3DSSB

Crystal structure of rabggtase(delta lrr; delta ig)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
327
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 118
structure length 327
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dssB00
4BOKA 1H3AA 1KZOB 2V8KA 2XWJB 4M76A 2H6HB 2I07B 1JCSB 1W6JA 4LNBB 1LTXB 1TN8B 3EUVB 2IEJB 3HXCB 3SFYB 3E30B 2A73B 2PMVA 5JPMB 1GXOA 1W6KA 1O6HA 1SA5B 1SA4B 1NI1B 1TN7B 3DSVB 3HXFB 3KQ4A 4YDEB 1QSJA 1R76A 1NL4B 4L9PB 4LNGB 4V1SA 1N95B 4ONTA 4BOJA 3Q7AB 1H35A 4C1SA 4ZRPA 3DPYB 1FPPB 1N4QB 1N4SB 4GTQB 1TNOB 3Q73B 1S63B 1D8DB 3OEDA 1QBQB 1GXMA 2XWBB 1O6RA 4GTPB 4D4CA 1H37A 2XQWA 1GXNA 3DSXB 4GTVB 1O5MB 3PZ4B 1O1SB 2WINB 1JCQB 1N9AB 4V1RA 1UMPA 1H3BA 1LD8B 4GTOB 3E32B 4FXKB 5AGDA 1H36A 2WY7A 2V8IA 1SQCA 2BB6A 4FXGB 3Q79B 1TNYB 1QQFA 3E33B 1N4RB 1DCEB 3SQCA 1FT1B 3G6JB 2H6FB 1HZFA 2ZIRB 4GTMB 3EU5B 4D4AA 3PZ3B 4D4DA 3OXUA 5FO9B 4ZH1A 1LD7B 3E34B 2V8JA 3K7XA 4KKIA 2G02A 3Q78B 1O79A 1JCRB 1N4PB 1O1TB 2B39A 3KSLB 4LNVA 5FO8B 1GSZA 2ZISB 1S64B 3Q7FB 1KZPB 4D94A 5JPNB 5FO7B 1MZCB 1D8EB 4D4BA 3DSWB 3KSQB 4KKJA 3CU7A 1C3DA 1X81B 3DSSB 3HXEB 3D5RA 2BBCA 2V3NA 1TNZB 5FOBB 2H6IB 3C72B 4GTSB 4MU9A 4GTTB 3KLSA 3RJ3A 3PZ1B 3D5SA 2H6GB 2NOJA 2R2LB 4ZRQA 3E37B 2SQCA 1O6QA 2G0DA 2WIIB 4GTRB 3DRAB 3PZ2B 3DSTB 1TNBB 3Q75B 1H39A 2BEDB 2BB5A 3HXDB 3SFXB 2WY8A 1TN6B 1GHQA 3HXBB 2PN5A 2F0YB 4YDOB 4EHMB 1H3CA 1O1RB 2GOXA 1FT2B 1N94B 2V3PA 3DSUB 1TNUB 4MBGB
chains in the Genus database with same CATH superfamily
1AGMA 4BOKA 1N1ZA 3ACSA 4LNBB 3QFZA 3EUVB 3VSMA 5EATA 1I8QA 1G9GA 1GXOA 1W6KA 1HXAA 4OZVA 3CIHA 3DSVB 3WKGA 1X9DA 1IA7A 4LNGB 4L9PB 4V1SA 1N95B 4ONTA 1H35A 4ZRPA 3Q73B 1S63B 1HXGA 1QBQB 1HMUA 2RI8A 3M74A 3SDVA 1JCQB 1N9AB 1UMPA 1LD8B 3WIWA 3E32B 1N7RA 2NVPA 2ZZRA 3G4FA 1SQCA 2BB6A 1RWHA 4FXGB 4TF4A 1TNYB 2H6FB 4MMIA 5CD2A 1OJPA 3EU5B 3WC3A 4CE7A 5MEHA 5ILKA 4D4DA 5FO9B 3QRYA 1V7XA 4WVBA 4ZH1A 1N23A 2V8JA 4KKIA 1KRFA 5ILHA 3P5PA 1N22A 5FO8B 1GSZA 1XWTA 3Q7FB 3NFVA 5JPNB 5ILIA 5FO7B 3E7JA 5IK6A 1MZCB 3T33A 3RENA 1GAIA 5ILYA 3M00A 4AYPA 4DOEA 2ZBLA 1HM2A 3DSSB 3X17A 3K11A 1HM3A 4GTSB 3A3VA 3KLSA 1N21A 5CZLA 2DRQA 4OZWA 2SQCA 2WIIB 5IKAA 3M7EA 1KSCA 1CB8A 1FO3A 1TNBB 5EASA 1N24A 1H39A 3SDRA 2AHGA 3W7SA 1UT9A 1TN6B 1GHQA 3HXBB 3M01A 3NNBA 4EHMB 1O1RB 2ONHA 4XUVA 4J5TA 2D8LA 2Q1FA 1H3AA 1J0MA 3WIQA 3WIRA 5JMDA 2I07B 1JCSB 4DODA 2X03A 3WKIA 4ZG8A 3HXCB 1KSDA 5IM1A 3SFYB 4E1YA 1GLMA 5JPMB 2B4FA 1O6HA 1V5CA 3M7CA 1SA5B 3RX5A 1WU6A 4MMHA 1R76A 3Q7AB 4EL8A 3W7TA 1H54A 1FPPB 1XW2A 3H2WA 3OEDA 3GZKA 1HCUA 4GTVB 4F13A 2EAEA 5ILJA 1KS8A 4V1RA 4Q88A 2WY7A 2V8IA 4JJJA 1LF6A 3ANIA 1FBWA 1QQFA 3SQCA 1FT1B 1HZFA 4GTMB 4D4AA 4NEIA 5M7IA 3AFJA 2VN4A 3E34B 3TF4A 2G02A 2BRWA 3Q78B 2JG0A 4LNVA 1G9JA 1O1TB 3KSLB 4AYRA 3W5MA 4KTRA 1FAEA 2FUTA 1N1BA 4D94A 5KKBA 1K72A 5E2JA 4AYQA 3WKHA 2J5CA 3M72A 3SAEA 4WU0A 1C3DA 1LXKA 1RWCA 1H13A 4DI5A 5DHKA 3D5RA 5DHIA 1HMWA 1TNZB 3E73A 2P0VA 2H6IB 3RSYA 4MU9A 1RQ5A 4GTTB 3EQAA 4FUSA 2DRSA 3D5SA 1ULVA 1XWQA 2NOJA 4ZH5A 3E37B 3S4DA 3PMMA 4QT9A 4GTRB 1DOGA 3DRAB 2JF4A 3DSTB 3PYBA 3ON6A 3H3KA 2BEDB 3QWTA 3SFXB 1WZZA 2PN5A 3M71A 3RX8A 5C05A 4YDOB 3S9VA 2D5JA 2V3PA 1HN0A 4M76A 1KZOB 2XWJB 1W6JA 3W7UA 2QNOA 2IEJB 1V7VA 5IK0A 2FV1A 1NI1B 3KQ4A 1X1IA 4YDEB 2OKXA 3P2CA 1NL4B 2DROA 3S4BA 4BOJA 3M7BA 5IL3A 3RRSA 3DPYB 1RWAA 1N4SB 1TNOB 1GXMA 2XWBB 5ILDA 4GTPB 1V5DA 2WDAA 1GXNA 1OJNA 3DSXB 2YIKA 1N7PA 1H12A 1O1SB 1O5MB 3M78A 2WINB 3W7XA 3QSPA 1VD5A 2FBAA 4L6XA 5GW7A 1H3BA 3EU8A 2VN7A 4AYOA 4FXKB 1L1YA 1V7WA 1HXCA 1OJMA 1LF9A 4OK2A 3ACTA 1WU4A 3Q79B 1JS4A 3SDTA 1N4RB 3G6JB 5EAUA 2ZIRB 3PYAA 3QDEA 2FUQA 1UG9A 4TXTA 1QAZA 3M02A 5JMFA 3ANKA 5IKHA 4LIXA 3K7XA 3N0FA 3AFLA 1FO2A 1N4PB 2CQSA 1X1JA 3VW5A 2ZISB 1S64B 1J0NA 3S4CA 1KZPB 2AHFA 1G87A 2RGKA 2WCOA 1GA2A 4L0GA 4Z4LA 3DSWB 5CA3A 3KSQB 1X81B 5DGRA 4WVCA 1L2AA 3W7WA 1F9GA 3HXEB 5M7YA 2EACA 4WVAA 5FOBB 1WU5A 3VSNA 1C82A 3PZ1B 4OK4A 1IA6A 2AFAA 2H6GB 2R2LB 2E24A 1G6IA 4ZRQA 2E22A 4F10A 3PZ2B 3Q75B 4FNVA 4Z4JA 2BB5A 4GAXA 3HXDB 2WY8A 3P5RA 4CJ0A 2GH4A 1OJOA 3A0OA 2F0YB 3G4DA 1H3CA 2GOXA 1FT2B 3DSUB 1TNUB 4RNQA 3EZ8A 2V8KA 1F9OA 1TF4A 2H6HB 1N20A 1LTXB 2A8ZA 1TN8B 2BRVX 3M75A 2Z07A 2EABA 2BRPA 4Q2BA 3E30B 2A73B 2PMVA 1FMIA 3M77A 1F1SA 3VXDA 3RX7A 5ILZA 1SA4B 1NC5A 1TN7B 3HXFB 1QSJA 1KREA 1F9DA 2GZ6A 4C1SA 2DRRA 3SDUA 1N4QB 4GTQB 1D8DB 3ANJA 1O6RA 1LOHA 2CQTA 3QXFA 4D4CA 3W5NA 1H37A 1W3YA 2XQWA 3PZ4B 1GAHA 1H14A 3QXQA 1CLCA 4GTOB 3QFYA 3E80A 5AGDA 1H36A 3QT9A 3GT5A 3D3IA 3M73A 2WYNA 2EADA 3E33B 1DCEB 1FP3A 2JJBA 3S4AA 1N7OA 4GL3A 1NXCA 4KTPA 3LZ9A 5GZKA 4OJZA 2ONGA 3PZ3B 2F6DA 3OXUA 2RI9A 1LD7B 2FV0A 4CJ1A 1EGUA 3SDQA 3WUXA 1O79A 1JCRB 3QPFA 2B39A 5IL8A 1LXMA 1DL2A 1KKTA 3QT3A 1D8EB 1HV6A 1HX9A 4D4BA 4KKJA 3CU7A 3N0GA 2BBCA 2V3NA 3C72B 1KWFA 1N7NA 3M7LA 1RWFA 3RJ3A 1FCEA 3WKFA 3GLYA 5IK9A 3E6UA 1O6QA 1KFGA 2G0DA 1X1HA 1AYXA 3QG0A 5GY3A 4FJQA 4YCRA 1FBOA 2XFGA 3H7LA 1CEMA 2FUZA 1IS9A 5DGQA 1RWGA 1N94B 1RW9A 3M76A 1N7QA 4MBGB
chains in the Genus database with same CATH topology
1AGMA 4BOKA 3ACSA 4LNBB 3QFZA 3EUVB 1G9GA 1GXOA 1W6KA 3CIHA 3DSVB 3WKGA 1X9DA 1IA7A 4LNGB 4L9PB 4V1SA 1N95B 4ONTA 1H35A 4ZRPA 3Q73B 1S63B 1QBQB 2RI8A 3M74A 3SDVA 1JCQB 1N9AB 1UMPA 1LD8B 3WIWA 3E32B 2NVPA 2ZZRA 1SQCA 2BB6A 4FXGB 4TF4A 1TNYB 2H6FB 5CD2A 3EU5B 3WC3A 4CE7A 5MEHA 4D4DA 5FO9B 3QRYA 1V7XA 4WVBA 4ZH1A 2V8JA 4KKIA 1KRFA 3P5PA 5FO8B 1GSZA 1XWTA 3Q7FB 5JPNB 5FO7B 3T33A 1MZCB 3RENA 1GAIA 4AYPA 4DOEA 2ZBLA 3DSSB 3X17A 3K11A 4GTSB 3A3VA 3KLSA 5CZLA 2DRQA 2SQCA 2WIIB 3M7EA 1KSCA 1FO3A 1TNBB 3SDRA 1H39A 2AHGA 3W7SA 1UT9A 1TN6B 1GHQA 3HXBB 4EHMB 1O1RB 4XUVA 4J5TA 2D8LA 3WIQA 1H3AA 3WIRA 2I07B 1JCSB 4DODA 3WKIA 4ZG8A 3HXCB 1KSDA 3SFYB 1GLMA 5JPMB 2B4FA 1O6HA 1V5CA 3M7CA 1SA5B 3RX5A 1WU6A 1R76A 3Q7AB 4EL8A 3W7TA 1H54A 1FPPB 1XW2A 3H2WA 3OEDA 3GZKA 1HCUA 4GTVB 2EAEA 1KS8A 4V1RA 4Q88A 2WY7A 2V8IA 4JJJA 1LF6A 3ANIA 1FBWA 1QQFA 3SQCA 1FT1B 1HZFA 4GTMB 4D4AA 5M7IA 3AFJA 2VN4A 3E34B 3TF4A 2G02A 3Q78B 2JG0A 4LNVA 1G9JA 1O1TB 3KSLB 4AYRA 3W5MA 4KTRA 1FAEA 4D94A 5KKBA 1K72A 5E2JA 4AYQA 3WKHA 3M72A 3SAEA 4WU0A 1C3DA 1H13A 3D5RA 3E73A 1TNZB 2P0VA 2H6IB 3RSYA 4MU9A 1RQ5A 4GTTB 3EQAA 4FUSA 2DRSA 3D5SA 1ULVA 1XWQA 2NOJA 4ZH5A 3E37B 3S4DA 3PMMA 4QT9A 4GTRB 1DOGA 3DRAB 2JF4A 3DSTB 3PYBA 3ON6A 3H3KA 2BEDB 3QWTA 3SFXB 1WZZA 2PN5A 3M71A 3RX8A 4YDOB 3S9VA 2D5JA 2V3PA 4M76A 1KZOB 2XWJB 1W6JA 3W7UA 2QNOA 2IEJB 1V7VA 2FV1A 1NI1B 3KQ4A 2OKXA 4YDEB 3P2CA 1NL4B 2DROA 3S4BA 4BOJA 3M7BA 3RRSA 3DPYB 1N4SB 1TNOB 1GXMA 2XWBB 4GTPB 1V5DA 1GXNA 2YIKA 3DSXB 3W7XA 1O5MB 1H12A 1O1SB 3M78A 2WINB 3QSPA 1VD5A 2FBAA 4L6XA 5GW7A 1H3BA 3EU8A 2VN7A 4AYOA 4FXKB 1L1YA 1V7WA 1LF9A 3ACTA 3Q79B 1WU4A 1JS4A 3SDTA 1N4RB 3G6JB 2ZIRB 3PYAA 3QDEA 1UG9A 4TXTA 3ANKA 4LIXA 3K7XA 1FO2A 1N4PB 2CQSA 3VW5A 2ZISB 1S64B 3S4CA 1KZPB 2AHFA 1G87A 2RGKA 1GA2A 4L0GA 4Z4LA 3DSWB 5CA3A 3KSQB 1X81B 5DGRA 4WVCA 1L2AA 3W7WA 3HXEB 5M7YA 2EACA 4WVAA 5FOBB 1WU5A 3PZ1B 1IA6A 2AFAA 2H6GB 2R2LB 1G6IA 4ZRQA 3PZ2B 3Q75B 4Z4JA 2BB5A 3HXDB 2WY8A 3P5RA 4CJ0A 2GH4A 2F0YB 1H3CA 2GOXA 1FT2B 3DSUB 1TNUB 3EZ8A 2V8KA 1F9OA 1TF4A 2H6HB 1LTXB 2A8ZA 1TN8B 3M75A 2Z07A 2EABA 4Q2BA 3E30B 2A73B 2PMVA 1FMIA 3M77A 3VXDA 3RX7A 1SA4B 1NC5A 1TN7B 3HXFB 1QSJA 1KREA 1F9DA 2GZ6A 4C1SA 2DRRA 3SDUA 1N4QB 4GTQB 1D8DB 3ANJA 1O6RA 2CQTA 3QXFA 4D4CA 3W5NA 1H37A 2XQWA 3PZ4B 1GAHA 1H14A 3QXQA 1CLCA 4GTOB 3QFYA 5AGDA 1H36A 3QT9A 3GT5A 3D3IA 3M73A 2WYNA 2EADA 3E33B 1DCEB 1FP3A 2JJBA 3S4AA 4GL3A 1NXCA 4KTPA 5GZKA 3PZ3B 2F6DA 3OXUA 2RI9A 1LD7B 2FV0A 4CJ1A 3SDQA 3WUXA 1O79A 3QPFA 2B39A 1DL2A 1KKTA 3QT3A 1D8EB 4D4BA 4KKJA 3CU7A 2BBCA 2V3NA 3C72B 1KWFA 3M7LA 3RJ3A 1FCEA 3WKFA 3GLYA 3E6UA 1O6QA 1KFGA 2G0DA 1AYXA 3QG0A 5GY3A 4YCRA 1FBOA 2XFGA 3H7LA 1CEMA 2FUZA 1IS9A 5DGQA 1N94B 3M76A 1JCRB 4MBGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOK A;  1H3A A;  1KZO B;  2V8K A;  2XWJ B;  4M76 A;  2H6H B;  2I07 B;  1JCS B;  1W6J A;  4LNB B;  1LTX B;  1TN8 B;  3EUV B;  2IEJ B;  3HXC B;  3SFY B;  3E30 B;  2A73 B;  2PMV A;  5JPM B;  1GXO A;  1W6K A;  1O6H A;  1SA5 B;  1SA4 B;  1NI1 B;  1TN7 B;  3DSV B;  3HXF B;  3KQ4 A;  4YDE B;  1QSJ A;  1R76 A;  1NL4 B;  4L9P B;  4LNG B;  4V1S A;  1N95 B;  4ONT A;  4BOJ A;  3Q7A B;  1H35 A;  4C1S A;  4ZRP A;  3DPY B;  1FPP B;  1N4Q B;  1N4S B;  4GTQ B;  1TNO B;  3Q73 B;  1S63 B;  1D8D B;  3OED A;  1QBQ B;  1GXM A;  2XWB B;  1O6R A;  4GTP B;  4D4C A;  1H37 A;  2XQW A;  1GXN A;  3DSX B;  4GTV B;  1O5M B;  3PZ4 B;  1O1S B;  2WIN B;  1JCQ B;  1N9A B;  4V1R A;  1UMP A;  1H3B A;  1LD8 B;  4GTO B;  3E32 B;  4FXK B;  5AGD A;  1H36 A;  2WY7 A;  2V8I A;  1SQC A;  2BB6 A;  4FXG B;  3Q79 B;  1TNY B;  1QQF A;  3E33 B;  1N4R B;  1DCE B;  3SQC A;  1FT1 B;  3G6J B;  2H6F B;  1HZF A;  2ZIR B;  4GTM B;  3EU5 B;  4D4A A;  3PZ3 B;  4D4D A;  3OXU A;  5FO9 B;  4ZH1 A;  1LD7 B;  3E34 B;  2V8J A;  3K7X A;  4KKI A;  2G02 A;  3Q78 B;  1O79 A;  1JCR B;  1N4P B;  1O1T B;  2B39 A;  3KSL B;  4LNV A;  5FO8 B;  1GSZ A;  2ZIS B;  1S64 B;  3Q7F B;  1KZP B;  4D94 A;  5JPN B;  5FO7 B;  1MZC B;  1D8E B;  4D4B A;  3DSW B;  3KSQ B;  4KKJ A;  3CU7 A;  1C3D A;  1X81 B;  3DSS B;  3HXE B;  3D5R A;  2BBC A;  2V3N A;  1TNZ B;  5FOB B;  2H6I B;  3C72 B;  4GTS B;  4MU9 A;  4GTT B;  3KLS A;  3RJ3 A;  3PZ1 B;  3D5S A;  2H6G B;  2NOJ A;  2R2L B;  4ZRQ A;  3E37 B;  2SQC A;  1O6Q A;  2G0D A;  2WII B;  4GTR B;  3DRA B;  3PZ2 B;  3DST B;  1TNB B;  3Q75 B;  1H39 A;  2BED B;  2BB5 A;  3HXD B;  3SFX B;  2WY8 A;  1TN6 B;  1GHQ A;  3HXB B;  2PN5 A;  2F0Y B;  4YDO B;  4EHM B;  1H3C A;  1O1R B;  2GOX A;  1FT2 B;  1N94 B;  2V3P A;  3DSU B;  1TNU B;  4MBG B; 
#chains in the Genus database with same CATH topology
 1AGM A;  4BOK A;  1N1Z A;  3ACS A;  4LNB B;  3QFZ A;  3EUV B;  3VSM A;  5EAT A;  1I8Q A;  1G9G A;  1GXO A;  1W6K A;  1HXA A;  4OZV A;  3CIH A;  3DSV B;  3WKG A;  1X9D A;  1IA7 A;  4LNG B;  4L9P B;  4V1S A;  1N95 B;  4ONT A;  1H35 A;  4ZRP A;  3Q73 B;  1S63 B;  1HXG A;  1QBQ B;  1HMU A;  2RI8 A;  3M74 A;  3SDV A;  1JCQ B;  1N9A B;  1UMP A;  1LD8 B;  3WIW A;  3E32 B;  1N7R A;  2NVP A;  2ZZR A;  3G4F A;  1SQC A;  2BB6 A;  1RWH A;  4FXG B;  4TF4 A;  1TNY B;  2H6F B;  4MMI A;  5CD2 A;  1OJP A;  3EU5 B;  3WC3 A;  4CE7 A;  5MEH A;  5ILK A;  4D4D A;  5FO9 B;  3QRY A;  1V7X A;  4WVB A;  4ZH1 A;  1N23 A;  2V8J A;  4KKI A;  1KRF A;  5ILH A;  3P5P A;  1N22 A;  5FO8 B;  1GSZ A;  1XWT A;  3Q7F B;  3NFV A;  5JPN B;  5ILI A;  5FO7 B;  3E7J A;  5IK6 A;  1MZC B;  3T33 A;  3REN A;  1GAI A;  5ILY A;  3M00 A;  4AYP A;  4DOE A;  2ZBL A;  1HM2 A;  3DSS B;  3X17 A;  3K11 A;  1HM3 A;  4GTS B;  3A3V A;  3KLS A;  1N21 A;  5CZL A;  2DRQ A;  4OZW A;  2SQC A;  2WII B;  5IKA A;  3M7E A;  1KSC A;  1CB8 A;  1FO3 A;  1TNB B;  5EAS A;  1N24 A;  1H39 A;  3SDR A;  2AHG A;  3W7S A;  1UT9 A;  1TN6 B;  1GHQ A;  3HXB B;  3M01 A;  3NNB A;  4EHM B;  1O1R B;  2ONH A;  4XUV A;  4J5T A;  2D8L A;  2Q1F A;  1H3A A;  1J0M A;  3WIQ A;  3WIR A;  5JMD A;  2I07 B;  1JCS B;  4DOD A;  2X03 A;  3WKI A;  4ZG8 A;  3HXC B;  1KSD A;  5IM1 A;  3SFY B;  4E1Y A;  1GLM A;  5JPM B;  2B4F A;  1O6H A;  1V5C A;  3M7C A;  1SA5 B;  3RX5 A;  1WU6 A;  4MMH A;  1R76 A;  3Q7A B;  4EL8 A;  3W7T A;  1H54 A;  1FPP B;  1XW2 A;  3H2W A;  3OED A;  3GZK A;  1HCU A;  4GTV B;  4F13 A;  2EAE A;  5ILJ A;  1KS8 A;  4V1R A;  4Q88 A;  2WY7 A;  2V8I A;  4JJJ A;  1LF6 A;  3ANI A;  1FBW A;  1QQF A;  3SQC A;  1FT1 B;  1HZF A;  4GTM B;  4D4A A;  4NEI A;  5M7I A;  3AFJ A;  2VN4 A;  3E34 B;  3TF4 A;  2G02 A;  2BRW A;  3Q78 B;  2JG0 A;  4LNV A;  1G9J A;  1O1T B;  3KSL B;  4AYR A;  3W5M A;  4KTR A;  1FAE A;  2FUT A;  1N1B A;  4D94 A;  5KKB A;  1K72 A;  5E2J A;  4AYQ A;  3WKH A;  2J5C A;  3M72 A;  3SAE A;  4WU0 A;  1C3D A;  1LXK A;  1RWC A;  1H13 A;  4DI5 A;  5DHK A;  3D5R A;  5DHI A;  1HMW A;  1TNZ B;  3E73 A;  2P0V A;  2H6I B;  3RSY A;  4MU9 A;  1RQ5 A;  4GTT B;  3EQA A;  4FUS A;  2DRS A;  3D5S A;  1ULV A;  1XWQ A;  2NOJ A;  4ZH5 A;  3E37 B;  3S4D A;  3PMM A;  4QT9 A;  4GTR B;  1DOG A;  3DRA B;  2JF4 A;  3DST B;  3PYB A;  3ON6 A;  3H3K A;  2BED B;  3QWT A;  3SFX B;  1WZZ A;  2PN5 A;  3M71 A;  3RX8 A;  5C05 A;  4YDO B;  3S9V A;  2D5J A;  2V3P A;  1HN0 A;  4M76 A;  1KZO B;  2XWJ B;  1W6J A;  3W7U A;  2QNO A;  2IEJ B;  1V7V A;  5IK0 A;  2FV1 A;  1NI1 B;  3KQ4 A;  1X1I A;  4YDE B;  2OKX A;  3P2C A;  1NL4 B;  2DRO A;  3S4B A;  4BOJ A;  3M7B A;  5IL3 A;  3RRS A;  3DPY B;  1RWA A;  1N4S B;  1TNO B;  1GXM A;  2XWB B;  5ILD A;  4GTP B;  1V5D A;  2WDA A;  1GXN A;  1OJN A;  3DSX B;  2YIK A;  1N7P A;  1H12 A;  1O1S B;  1O5M B;  3M78 A;  2WIN B;  3W7X A;  3QSP A;  1VD5 A;  2FBA A;  4L6X A;  5GW7 A;  1H3B A;  3EU8 A;  2VN7 A;  4AYO A;  4FXK B;  1L1Y A;  1V7W A;  1HXC A;  1OJM A;  1LF9 A;  4OK2 A;  3ACT A;  1WU4 A;  3Q79 B;  1JS4 A;  3SDT A;  1N4R B;  3G6J B;  5EAU A;  2ZIR B;  3PYA A;  3QDE A;  2FUQ A;  1UG9 A;  4TXT A;  1QAZ A;  3M02 A;  5JMF A;  3ANK A;  5IKH A;  4LIX A;  3K7X A;  3N0F A;  3AFL A;  1FO2 A;  1N4P B;  2CQS A;  1X1J A;  3VW5 A;  2ZIS B;  1S64 B;  1J0N A;  3S4C A;  1KZP B;  2AHF A;  1G87 A;  2RGK A;  2WCO A;  1GA2 A;  4L0G A;  4Z4L A;  3DSW B;  5CA3 A;  3KSQ B;  1X81 B;  5DGR A;  4WVC A;  1L2A A;  3W7W A;  1F9G A;  3HXE B;  5M7Y A;  2EAC A;  4WVA A;  5FOB B;  1WU5 A;  3VSN A;  1C82 A;  3PZ1 B;  4OK4 A;  1IA6 A;  2AFA A;  2H6G B;  2R2L B;  2E24 A;  1G6I A;  4ZRQ A;  2E22 A;  4F10 A;  3PZ2 B;  3Q75 B;  4FNV A;  4Z4J A;  2BB5 A;  4GAX A;  3HXD B;  2WY8 A;  3P5R A;  4CJ0 A;  2GH4 A;  1OJO A;  3A0O A;  2F0Y B;  3G4D A;  1H3C A;  2GOX A;  1FT2 B;  3DSU B;  1TNU B;  4RNQ A;  3EZ8 A;  2V8K A;  1F9O A;  1TF4 A;  2H6H B;  1N20 A;  1LTX B;  2A8Z A;  1TN8 B;  2BRV X;  3M75 A;  2Z07 A;  2EAB A;  2BRP A;  4Q2B A;  3E30 B;  2A73 B;  2PMV A;  1FMI A;  3M77 A;  1F1S A;  3VXD A;  3RX7 A;  5ILZ A;  1SA4 B;  1NC5 A;  1TN7 B;  3HXF B;  1QSJ A;  1KRE A;  1F9D A;  2GZ6 A;  4C1S A;  2DRR A;  3SDU A;  1N4Q B;  4GTQ B;  1D8D B;  3ANJ A;  1O6R A;  1LOH A;  2CQT A;  3QXF A;  4D4C A;  3W5N A;  1H37 A;  1W3Y A;  2XQW A;  3PZ4 B;  1GAH A;  1H14 A;  3QXQ A;  1CLC A;  4GTO B;  3QFY A;  3E80 A;  5AGD A;  1H36 A;  3QT9 A;  3GT5 A;  3D3I A;  3M73 A;  2WYN A;  2EAD A;  3E33 B;  1DCE B;  1FP3 A;  2JJB A;  3S4A A;  1N7O A;  4GL3 A;  1NXC A;  4KTP A;  3LZ9 A;  5GZK A;  4OJZ A;  2ONG A;  3PZ3 B;  2F6D A;  3OXU A;  2RI9 A;  1LD7 B;  2FV0 A;  4CJ1 A;  1EGU A;  3SDQ A;  3WUX A;  1O79 A;  1JCR B;  3QPF A;  2B39 A;  5IL8 A;  1LXM A;  1DL2 A;  1KKT A;  3QT3 A;  1D8E B;  1HV6 A;  1HX9 A;  4D4B A;  4KKJ A;  3CU7 A;  3N0G A;  2BBC A;  2V3N A;  3C72 B;  1KWF A;  1N7N A;  3M7L A;  1RWF A;  3RJ3 A;  1FCE A;  3WKF A;  3GLY A;  5IK9 A;  3E6U A;  1O6Q A;  1KFG A;  2G0D A;  1X1H A;  1AYX A;  3QG0 A;  5GY3 A;  4FJQ A;  4YCR A;  1FBO A;  2XFG A;  3H7L A;  1CEM A;  2FUZ A;  1IS9 A;  5DGQ A;  1RWG A;  1N94 B;  1RW9 A;  3M76 A;  1N7Q A;  4MBG B; 
#chains in the Genus database with same CATH homology
 1AGM A;  4BOK A;  3ACS A;  4LNB B;  3QFZ A;  3EUV B;  1G9G A;  1GXO A;  1W6K A;  3CIH A;  3DSV B;  3WKG A;  1X9D A;  1IA7 A;  4LNG B;  4L9P B;  4V1S A;  1N95 B;  4ONT A;  1H35 A;  4ZRP A;  3Q73 B;  1S63 B;  1QBQ B;  2RI8 A;  3M74 A;  3SDV A;  1JCQ B;  1N9A B;  1UMP A;  1LD8 B;  3WIW A;  3E32 B;  2NVP A;  2ZZR A;  1SQC A;  2BB6 A;  4FXG B;  4TF4 A;  1TNY B;  2H6F B;  5CD2 A;  3EU5 B;  3WC3 A;  4CE7 A;  5MEH A;  4D4D A;  5FO9 B;  3QRY A;  1V7X A;  4WVB A;  4ZH1 A;  2V8J A;  4KKI A;  1KRF A;  3P5P A;  5FO8 B;  1GSZ A;  1XWT A;  3Q7F B;  5JPN B;  5FO7 B;  3T33 A;  1MZC B;  3REN A;  1GAI A;  4AYP A;  4DOE A;  2ZBL A;  3DSS B;  3X17 A;  3K11 A;  4GTS B;  3A3V A;  3KLS A;  5CZL A;  2DRQ A;  2SQC A;  2WII B;  3M7E A;  1KSC A;  1FO3 A;  1TNB B;  3SDR A;  1H39 A;  2AHG A;  3W7S A;  1UT9 A;  1TN6 B;  1GHQ A;  3HXB B;  4EHM B;  1O1R B;  4XUV A;  4J5T A;  2D8L A;  3WIQ A;  1H3A A;  3WIR A;  2I07 B;  1JCS B;  4DOD A;  3WKI A;  4ZG8 A;  3HXC B;  1KSD A;  3SFY B;  1GLM A;  5JPM B;  2B4F A;  1O6H A;  1V5C A;  3M7C A;  1SA5 B;  3RX5 A;  1WU6 A;  1R76 A;  3Q7A B;  4EL8 A;  3W7T A;  1H54 A;  1FPP B;  1XW2 A;  3H2W A;  3OED A;  3GZK A;  1HCU A;  4GTV B;  2EAE A;  1KS8 A;  4V1R A;  4Q88 A;  2WY7 A;  2V8I A;  4JJJ A;  1LF6 A;  3ANI A;  1FBW A;  1QQF A;  3SQC A;  1FT1 B;  1HZF A;  4GTM B;  4D4A A;  5M7I A;  3AFJ A;  2VN4 A;  3E34 B;  3TF4 A;  2G02 A;  3Q78 B;  2JG0 A;  4LNV A;  1G9J A;  1O1T B;  3KSL B;  4AYR A;  3W5M A;  4KTR A;  1FAE A;  4D94 A;  5KKB A;  1K72 A;  5E2J A;  4AYQ A;  3WKH A;  3M72 A;  3SAE A;  4WU0 A;  1C3D A;  1H13 A;  3D5R A;  3E73 A;  1TNZ B;  2P0V A;  2H6I B;  3RSY A;  4MU9 A;  1RQ5 A;  4GTT B;  3EQA A;  4FUS A;  2DRS A;  3D5S A;  1ULV A;  1XWQ A;  2NOJ A;  4ZH5 A;  3E37 B;  3S4D A;  3PMM A;  4QT9 A;  4GTR B;  1DOG A;  3DRA B;  2JF4 A;  3DST B;  3PYB A;  3ON6 A;  3H3K A;  2BED B;  3QWT A;  3SFX B;  1WZZ A;  2PN5 A;  3M71 A;  3RX8 A;  4YDO B;  3S9V A;  2D5J A;  2V3P A;  4M76 A;  1KZO B;  2XWJ B;  1W6J A;  3W7U A;  2QNO A;  2IEJ B;  1V7V A;  2FV1 A;  1NI1 B;  3KQ4 A;  2OKX A;  4YDE B;  3P2C A;  1NL4 B;  2DRO A;  3S4B A;  4BOJ A;  3M7B A;  3RRS A;  3DPY B;  1N4S B;  1TNO B;  1GXM A;  2XWB B;  4GTP B;  1V5D A;  1GXN A;  2YIK A;  3DSX B;  3W7X A;  1O5M B;  1H12 A;  1O1S B;  3M78 A;  2WIN B;  3QSP A;  1VD5 A;  2FBA A;  4L6X A;  5GW7 A;  1H3B A;  3EU8 A;  2VN7 A;  4AYO A;  4FXK B;  1L1Y A;  1V7W A;  1LF9 A;  3ACT A;  3Q79 B;  1WU4 A;  1JS4 A;  3SDT A;  1N4R B;  3G6J B;  2ZIR B;  3PYA A;  3QDE A;  1UG9 A;  4TXT A;  3ANK A;  4LIX A;  3K7X A;  1FO2 A;  1N4P B;  2CQS A;  3VW5 A;  2ZIS B;  1S64 B;  3S4C A;  1KZP B;  2AHF A;  1G87 A;  2RGK A;  1GA2 A;  4L0G A;  4Z4L A;  3DSW B;  5CA3 A;  3KSQ B;  1X81 B;  5DGR A;  4WVC A;  1L2A A;  3W7W A;  3HXE B;  5M7Y A;  2EAC A;  4WVA A;  5FOB B;  1WU5 A;  3PZ1 B;  1IA6 A;  2AFA A;  2H6G B;  2R2L B;  1G6I A;  4ZRQ A;  3PZ2 B;  3Q75 B;  4Z4J A;  2BB5 A;  3HXD B;  2WY8 A;  3P5R A;  4CJ0 A;  2GH4 A;  2F0Y B;  1H3C A;  2GOX A;  1FT2 B;  3DSU B;  1TNU B;  3EZ8 A;  2V8K A;  1F9O A;  1TF4 A;  2H6H B;  1LTX B;  2A8Z A;  1TN8 B;  3M75 A;  2Z07 A;  2EAB A;  4Q2B A;  3E30 B;  2A73 B;  2PMV A;  1FMI A;  3M77 A;  3VXD A;  3RX7 A;  1SA4 B;  1NC5 A;  1TN7 B;  3HXF B;  1QSJ A;  1KRE A;  1F9D A;  2GZ6 A;  4C1S A;  2DRR A;  3SDU A;  1N4Q B;  4GTQ B;  1D8D B;  3ANJ A;  1O6R A;  2CQT A;  3QXF A;  4D4C A;  3W5N A;  1H37 A;  2XQW A;  3PZ4 B;  1GAH A;  1H14 A;  3QXQ A;  1CLC A;  4GTO B;  3QFY A;  5AGD A;  1H36 A;  3QT9 A;  3GT5 A;  3D3I A;  3M73 A;  2WYN A;  2EAD A;  3E33 B;  1DCE B;  1FP3 A;  2JJB A;  3S4A A;  4GL3 A;  1NXC A;  4KTP A;  5GZK A;  3PZ3 B;  2F6D A;  3OXU A;  2RI9 A;  1LD7 B;  2FV0 A;  4CJ1 A;  3SDQ A;  3WUX A;  1O79 A;  3QPF A;  2B39 A;  1DL2 A;  1KKT A;  3QT3 A;  1D8E B;  4D4B A;  4KKJ A;  3CU7 A;  2BBC A;  2V3N A;  3C72 B;  1KWF A;  3M7L A;  3RJ3 A;  1FCE A;  3WKF A;  3GLY A;  3E6U A;  1O6Q A;  1KFG A;  2G0D A;  1AYX A;  3QG0 A;  5GY3 A;  4YCR A;  1FBO A;  2XFG A;  3H7L A;  1CEM A;  2FUZ A;  1IS9 A;  5DGQ A;  1N94 B;  3M76 A;  1JCR B;  4MBG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...