3DSSB

Crystal structure of rabggtase(delta lrr; delta ig)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
327
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 118
structure length 327
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dssB00
3Q75B 4V1RA 1H35A 1D8DB 1D8EB 4ZRQA 2PN5A 1O6QA 4EHMB 1TN7B 1UMPA 4D4DA 1H3BA 2GOXA 3SFYB 3OEDA 4GTQB 2V8KA 2WY8A 1FPPB 3Q78B 5JPNB 3KSQB 1QBQB 3KSLB 1C3DA 1QQFA 3D5RA 1JCQB 3HXCB 1O6HA 4BOKA 1O1TB 2H6IB 3HXFB 3E34B 1KZOB 4MU9A 2XWJB 4D94A 5FOBB 3E37B 3SQCA 4BOJA 5AGDA 2G02A 1O1RB 3PZ1B 1GSZA 4GTMB 3DSSB 4D4CA 1GXNA 1LTXB 3DSXB 3EU5B 2H6HB 5JPMB 1H39A 2NOJA 4D4BA 1NL4B 2V8JA 4C1SA 1TNBB 5FO8B 1GXOA 3EUVB 2XQWA 5FO9B 4GTVB 1TNUB 1W6JA 4ONTA 2V3PA 1TNZB 2H6GB 3PZ3B 1H37A 2F0YB 3E30B 2BB6A 4GTTB 1H3AA 2R2LB 1SQCA 3RJ3A 1NI1B 1FT1B 4GTOB 1S64B 2V8IA 1O6RA 2ZISB 2IEJB 4GTRB 4KKIA 4ZH1A 2XWBB 3Q7AB 2SQCA 1TNOB 4ZRPA 2H6FB 2WY7A 1S63B 1X81B 1KZPB 4L9PB 3G6JB 1N95B 1N4QB 3DSUB 3KQ4A 4M76A 3HXEB 1SA5B 2I07B 3DSTB 5FO7B 1LD8B 1JCSB 3C72B 1H36A 1R76A 3HXBB 1N94B 2WINB 1MZCB 3DRAB 2WIIB 1O79A 3K7XA 2PMVA 1TN8B 4V1SA 1N4RB 2BEDB 1O1SB 1N4PB 1N4SB 1FT2B 2BBCA 1N9AB 3E32B 3Q73B 4LNBB 4LNVA 4YDEB 2ZIRB 3DSWB 3OXUA 3Q7FB 1GXMA 1W6KA 1TNYB 1H3CA 3HXDB 3D5SA 4KKJA 3E33B 3SFXB 1O5MB 1GHQA 2BB5A 2G0DA 1LD7B 3KLSA 4FXKB 3Q79B 2A73B 1HZFA 4GTPB 3CU7A 4LNGB 4D4AA 2V3NA 4GTSB 1DCEB 3DSVB 1TN6B 2B39A 3DPYB 4FXGB 1SA4B 3PZ2B 3PZ4B 4MBGB 1QSJA 1JCRB 4YDOB
chains in the Genus database with same CATH superfamily
3Q75B 3W5NA 1H35A 2EADA 3M77A 4ZRQA 1O6QA 1N1BA 2QNOA 2JJBA 1V5CA 3WKFA 4FUSA 3M7EA 1DL2A 1GA2A 2V8KA 2WY8A 3KSQB 3M7CA 4DOEA 2RI9A 4BOKA 3W5MA 3S4AA 2BRVX 1KZOB 3M75A 2GZ6A 4NEIA 4MU9A 3P5PA 1V5DA 5ILYA 4KTRA 5GW7A 5DGQA 4L6XA 5M7IA 3PZ1B 1GSZA 4GTMB 2X03A 1LTXB 2E22A 2DRRA 4CJ0A 4L0GA 5ILKA 1H39A 3QT9A 3M76A 1NL4B 2V8JA 1JS4A 4OZWA 3QXFA 1IA6A 4GTVB 4WU0A 4ONTA 1OJOA 2V3PA 1N20A 2Q1FA 3GZKA 1TNZB 3LZ9A 2F0YB 4GTTB 1LXKA 3ACTA 3M72A 3RX7A 2VN4A 3E6UA 2ONHA 1G9GA 5ILIA 1CEMA 1HM2A 1FT1B 1HMUA 2V8IA 1O6RA 4GTRB 3H3KA 4KKIA 5DHIA 4L9PB 1X81B 1CLCA 1J0NA 1N95B 3SDRA 3VW5A 4CJ1A 4JJJA 2I07B 1N1ZA 3QDEA 3RX5A 2FUTA 3ON6A 1H36A 1FMIA 3W7WA 3TF4A 3E73A 1WU6A 1NC5A 1OJPA 3A3VA 3K7XA 1TN8B 2EAEA 3N0GA 3Q73B 4WVAA 1F1SA 3DSWB 2RI8A 1FP3A 3D5SA 2EABA 1LD7B 4FXKB 2A73B 3QWTA 2OKXA 4D4AA 3WKGA 2V3NA 4F10A 1FBOA 3DSVB 2AHFA 4MMHA 3PZ4B 1QSJA 3VSMA 1JCRB 4AYQA 4YDOB 4V1RA 2D8LA 3VSNA 1G6IA 3RRSA 1FBWA 4EHMB 3M71A 1TN7B 2FV0A 1UMPA 4TXTA 2GOXA 3OEDA 3QG0A 1N7QA 5IKAA 3KSLB 1L2AA 3N0FA 2Z07A 4DI5A 2WCOA 1O6HA 2FV1A 3WUXA 3M01A 1HV6A 4OK2A 1F9OA 1G87A 2VN7A 1GAIA 4D94A 3W7TA 2CQTA 5AGDA 5ILDA 5DGRA 1V7VA 3H2WA 3S9VA 3PYAA 3SDUA 3DSXB 3EU5B 1HX9A 1RWAA 5JPMB 2NOJA 1TNBB 1V7XA 1W6JA 3QFZA 4CE7A 3SDTA 3PZ3B 2RGKA 2B4FA 1H3AA 4XUVA 2R2LB 3EU8A 3WC3A 3M00A 3WIWA 1FO3A 1S64B 1L1YA 1ULVA 2ZISB 4LIXA 2IEJB 3M78A 4ZH1A 3Q7AB 2SQCA 2WY7A 1S63B 1KZPB 3G6JB 3KQ4A 4M76A 5IK0A 3WKHA 4E1YA 3QRYA 1MZCB 1RWGA 3X17A 5CD2A 2WIIB 2PMVA 4V1SA 2BEDB 3GLYA 3E32B 3G4DA 1N7OA 3M02A 3OXUA 3Q7FB 4OZVA 4GAXA 3PMMA 1TNYB 1IS9A 2BRPA 1UG9A 5DHKA 5ILZA 5E2JA 3EZ8A 4ZG8A 3A0OA 4KKJA 3E33B 1GHQA 2JG0A 3AFJA 2G0DA 3E80A 3Q79B 2EACA 4AYRA 1HCUA 3M73A 3GT5A 4GTSB 1TN6B 3H7LA 3PZ2B 2XFGA 1D8DB 1KS8A 1KWFA 2ONGA 2J5CA 2ZZRA 1LF9A 2ZBLA 2PN5A 3QPFA 1UT9A 1HXCA 3ANIA 1KSDA 1X1IA 3W7SA 1FAEA 4D4DA 1C82A 3AFLA 2FUZA 3SFYB 4J5TA 2WYNA 2NVPA 5C05A 1O1TB 2YIKA 2H6IB 5JMFA 3E34B 1GLMA 3ACSA 1GAHA 3E37B 3M7LA 4BOJA 3W7UA 3QFYA 2G02A 1O1RB 1KREA 1RQ5A 1KFGA 1FCEA 1GXNA 5EATA 2H6HB 3NNBA 4ZH5A 3RX8A 4C1SA 3RSYA 1KKTA 1G9JA 5FO8B 3VXDA 5CA3A 5IM1A 1TNUB 1RWFA 1H13A 5CZLA 1F9GA 1EGUA 3E30B 5IK9A 1FO2A 2BB6A 4WVBA 5EAUA 3WIQA 5GZKA 1I8QA 2FUQA 3RJ3A 1XW2A 5KKBA 1NI1B 2AFAA 1RW9A 3P5RA 3P2CA 4Z4JA 1N7RA 2XWBB 4ZRPA 2H6FB 4RNQA 3DSUB 3HXEB 4AYOA 5ILJA 3DSTB 5FO7B 1LD8B 1JCSB 1H54A 3NFVA 1N94B 3G4FA 3K11A 1O79A 3Q78B 1N4SB 1O1SB 4LNGB 4QT9A 1N9AB 4LNBB 4LNVA 4DODA 1W3YA 1CB8A 1H12A 1DOGA 2P0VA 1GXMA 1W6KA 3EQAA 1V7WA 3SAEA 1XWTA 5M7YA 4WVCA 4MMIA 5EASA 1HZFA 2D5JA 4GTPB 3W7XA 3CIHA 1J0MA 3CU7A 3M74A 3D3IA 2B39A 3DPYB 4FXGB 1WU4A 4MBGB 1N7NA 1K72A 4OK4A 1D8EB 1NXCA 4GL3A 3ANJA 4FJQA 4F13A 1HM3A 3RENA 2FBAA 1H3BA 2DRSA 4GTQB 3S4CA 1FPPB 5JPNB 1KSCA 1QBQB 2A8ZA 1C3DA 1HXAA 1QQFA 3D5RA 1JCQB 1KRFA 3HXCB 3S4BA 3HXFB 1AYXA 3QT3A 1LF6A 2XWJB 5FOBB 5MEHA 3SQCA 2WDAA 1WU5A 3QSPA 3E7JA 3DSSB 4D4CA 2JF4A 3WIRA 1X9DA 4D4BA 3S4DA 1GXOA 3EUVB 2XQWA 3M7BA 1VD5A 3PYBA 4Q2BA 5FO9B 5IK6A 5IL3A 1AGMA 1IA7A 2H6GB 1H37A 1HXGA 1HN0A 1SQCA 4EL8A 4AYPA 2F6DA 4KTPA 4GTOB 4OJZA 5JMDA 2CQSA 3WKIA 1N7PA 3QXQA 1HMWA 1X1JA 1TNOB 2AHGA 1XWQA 1OJNA 2DRQA 1N4QB 1SA5B 1WZZA 1N23A 3C72B 1R76A 3HXBB 2WINB 1N21A 3DRAB 1LOHA 1OJMA 4Q88A 1N4RB 1N4PB 1RWHA 1FT2B 2BBCA 4YDEB 5IKHA 4Z4LA 1F9DA 1QAZA 2ZIRB 1N22A 4TF4A 4YCRA 1RWCA 3T33A 1H3CA 3HXDB 3SFXB 1O5MB 2BB5A 3KLSA 3SDVA 2DROA 5IL8A 1H14A 2E24A 5ILHA 1LXMA 5GY3A 1N24A 1TF4A 2BRWA 1DCEB 2GH4A 1X1HA 1SA4B 4FNVA 3SDQA 3ANKA
chains in the Genus database with same CATH topology
3Q75B 3W5NA 1H35A 2EADA 3M77A 4ZRQA 1O6QA 2QNOA 2JJBA 1V5CA 3WKFA 4FUSA 3M7EA 1DL2A 1GA2A 2V8KA 2WY8A 3KSQB 3M7CA 4DOEA 2RI9A 4BOKA 3W5MA 3S4AA 1KZOB 3M75A 2GZ6A 4MU9A 3P5PA 1V5DA 4KTRA 5GW7A 5DGQA 4L6XA 5M7IA 3PZ1B 1GSZA 4GTMB 1LTXB 2DRRA 4CJ0A 4L0GA 1H39A 3QT9A 3M76A 1NL4B 2V8JA 1JS4A 3QXFA 1IA6A 4GTVB 4WU0A 4ONTA 2V3PA 3GZKA 1TNZB 2F0YB 4GTTB 3ACTA 3M72A 3RX7A 2VN4A 3E6UA 1G9GA 1CEMA 1FT1B 2V8IA 1O6RA 4GTRB 3H3KA 4KKIA 4L9PB 1X81B 1CLCA 1N95B 3VW5A 3SDRA 4CJ1A 4JJJA 2I07B 3QDEA 3RX5A 3ON6A 1H36A 1FMIA 3W7WA 3TF4A 3E73A 1WU6A 1NC5A 3A3VA 3K7XA 1TN8B 2EAEA 3Q73B 4WVAA 3DSWB 2RI8A 1FP3A 3D5SA 2EABA 1LD7B 4FXKB 2A73B 3QWTA 2OKXA 4D4AA 3WKGA 2V3NA 1FBOA 3DSVB 2AHFA 3PZ4B 1QSJA 1JCRB 4AYQA 4YDOB 4V1RA 2D8LA 1G6IA 3RRSA 1FBWA 4EHMB 3M71A 1TN7B 2FV0A 1UMPA 4TXTA 2GOXA 3OEDA 3QG0A 3KSLB 1L2AA 2Z07A 1O6HA 2FV1A 3WUXA 1F9OA 1G87A 2VN7A 1GAIA 4D94A 3W7TA 2CQTA 5AGDA 5DGRA 1V7VA 3H2WA 3S9VA 3PYAA 3DSXB 3EU5B 5JPMB 2NOJA 1TNBB 1V7XA 1W6JA 3QFZA 4CE7A 3SDTA 3PZ3B 2RGKA 2B4FA 1H3AA 4XUVA 2R2LB 3EU8A 3WC3A 3WIWA 1FO3A 1S64B 1L1YA 1ULVA 2ZISB 4LIXA 2IEJB 3M78A 4ZH1A 3Q7AB 2SQCA 2WY7A 1S63B 1KZPB 3G6JB 3KQ4A 4M76A 3WKHA 3QRYA 1MZCB 3X17A 5CD2A 2WIIB 2PMVA 4V1SA 2BEDB 3GLYA 3E32B 3OXUA 3Q7FB 3PMMA 1TNYB 1IS9A 1UG9A 5E2JA 3EZ8A 4ZG8A 4KKJA 3E33B 1GHQA 2JG0A 3AFJA 2G0DA 3Q79B 2EACA 4AYRA 1HCUA 3M73A 3GT5A 4GTSB 1TN6B 3H7LA 3PZ2B 2XFGA 1D8DB 1KS8A 1KWFA 2ZZRA 1LF9A 2ZBLA 2PN5A 3QPFA 1UT9A 3ANIA 1KSDA 3W7SA 1FAEA 4D4DA 2FUZA 3SFYB 4J5TA 2WYNA 2NVPA 1O1TB 2YIKA 2H6IB 3E34B 1GLMA 3ACSA 1GAHA 3E37B 3M7LA 4BOJA 3W7UA 3QFYA 2G02A 1O1RB 1KREA 1RQ5A 1KFGA 1FCEA 1GXNA 2H6HB 4ZH5A 3RX8A 4C1SA 3RSYA 1KKTA 1G9JA 5FO8B 3VXDA 5CA3A 1TNUB 1H13A 5CZLA 3E30B 1FO2A 2BB6A 4WVBA 3WIQA 5GZKA 3RJ3A 1XW2A 5KKBA 1NI1B 2AFAA 3P5RA 3P2CA 4Z4JA 2XWBB 4ZRPA 2H6FB 3DSUB 3HXEB 4AYOA 3DSTB 5FO7B 1LD8B 1JCSB 1H54A 1N94B 3K11A 1O79A 3Q78B 1N4SB 1O1SB 4LNGB 4QT9A 1N9AB 4LNBB 4LNVA 4DODA 1H12A 1DOGA 2P0VA 1GXMA 1W6KA 3EQAA 1V7WA 3SAEA 1XWTA 5M7YA 4WVCA 1HZFA 2D5JA 4GTPB 3W7XA 3CIHA 3CU7A 3M74A 3D3IA 2B39A 3DPYB 4FXGB 1WU4A 4MBGB 1K72A 1D8EB 1NXCA 4GL3A 3ANJA 3RENA 2FBAA 1H3BA 2DRSA 4GTQB 3S4CA 1FPPB 5JPNB 1KSCA 1QBQB 2A8ZA 1C3DA 1QQFA 3D5RA 1JCQB 1KRFA 3HXCB 3S4BA 3HXFB 1AYXA 3QT3A 1LF6A 2XWJB 5FOBB 5MEHA 3SQCA 1WU5A 3QSPA 3DSSB 4D4CA 2JF4A 3WIRA 1X9DA 4D4BA 3S4DA 1GXOA 3EUVB 2XQWA 3M7BA 1VD5A 3PYBA 4Q2BA 5FO9B 1AGMA 1IA7A 2H6GB 1H37A 1SQCA 4EL8A 4AYPA 2F6DA 4KTPA 4GTOB 2CQSA 3WKIA 3QXQA 1TNOB 2AHGA 1XWQA 2DRQA 1N4QB 1SA5B 1WZZA 3C72B 1R76A 3HXBB 2WINB 3DRAB 4Q88A 1N4RB 1N4PB 1FT2B 2BBCA 4YDEB 4Z4LA 1F9DA 2ZIRB 4TF4A 4YCRA 3T33A 1H3CA 3HXDB 3SFXB 1O5MB 2BB5A 3KLSA 3SDVA 2DROA 1H14A 5GY3A 1TF4A 1DCEB 2GH4A 1SA4B 3SDUA 3SDQA 3ANKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q75 B;  4V1R A;  1H35 A;  1D8D B;  1D8E B;  4ZRQ A;  2PN5 A;  1O6Q A;  4EHM B;  1TN7 B;  1UMP A;  4D4D A;  1H3B A;  2GOX A;  3SFY B;  3OED A;  4GTQ B;  2V8K A;  2WY8 A;  1FPP B;  3Q78 B;  5JPN B;  3KSQ B;  1QBQ B;  3KSL B;  1C3D A;  1QQF A;  3D5R A;  1JCQ B;  3HXC B;  1O6H A;  4BOK A;  1O1T B;  2H6I B;  3HXF B;  3E34 B;  1KZO B;  4MU9 A;  2XWJ B;  4D94 A;  5FOB B;  3E37 B;  3SQC A;  4BOJ A;  5AGD A;  2G02 A;  1O1R B;  3PZ1 B;  1GSZ A;  4GTM B;  3DSS B;  4D4C A;  1GXN A;  1LTX B;  3DSX B;  3EU5 B;  2H6H B;  5JPM B;  1H39 A;  2NOJ A;  4D4B A;  1NL4 B;  2V8J A;  4C1S A;  1TNB B;  5FO8 B;  1GXO A;  3EUV B;  2XQW A;  5FO9 B;  4GTV B;  1TNU B;  1W6J A;  4ONT A;  2V3P A;  1TNZ B;  2H6G B;  3PZ3 B;  1H37 A;  2F0Y B;  3E30 B;  2BB6 A;  4GTT B;  1H3A A;  2R2L B;  1SQC A;  3RJ3 A;  1NI1 B;  1FT1 B;  4GTO B;  1S64 B;  2V8I A;  1O6R A;  2ZIS B;  2IEJ B;  4GTR B;  4KKI A;  4ZH1 A;  2XWB B;  3Q7A B;  2SQC A;  1TNO B;  4ZRP A;  2H6F B;  2WY7 A;  1S63 B;  1X81 B;  1KZP B;  4L9P B;  3G6J B;  1N95 B;  1N4Q B;  3DSU B;  3KQ4 A;  4M76 A;  3HXE B;  1SA5 B;  2I07 B;  3DST B;  5FO7 B;  1LD8 B;  1JCS B;  3C72 B;  1H36 A;  1R76 A;  3HXB B;  1N94 B;  2WIN B;  1MZC B;  3DRA B;  2WII B;  1O79 A;  3K7X A;  2PMV A;  1TN8 B;  4V1S A;  1N4R B;  2BED B;  1O1S B;  1N4P B;  1N4S B;  1FT2 B;  2BBC A;  1N9A B;  3E32 B;  3Q73 B;  4LNB B;  4LNV A;  4YDE B;  2ZIR B;  3DSW B;  3OXU A;  3Q7F B;  1GXM A;  1W6K A;  1TNY B;  1H3C A;  3HXD B;  3D5S A;  4KKJ A;  3E33 B;  3SFX B;  1O5M B;  1GHQ A;  2BB5 A;  2G0D A;  1LD7 B;  3KLS A;  4FXK B;  3Q79 B;  2A73 B;  1HZF A;  4GTP B;  3CU7 A;  4LNG B;  4D4A A;  2V3N A;  4GTS B;  1DCE B;  3DSV B;  1TN6 B;  2B39 A;  3DPY B;  4FXG B;  1SA4 B;  3PZ2 B;  3PZ4 B;  4MBG B;  1QSJ A;  1JCR B;  4YDO B; 
#chains in the Genus database with same CATH topology
 3Q75 B;  3W5N A;  1H35 A;  2EAD A;  3M77 A;  4ZRQ A;  1O6Q A;  1N1B A;  2QNO A;  2JJB A;  1V5C A;  3WKF A;  4FUS A;  3M7E A;  1DL2 A;  1GA2 A;  2V8K A;  2WY8 A;  3KSQ B;  3M7C A;  4DOE A;  2RI9 A;  4BOK A;  3W5M A;  3S4A A;  2BRV X;  1KZO B;  3M75 A;  2GZ6 A;  4NEI A;  4MU9 A;  3P5P A;  1V5D A;  5ILY A;  4KTR A;  5GW7 A;  5DGQ A;  4L6X A;  5M7I A;  3PZ1 B;  1GSZ A;  4GTM B;  2X03 A;  1LTX B;  2E22 A;  2DRR A;  4CJ0 A;  4L0G A;  5ILK A;  1H39 A;  3QT9 A;  3M76 A;  1NL4 B;  2V8J A;  1JS4 A;  4OZW A;  3QXF A;  1IA6 A;  4GTV B;  4WU0 A;  4ONT A;  1OJO A;  2V3P A;  1N20 A;  2Q1F A;  3GZK A;  1TNZ B;  3LZ9 A;  2F0Y B;  4GTT B;  1LXK A;  3ACT A;  3M72 A;  3RX7 A;  2VN4 A;  3E6U A;  2ONH A;  1G9G A;  5ILI A;  1CEM A;  1HM2 A;  1FT1 B;  1HMU A;  2V8I A;  1O6R A;  4GTR B;  3H3K A;  4KKI A;  5DHI A;  4L9P B;  1X81 B;  1CLC A;  1J0N A;  1N95 B;  3SDR A;  3VW5 A;  4CJ1 A;  4JJJ A;  2I07 B;  1N1Z A;  3QDE A;  3RX5 A;  2FUT A;  3ON6 A;  1H36 A;  1FMI A;  3W7W A;  3TF4 A;  3E73 A;  1WU6 A;  1NC5 A;  1OJP A;  3A3V A;  3K7X A;  1TN8 B;  2EAE A;  3N0G A;  3Q73 B;  4WVA A;  1F1S A;  3DSW B;  2RI8 A;  1FP3 A;  3D5S A;  2EAB A;  1LD7 B;  4FXK B;  2A73 B;  3QWT A;  2OKX A;  4D4A A;  3WKG A;  2V3N A;  4F10 A;  1FBO A;  3DSV B;  2AHF A;  4MMH A;  3PZ4 B;  1QSJ A;  3VSM A;  1JCR B;  4AYQ A;  4YDO B;  4V1R A;  2D8L A;  3VSN A;  1G6I A;  3RRS A;  1FBW A;  4EHM B;  3M71 A;  1TN7 B;  2FV0 A;  1UMP A;  4TXT A;  2GOX A;  3OED A;  3QG0 A;  1N7Q A;  5IKA A;  3KSL B;  1L2A A;  3N0F A;  2Z07 A;  4DI5 A;  2WCO A;  1O6H A;  2FV1 A;  3WUX A;  3M01 A;  1HV6 A;  4OK2 A;  1F9O A;  1G87 A;  2VN7 A;  1GAI A;  4D94 A;  3W7T A;  2CQT A;  5AGD A;  5ILD A;  5DGR A;  1V7V A;  3H2W A;  3S9V A;  3PYA A;  3SDU A;  3DSX B;  3EU5 B;  1HX9 A;  1RWA A;  5JPM B;  2NOJ A;  1TNB B;  1V7X A;  1W6J A;  3QFZ A;  4CE7 A;  3SDT A;  3PZ3 B;  2RGK A;  2B4F A;  1H3A A;  4XUV A;  2R2L B;  3EU8 A;  3WC3 A;  3M00 A;  3WIW A;  1FO3 A;  1S64 B;  1L1Y A;  1ULV A;  2ZIS B;  4LIX A;  2IEJ B;  3M78 A;  4ZH1 A;  3Q7A B;  2SQC A;  2WY7 A;  1S63 B;  1KZP B;  3G6J B;  3KQ4 A;  4M76 A;  5IK0 A;  3WKH A;  4E1Y A;  3QRY A;  1MZC B;  1RWG A;  3X17 A;  5CD2 A;  2WII B;  2PMV A;  4V1S A;  2BED B;  3GLY A;  3E32 B;  3G4D A;  1N7O A;  3M02 A;  3OXU A;  3Q7F B;  4OZV A;  4GAX A;  3PMM A;  1TNY B;  1IS9 A;  2BRP A;  1UG9 A;  5DHK A;  5ILZ A;  5E2J A;  3EZ8 A;  4ZG8 A;  3A0O A;  4KKJ A;  3E33 B;  1GHQ A;  2JG0 A;  3AFJ A;  2G0D A;  3E80 A;  3Q79 B;  2EAC A;  4AYR A;  1HCU A;  3M73 A;  3GT5 A;  4GTS B;  1TN6 B;  3H7L A;  3PZ2 B;  2XFG A;  1D8D B;  1KS8 A;  1KWF A;  2ONG A;  2J5C A;  2ZZR A;  1LF9 A;  2ZBL A;  2PN5 A;  3QPF A;  1UT9 A;  1HXC A;  3ANI A;  1KSD A;  1X1I A;  3W7S A;  1FAE A;  4D4D A;  1C82 A;  3AFL A;  2FUZ A;  3SFY B;  4J5T A;  2WYN A;  2NVP A;  5C05 A;  1O1T B;  2YIK A;  2H6I B;  5JMF A;  3E34 B;  1GLM A;  3ACS A;  1GAH A;  3E37 B;  3M7L A;  4BOJ A;  3W7U A;  3QFY A;  2G02 A;  1O1R B;  1KRE A;  1RQ5 A;  1KFG A;  1FCE A;  1GXN A;  5EAT A;  2H6H B;  3NNB A;  4ZH5 A;  3RX8 A;  4C1S A;  3RSY A;  1KKT A;  1G9J A;  5FO8 B;  3VXD A;  5CA3 A;  5IM1 A;  1TNU B;  1RWF A;  1H13 A;  5CZL A;  1F9G A;  1EGU A;  3E30 B;  5IK9 A;  1FO2 A;  2BB6 A;  4WVB A;  5EAU A;  3WIQ A;  5GZK A;  1I8Q A;  2FUQ A;  3RJ3 A;  1XW2 A;  5KKB A;  1NI1 B;  2AFA A;  1RW9 A;  3P5R A;  3P2C A;  4Z4J A;  1N7R A;  2XWB B;  4ZRP A;  2H6F B;  4RNQ A;  3DSU B;  3HXE B;  4AYO A;  5ILJ A;  3DST B;  5FO7 B;  1LD8 B;  1JCS B;  1H54 A;  3NFV A;  1N94 B;  3G4F A;  3K11 A;  1O79 A;  3Q78 B;  1N4S B;  1O1S B;  4LNG B;  4QT9 A;  1N9A B;  4LNB B;  4LNV A;  4DOD A;  1W3Y A;  1CB8 A;  1H12 A;  1DOG A;  2P0V A;  1GXM A;  1W6K A;  3EQA A;  1V7W A;  3SAE A;  1XWT A;  5M7Y A;  4WVC A;  4MMI A;  5EAS A;  1HZF A;  2D5J A;  4GTP B;  3W7X A;  3CIH A;  1J0M A;  3CU7 A;  3M74 A;  3D3I A;  2B39 A;  3DPY B;  4FXG B;  1WU4 A;  4MBG B;  1N7N A;  1K72 A;  4OK4 A;  1D8E B;  1NXC A;  4GL3 A;  3ANJ A;  4FJQ A;  4F13 A;  1HM3 A;  3REN A;  2FBA A;  1H3B A;  2DRS A;  4GTQ B;  3S4C A;  1FPP B;  5JPN B;  1KSC A;  1QBQ B;  2A8Z A;  1C3D A;  1HXA A;  1QQF A;  3D5R A;  1JCQ B;  1KRF A;  3HXC B;  3S4B A;  3HXF B;  1AYX A;  3QT3 A;  1LF6 A;  2XWJ B;  5FOB B;  5MEH A;  3SQC A;  2WDA A;  1WU5 A;  3QSP A;  3E7J A;  3DSS B;  4D4C A;  2JF4 A;  3WIR A;  1X9D A;  4D4B A;  3S4D A;  1GXO A;  3EUV B;  2XQW A;  3M7B A;  1VD5 A;  3PYB A;  4Q2B A;  5FO9 B;  5IK6 A;  5IL3 A;  1AGM A;  1IA7 A;  2H6G B;  1H37 A;  1HXG A;  1HN0 A;  1SQC A;  4EL8 A;  4AYP A;  2F6D A;  4KTP A;  4GTO B;  4OJZ A;  5JMD A;  2CQS A;  3WKI A;  1N7P A;  3QXQ A;  1HMW A;  1X1J A;  1TNO B;  2AHG A;  1XWQ A;  1OJN A;  2DRQ A;  1N4Q B;  1SA5 B;  1WZZ A;  1N23 A;  3C72 B;  1R76 A;  3HXB B;  2WIN B;  1N21 A;  3DRA B;  1LOH A;  1OJM A;  4Q88 A;  1N4R B;  1N4P B;  1RWH A;  1FT2 B;  2BBC A;  4YDE B;  5IKH A;  4Z4L A;  1F9D A;  1QAZ A;  2ZIR B;  1N22 A;  4TF4 A;  4YCR A;  1RWC A;  3T33 A;  1H3C A;  3HXD B;  3SFX B;  1O5M B;  2BB5 A;  3KLS A;  3SDV A;  2DRO A;  5IL8 A;  1H14 A;  2E24 A;  5ILH A;  1LXM A;  5GY3 A;  1N24 A;  1TF4 A;  2BRW A;  1DCE B;  2GH4 A;  1X1H A;  1SA4 B;  4FNV A;  3SDQ A;  3ANK A; 
#chains in the Genus database with same CATH homology
 3Q75 B;  3W5N A;  1H35 A;  2EAD A;  3M77 A;  4ZRQ A;  1O6Q A;  2QNO A;  2JJB A;  1V5C A;  3WKF A;  4FUS A;  3M7E A;  1DL2 A;  1GA2 A;  2V8K A;  2WY8 A;  3KSQ B;  3M7C A;  4DOE A;  2RI9 A;  4BOK A;  3W5M A;  3S4A A;  1KZO B;  3M75 A;  2GZ6 A;  4MU9 A;  3P5P A;  1V5D A;  4KTR A;  5GW7 A;  5DGQ A;  4L6X A;  5M7I A;  3PZ1 B;  1GSZ A;  4GTM B;  1LTX B;  2DRR A;  4CJ0 A;  4L0G A;  1H39 A;  3QT9 A;  3M76 A;  1NL4 B;  2V8J A;  1JS4 A;  3QXF A;  1IA6 A;  4GTV B;  4WU0 A;  4ONT A;  2V3P A;  3GZK A;  1TNZ B;  2F0Y B;  4GTT B;  3ACT A;  3M72 A;  3RX7 A;  2VN4 A;  3E6U A;  1G9G A;  1CEM A;  1FT1 B;  2V8I A;  1O6R A;  4GTR B;  3H3K A;  4KKI A;  4L9P B;  1X81 B;  1CLC A;  1N95 B;  3VW5 A;  3SDR A;  4CJ1 A;  4JJJ A;  2I07 B;  3QDE A;  3RX5 A;  3ON6 A;  1H36 A;  1FMI A;  3W7W A;  3TF4 A;  3E73 A;  1WU6 A;  1NC5 A;  3A3V A;  3K7X A;  1TN8 B;  2EAE A;  3Q73 B;  4WVA A;  3DSW B;  2RI8 A;  1FP3 A;  3D5S A;  2EAB A;  1LD7 B;  4FXK B;  2A73 B;  3QWT A;  2OKX A;  4D4A A;  3WKG A;  2V3N A;  1FBO A;  3DSV B;  2AHF A;  3PZ4 B;  1QSJ A;  1JCR B;  4AYQ A;  4YDO B;  4V1R A;  2D8L A;  1G6I A;  3RRS A;  1FBW A;  4EHM B;  3M71 A;  1TN7 B;  2FV0 A;  1UMP A;  4TXT A;  2GOX A;  3OED A;  3QG0 A;  3KSL B;  1L2A A;  2Z07 A;  1O6H A;  2FV1 A;  3WUX A;  1F9O A;  1G87 A;  2VN7 A;  1GAI A;  4D94 A;  3W7T A;  2CQT A;  5AGD A;  5DGR A;  1V7V A;  3H2W A;  3S9V A;  3PYA A;  3DSX B;  3EU5 B;  5JPM B;  2NOJ A;  1TNB B;  1V7X A;  1W6J A;  3QFZ A;  4CE7 A;  3SDT A;  3PZ3 B;  2RGK A;  2B4F A;  1H3A A;  4XUV A;  2R2L B;  3EU8 A;  3WC3 A;  3WIW A;  1FO3 A;  1S64 B;  1L1Y A;  1ULV A;  2ZIS B;  4LIX A;  2IEJ B;  3M78 A;  4ZH1 A;  3Q7A B;  2SQC A;  2WY7 A;  1S63 B;  1KZP B;  3G6J B;  3KQ4 A;  4M76 A;  3WKH A;  3QRY A;  1MZC B;  3X17 A;  5CD2 A;  2WII B;  2PMV A;  4V1S A;  2BED B;  3GLY A;  3E32 B;  3OXU A;  3Q7F B;  3PMM A;  1TNY B;  1IS9 A;  1UG9 A;  5E2J A;  3EZ8 A;  4ZG8 A;  4KKJ A;  3E33 B;  1GHQ A;  2JG0 A;  3AFJ A;  2G0D A;  3Q79 B;  2EAC A;  4AYR A;  1HCU A;  3M73 A;  3GT5 A;  4GTS B;  1TN6 B;  3H7L A;  3PZ2 B;  2XFG A;  1D8D B;  1KS8 A;  1KWF A;  2ZZR A;  1LF9 A;  2ZBL A;  2PN5 A;  3QPF A;  1UT9 A;  3ANI A;  1KSD A;  3W7S A;  1FAE A;  4D4D A;  2FUZ A;  3SFY B;  4J5T A;  2WYN A;  2NVP A;  1O1T B;  2YIK A;  2H6I B;  3E34 B;  1GLM A;  3ACS A;  1GAH A;  3E37 B;  3M7L A;  4BOJ A;  3W7U A;  3QFY A;  2G02 A;  1O1R B;  1KRE A;  1RQ5 A;  1KFG A;  1FCE A;  1GXN A;  2H6H B;  4ZH5 A;  3RX8 A;  4C1S A;  3RSY A;  1KKT A;  1G9J A;  5FO8 B;  3VXD A;  5CA3 A;  1TNU B;  1H13 A;  5CZL A;  3E30 B;  1FO2 A;  2BB6 A;  4WVB A;  3WIQ A;  5GZK A;  3RJ3 A;  1XW2 A;  5KKB A;  1NI1 B;  2AFA A;  3P5R A;  3P2C A;  4Z4J A;  2XWB B;  4ZRP A;  2H6F B;  3DSU B;  3HXE B;  4AYO A;  3DST B;  5FO7 B;  1LD8 B;  1JCS B;  1H54 A;  1N94 B;  3K11 A;  1O79 A;  3Q78 B;  1N4S B;  1O1S B;  4LNG B;  4QT9 A;  1N9A B;  4LNB B;  4LNV A;  4DOD A;  1H12 A;  1DOG A;  2P0V A;  1GXM A;  1W6K A;  3EQA A;  1V7W A;  3SAE A;  1XWT A;  5M7Y A;  4WVC A;  1HZF A;  2D5J A;  4GTP B;  3W7X A;  3CIH A;  3CU7 A;  3M74 A;  3D3I A;  2B39 A;  3DPY B;  4FXG B;  1WU4 A;  4MBG B;  1K72 A;  1D8E B;  1NXC A;  4GL3 A;  3ANJ A;  3REN A;  2FBA A;  1H3B A;  2DRS A;  4GTQ B;  3S4C A;  1FPP B;  5JPN B;  1KSC A;  1QBQ B;  2A8Z A;  1C3D A;  1QQF A;  3D5R A;  1JCQ B;  1KRF A;  3HXC B;  3S4B A;  3HXF B;  1AYX A;  3QT3 A;  1LF6 A;  2XWJ B;  5FOB B;  5MEH A;  3SQC A;  1WU5 A;  3QSP A;  3DSS B;  4D4C A;  2JF4 A;  3WIR A;  1X9D A;  4D4B A;  3S4D A;  1GXO A;  3EUV B;  2XQW A;  3M7B A;  1VD5 A;  3PYB A;  4Q2B A;  5FO9 B;  1AGM A;  1IA7 A;  2H6G B;  1H37 A;  1SQC A;  4EL8 A;  4AYP A;  2F6D A;  4KTP A;  4GTO B;  2CQS A;  3WKI A;  3QXQ A;  1TNO B;  2AHG A;  1XWQ A;  2DRQ A;  1N4Q B;  1SA5 B;  1WZZ A;  3C72 B;  1R76 A;  3HXB B;  2WIN B;  3DRA B;  4Q88 A;  1N4R B;  1N4P B;  1FT2 B;  2BBC A;  4YDE B;  4Z4L A;  1F9D A;  2ZIR B;  4TF4 A;  4YCR A;  3T33 A;  1H3C A;  3HXD B;  3SFX B;  1O5M B;  2BB5 A;  3KLS A;  3SDV A;  2DRO A;  1H14 A;  5GY3 A;  1TF4 A;  1DCE B;  2GH4 A;  1SA4 B;  3SDU A;  3SDQ A;  3ANK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...