB 4U0RC 3W5MA 1U92A 5DJ8A 4RGNB 4TUJA 4OM0H 5FYLH 3BZEB 2MKLC 4YWGH 3C5JB 3QP3A 1TZIA 3B9VA 3O2VL 4FQHB 1XGQB 2ATKA 4OCRH 4Y4FC 1ZT7A 2FO4A 5FO7A 4NO2A 4ZPTB 5FO8A 4NKIL 4YHMH 2ZCHL 2C7UB 1VB9A 3SE8H 1IKFL 4N0RA 3WUWG 1KN2H 4YX2H 4F7PB 5IB5B 1E4KA 1MJ7H 5D7SL 4F9LC 4UT6L 1IEBB 1F9DA 1SVZA 1UC6A 3BPLB 4JZJC 4Y4KB 3VRIA 4RRPA 1H3VA 1E4WH 1LDSA 2BK8A 3DX9A 2HT3C 5EH1A 4W4OC 1ACYH 4X0KA 2LU4A 5MEPA 3S88L 1A6VH 1KJ3H 5T3XE 1CF8L 2X1XR 1YEFH 3C8KA 1IGTA 1VDGA 3IDIB 3CFJB 5EU5B 4PJXB 2DKMA 5T3XL 3O45A 1KCVL 5IHLB 2DQCL 1CXFA 4KHXL 2X7LB 1BPVA 3U6RB 1BF2A 4HIIA 4RMSA 4MNQD 1S9XB 1AGBB 5FDWA 5C70A 3FOLA 3L3KB 4BFIA 2UZXB 4PRIB 4NUGH 3E8UL 5E1AB 3WV0A 3FRUA 2YZ8A 3TBTB 4OIIL 4OTXH 3ROLB 5T1MB 3V5KB 4Z77B 4N9GA 2R69H 3TVMA 1A7QH 3QUZA 1MHCA 3S96B 2HRLA 4FNLH 4CJ0A 2Z0BA 3SGKC 4RFOL 4XI5D 1FH5L 4Y19D 4PJFB 4U1NA 3OKDB 2FR4B 1ZOXA 2CO7B 3O3AB 4U1MA 5HYSA 3FO1B 5F6HJ 5C2BH 4NRZB 3WFHB 4BZ2L 2H32B 3NA4A 4TTGA 2E7HA 1BEYH 3EGSB 3FKUS 4X6EB 25C8L 1Q8MA 4FTVB 4P5TD 4MCYB 5EWIL 1SJEA 3W2DH 3FO9A 2Z91A 5I1JL 4HIJB 1A1OA 5C1MB 1MF2L 3V4PL 1WEJL 2NNAB 3VDAA 5JOEA 5F72S 3UPRA 1NGQL 3CJJA 1C1EH 4PP2B 3WUWB 4TULH 1EO5A 4NZJA 1DBKL 2BNRE 5EO0B 3WNKA 3BAEL 3O4LD 1ZHBA 5D93B 3IDMA 5DVMA 1FZOB 2NY3C 1XGUB 3W9DB 1EFXD 1U58A 2YA2A 3KXFA 4JO3H 4UUJB 4WU7A 2MSPA 4G42A 4JFDA 1X5KA 2BNUA 2HJLA 5BRZE 3TESA 4GAYA 1FFQA 2CR6A 4JG1L 2AJSL 4JN2A 4KJQD 4U6HA 3QG7L 3AM8C 4Z95L 1HH9B 4NN6B 1EGJA 3OKLB 4L3EB 1N3NA 4MJID 4KK5C 2Q3AA 3VWKA 3QUYC 3R4DA 1YJDC 3FTGA 3FFCA 2UYLB 2PO6C 4M02A 2IAMC 1XR9A 5GHWH 3RPIA 4YHNA 1R3KB 2JJVA 4YO0B 1Q0YL 5E8DL 4C56B 3KLSA 3VXTA 3FOMB 3DI3B 4JRYD 3MXVH 1A1NB 4OF7A 4LCIL 3N9GL 3K1DA 3L3DA 2VDPH 2AK4E 2IBBA 1QP1A 3A6OA 4KQ3H 4IMLA 1YZZA 1K4CA 3RU8L 4KQ4H 1NLBL 4JFXA 4ACPA 3QO1B 1CXEA 1S5HB 2YA1A 4D9LL 3HE6C 1NSNL 4D9RD 2GYSA 1T2QL 1NUFA 5F7EH 3SOBH 4R4BB 3VI3F 2F58H 4ZSOB 5F7UA 2MKWA 4QXGL 4EUPB 3FQRA 4LSPH 1BQUA 3T1FB 3PWPD 4F7TB 2HRPL 3MRJA 2Y06H 1BVLA 1P4LB 5T1LB 1HZHH 3NIFF 5DJCA 4U1LB 4GRWE 3KG5A 1DL7L 4S1QL 5DVOA 1KIRB 1RUPH 2EECA 2NYYD 4L4TA 3LCYA 1MWAL 4LSTH 2OTUA 1PKQE 5JPNA 5DSCB 1P9MC 4L5FH 3IFNL 3T09A 2X4PA 2BNQA 5INCA 5DI8A 2VLME 3KHQA 3GHBH 4JFQB 4GAJH 3C2AL 3C60D 3I9GH 3HPJB 4ESKA 3INUL 1GYAA 4PV8B 2Q8BH 2WUCH 2X4QB 3O8XC 4B5EA 5CGMA 1JHLH 3IVKA 3FHQA 5F93C 4LASH 4TSCH 4EDWH 4YNYA 3VCLB 2R0WH 3VFRB 3LKOA 3GMNA 1I3GL 4XBGB 5C09D 4GRMB 5C07E 3O9WD 1GC1H 4BUGA 5E2UH 1MREH 3H3PH 5ALBH 5I8CB 3HG1E 5CLTA 1UA6H 4HV8A 5F9AC 3MV7B 4NP4H 4KUZL 1FNGA 4PB9H 4GG6B 4KKCD 3TZVA 5F8RC 5BJTA 1JYWA 5IB3B 5ITBL 5IJVB 3ULVF 3WFCH 4HS3A 1U8OA 3CPLA 2H26A 4NSKB 3KPSE 3ULUE 1WIPA 4EDXB 5DFWH 2H9GB 5HGAB 5ADPH 4UZGA 3I2CH 4Z7OE 3FT3A 1NBQA 3SHSA 1FG2B 5DUML 1NXCA 1WTGT 1NC4D 4AEFA 4U1IB 2AJVH 4Y89A 4YGVA 4RDQF 2EIDA 1ZANL 4OT1L 1JGDA 2BERA 4PLJD 4X7DC 3QBTB 2R0ZL 4P99A 2DI7A 2JF1A 3VRLE 3STLB 5EDXA 3LKSA 5DJDA 2AV7B 5TE7H 2CGRL 43CAA 4DGVL 1YY9D 1TTUA 3HC4H 3RDTA 1OPGL 5CUSH 1XF3A 4JJHA 4ZO8A 1OSZA 4ORGB 3LS4L 2X70B 2XN9B 3VJ6A 1CGSH 4ODVL 4WHTB 4UIMA 2AEQL 4DZ8B 3F7VB 4O5LL 4PJDE 4KJQC 1C7SA 4Y0GA 4U1KA 2FB4H 4LSQL 4HK3N 3HAEA 4RAUB 4WFFE 2FATH 4X8JB 4TUKH 4JFPA 5A16A 3BZEA 4S1SL 1M1SA 4M3JA 1QSEB 2ED8A 1PYWB 1X5AA 2FEDD 1J1XH 35C8H 3DMMA 2FLBT 4LPTA 3GSNL 2VQTA 1LGVA 1K8DA 4JPIA 4E41B 5DHXB 1LF9A 2CK2A 2QTEA 3LEXA 5DQDL 3DYMA 3EO9H 3QDGA 4DGIH 3U4BL 4U1GC 5F1SA 4XMPL 2VAAB 5FFLA 4LK4A 1CBVL 4NO5A 2EICA 2DICA 4UT9H 1M7XA 2P5EA 4NQXA 2YMXL 4RWYL 3HS0A 4P23D 5B3JE 3OB0K 1CGVA 2OL3B 4TSBL 5B38A 3KPMA 4KDTA 1FYTE 5C08E 2JTDA 4XX1G 3B9KA 4K3DL 4RBPK 3WE6B 1RIUL 3T0EE 3B43A 4LRNH 1S8DB 5I1AA 1BREA 1JF1B 2JB5L 1JF5A 1V05A 3QDMA 4HQQL 1T22A 3SO3C 2J8UE 1OTTC 1FSKB 4Q2ZB 2FJHA 3C6SA 1T03H 1P4BH 1KG0A 5E9DA 2NYYC 3AB0C 1AGBA 5DD3L 3EOYG 1OGAD 4X5XB 1PY4A 4K9EC 4HK0A 5E2WH 4JB9L 4LOUD 1GRWA 5ESQB 1LF6A 1RIHL 1IT9L 4MDJB 3LKQA 4ONHB 1RZ7L 2CUIA 4H26A 4CN1A 5L9DL 4XVJH 4DWHA 2D0HA 1AP2B 1CICA 1HCVA 5CILH 3F7RA 4UAOB 3EYOB 2DM7A 3LPGA 1KNOB 3UTSD 3EOTL 3O3AA 5DMJB 1HSBB 4RMVA 4WWKA 1KCUL 4HXAL 1UVQB 4KVNL 1WTLA 3HZKB 4JO1L 4NZRH 1EGJH 1BVZA 3BZ4A 3WO4B 1WBZB 5BQ7A 3UDWC 4QEGA 5HHNB 2H32A 1XMWA 1UB6A 3QHZL 3CH1A 4KFZC 5DLMH 1N6QH 2P24B 4LSRH 1DN0B 5E2JA 1D5IL 1UXWB 3R06A 1CFSB 4H1LB 2CJUH 2ZCKH 3PHOB 5GW7A 2JB6B 1JK8A 3CLEH 2DBJA 5D6CA 5TFSL 2DQIL 2FHFA 4PG9B 4XAKD 4CU6A 4CADB 1VSCA 4BQ9A 5T5FL 3CH8A 1DEEB 4WWID 4PBXA 1D5BA 5D5MA 4P2QA 3QWOB 3WS3A 1TFHA 4ODTL 4O02L 2SEBA 4F57H 2ICWJ 1DBJH 5EORH 3TIDB 1A3RH 4HZAA 2G75A 1UENA 4N0UE 1FVDB 2NY2C 2NX5B 4YK4B 1XF4A 3QG6B 1RUQH 4PLJC 4G8FB 4IEFB 3MACH 4HMEA 4QRPA 3QUML 3KPRD 3SKOB 4DGYL 3BHBA 2F5AH 5IEHA 2J8OA 3BEWB 2XWTB 3GB7B 3G5VB 4ETQA 4NHCH 4UDUA 4YR6B 1MQ8A 4N8CL 3KJ4C 3PG2A 1T7VA 5FUCC 4LARH 3X14A 2BOCA 4JAMA 3PQYE 5D5MF 4MLIA 1QUNA 2YSSA 1F13A 2VL5B 3WUXA 1QVOA 1ADQL 5F8QC 4HLZG 4PJAA 3O41B 1V3LA 2QQLL 4IRJA 3CNKA 1RJZB 1KEGL 3RZCC 1EK3A 4O58H 4W70A 2K7QA 2H1PL 4Y19B 3UJIH 2GCYB 1GAFL 4G6FD 5FUOL 1INEH 5SWZD 2FGWH 4KKLD 3P3YA 1RURL 4M7KH 4ALAH 3ULVH 2HMIC 1W0YT 3GHEH 4FQQB 5E4EC 5F6IC 3X12A 3ZYOA 5KVFH 4LVOB 4WHDA 2OXHA 4N0FB 4PJAF 5F1IB 4X6CA 4KKAD 3CFEA 5C0JA 4L8CB 3PHQB 4YDJA 4N90E 3VXPB 3BQUC 4IDLA 1MI5E 1JNHA 3MYZA 3WFDH 3UBXI 4KHTL 1A6TA 2BDNH 4XPBL 3HC3H 5IB1B 4IDJL 5J6GA 3KLAA 4P23C 2IAND 2XQBL 1BIIB 2IH3B 1H54A 3O3BA 4LVNB 4Z7QF 5KVGL 4HH9B 1F90L 1N64H 4JQXC 3QT2A 5DRXB 3QUKB 1HOCA 3Q6GH 4JFQA 1T0NB 4M5ZH 3N85L 5D2NA 3KPPB 1B9ZA 4NQCE 4OLZH 4QTHA 2V2XA 4X6CF 3F62A 5E5UB 2XI9A 2FLRT 3ARFD 3T4AB 1OWWA 4WI4A 3SDCD 3JV4B 3TT1L 1AY1L 4IMKA 1KWFA 3V4VH 3RUGB 3B83A 1QTYT 2I5YH 2E7LC 1IAIL 3QJFA 3OHXB 3L5XH 5LBSL 4LOUC 7FABL 4KGJA 4G5ZL 4OI9A 5AG8A 4QRUB 1S9WB 3SQOH 3RWCB 2UY7A 5FOBB 4DCQA 4KXZI 5CJXC 2EYSB 2HVKA 5HPOA 4J3SA 3Q6FB 5B8CB 3IXAB 4Y4FA 3VE0A 4AG4H 1LE9A 1GA2A 4IS6B 4PBWD 5JA8B 3MV7A 2OX5A 4J7RA 1WBYA 1INDL 1WUNT 3BKML 3L9RA 5D96C 4EJ1C 3CZFA 4M48H 5HYIA 4M43L 4NNPL 3LKPB 3OKNA 4LSUH 4Q88A 3HAEH 3QWRA 4F9LA 2E7BA 4L4JA 4EDXA 5ESAB 1DLFL 1T20B 3U0PB 2FV0A 4I18B 1EV2E 4Y5YC 3TBYB 1FG2A 4Z4JA 4W4OA 5HHXL 1XGTA 3QRGL 6FABH 2D03L 1N2RA 3F7PC 5FYKE 1HILB 4ZTOL 4P5KA 1CD0A 5AZEL 1G9EA 2XTLA 4XAWH 4PY7B 1S9VA 3STLA 5ERWB 1A7PL 2PYED 5JIHA 3KLHD 1DQDH 2C3HA 3BWUC 4HWBL 2DWDA 3IDXH 4YLQT 3GRWA 4GQ9L 4GW4A 3P4MB 4OZFB 1U6AH 3ALXA 3UO1L 5I1IH 2XOTA 3W82A 5T5NF 3VGGA 2NY7L 2R9HD 4Y5VC 1FL3B 2X70A 2VXTL 2XN9A 1DDHB 1JP5A 4R2GB 2D7PA 1QSZA 3DXAA 1MVFA 1A1MB 1KIQB 3S7GA 3CSPA 5KSUA 5CP7A 1YQVH 4NYLB 5CD5C 1T7ZA 2O61B 3P9MB 3PDGA 4WNQA 5CEZD 1QRNB 1NAKH 1HXMA 5A3ID 1R24A 5DDHB 1C5DB 3IJSA 3GSOB 1NFDA 4KI5D 4XP4L 4JPKL 5AZ2H 5KBNC 3MRMB 1R3IH 1Z9LA 1OP5H 2V2TA 4J1UB 3U0TB 4LCWB 2X4NB 1DANU 4G6AC 5DR5H 3RWIA 1ED3B 1S7RA 1AQDB 3JV6A 4ZFZA 4HULB 4G6JL 1OP3H 2F54E 2P49B 3CDFA 1BLNB 4FFZH 5CKAA 3BGFB 3F7YA 5CMAB 3IDYB 3BKYL 2OL3A 3U9UB 4FQLL 1D5ZA 1NFDF 4EBQH 5BVPH 1T4KA 2DWEB 3CSGA 2GJJA 4XNYL 3C08H 3U9PL 1UZ8A 3N0PB 1EAPA 1OTSD 4KKAC 5MEOB 2V7HB 4RNRA 5EC2A 3QFZA 1MPAH 5FHBH 2YPLD 1AQKH 3LHPH 4N8VB 3GDBA 1WK0A 1IFHL 2X2YA 1X5LA 1JTOA 1GZQB 1H3TA 3CDGA 4GG8A 2WBJD 4HLJA 5IESH 1F4WH 5ELIA 5I15L 1WCBA 1OTUC 3BPCA 5TQ0L 1FRGL 3GMOB 1U8MB 1CQYA 3QDEA 4NJAH 1OAYL 2FEEL 3ARXA 2PO6A 4PJCB 2IAMA 4MDJA 2CPCA 4OLUH 5HHMB 3O6LH 5C0AA 4LHUD 1J87A 3S3JA 1MCRA 4U7MA 3TM6A 5M95B 4XVTH 3QUXD 2ZUTA 3SDCC 1KNOA 1HSBA 3HUJA 1M7DA 3OX8B 1OAQL 4BH8B 1C5BL 4PTUB 1G7PA 3QNYB 4DN3L 5C0EA 1BJ8A 3BP7B 5DRNB 4G6KH 2ITCB 2IBZY 3K11A 3UTZB 3TYFB 4HWNA 1BMGA 2Z07A 1AGDB 2UWEB 4CNIB 3D3VE 1JV5B 4M61B 2B4CH 4DZBB 4WY7H 1FGVL 1NUNB 1VEPA 1J5OH 3P4OB 2Y4SA 4QHKI 2VXUH 1FZMB 3HUJF 2XRAL 1OT1A 4Y2DC 2GSGA 5K9OB 5A43C 3CIQA 4OD2B 3G08B 3STZA 3M17B 4HGWB 3CFKA 1S7UB 4MD5A 4RISL 1RVFL 1ZLVH 3V6FB 4F80A 3QG6A 5D7IA 4LEOA 4G8FA 2NTSP 1U9KA 3CCHA 1W0VB 3N1QC 4ZH5A 4K2UH 2HKFH 3BZFB 2XA8L 1MFDH 2YHGA 4MJ4A 4MXWH 3NACL 3KLHC 1I7TA 4JN1H 4MNQA 3WIIH 2ZUWA 4DKEL 2XXCB 1OGAB 4A6YB 5EN2A 1KTKE 5F97E 2DQEH 3U7WH 5IV2B 5DEZA 4KRPD 5HVWA 5CJOL 2R9HC 3X13B 1ZTXH 2IFFH 1MIML 2JJBA 3ARTA 5L8LB 5D7IF 3LOWA 3SKUD 5T3ZH 3PHSA 1P7KA 1UM6H 1BD2A 2D9CA 3T2PA 5I8KH 2BMKB 4NUJA 5DS8B 5A3IC 2C4XA 2MHAA 4ZFGH 1AO7D 2P47B 3T1WA 3PL6C 1M71A 5F1IA 4P5TA 3MV9E 4LLYA 4LLVA 4Y4HD 5JOFB 1XT5A 4NHUA 5EIIA 2ZUXA 4W68A 3L5WB 4QF1B 4HGKC 1A7OH 5IB1A 3VGBA 1NMCB 1LILA 3CK0L 1NPUA 1RJLA 2V17L 4X7SH 3O4LA 1YMHA 4UOJA 1R5IB 1C16B 3MRPA 1T0PB 5IK3B 2P5WE 3GJEB 1D9KC 2Q76A 1EFXA 2VDRH 1RHHA 4NC1C 3NCCB 1OTSC 1XZ0A 2FIKA 4ELKB 2H41A 5IBTH 3DX8A 1E6OH 4YIQB 4PG2A 3T4AA 4Q7DA 5LAXB 3KPRB 4ZXBD 5I1GH 3RUGA 1YECH 4ZPVB 4Y4KC 3MGOB 2YD8A 4MJIA 3U30C 1CDCA 1GGTA 4PYHA 1S9WA 2J5LB 5JHDE 1N59B 4K71B 3VGFA 3GRWH 5FECB 4HPOH 5IBUG 1WT5C 3Q6FA 4YHIB 3ARQA 2Z35A 4NKOB 4YJZL 4JRYA 4YC2B 2R1YB 3QUXC 3EKCA 5A2JH 1T1WB 2FBOJ 3HR5B 1CIDA 4LPUA 3SDYL 3N1PC 1A21A 3MBEB 3DECA 3LIZL 5K33A 4DKFL 4BSWA 3PWNA 3WD5H 5CAYB 3RUGF 4PRPE 1DLHB 3VD9A 1FNFA 3N06B 4P4KD 5I16B 1WFUA 5FGBC 3UMTA 5D7LD 1UJ3B 4MXVF 1EHXA 3FMGL 1JPST 2ARJA 2OLDA 3NCJL 4YFLF 1WFNA 1T0MB 2VISB 1L1YA 4QHNB 1CVRA 3TCXA 4PRHE 5TQ2H 5B21A 5TE6H 1MFEL 3I6LE 3EFDL 3RWJA 2WIIA 3MRCB