1VD5A

Crystal structure of unsaturated glucuronyl hydrolase, responsible for the degradation of glycosaminoglycan, from bacillus sp. gl1 at 1.8 a resolution
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
377
structure length
377
Chain Sequence
MWQQAIGDALGITARNLKKFGDRFPHVSDGSNKYVLNDNTDWTDGFWSGILWLCYEYTGDEQYREGAVRTVASFRERLDRFENLDHHDIGFLYSLSAKAQWIVEKDESARKLALDAADVLMRRWRADAGIIQAWGPKGDPENGGRIIIDCLLNLPLLLWAGEQTGDPEYRRVAEAHALKSRRFLVRGDDSSYHTFYFDPENGNAIRGGTHQGNTDGSTWTRGQAWGIYGFALNSRYLGNADLLETAKRMARHFLARVPEDGVVYWDFEVPQEPSSYRDSSASAITACGLLEIASQLDESDPERQRFIDAAKTTVTALRDGYAERDDGEAEGFIRRGSYHVRGGISPDDYTIWGDYYYLEALLRLERGVTGYWYERGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords unsaturated glucuronyl hydrolase
publication title Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution
pubmed doi rcsb
source organism Bacillus sp.
total genus 159
structure length 377
sequence length 377
ec nomenclature ec 3.2.1.179: Gellan tetrasaccharide unsaturated glucuronosyl hydrolase.
pdb deposition date 2004-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07470 Glyco_hydro_88 Glycosyl Hydrolase Family 88
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1vd5A00
1IS9A 3WKGA 4XUVA 1LF6A 4CJ0A 4FUSA 4WU0A 3T33A 3QT3A 1V7VA 4J5TA 1H13A 1V5DA 3ANIA 2FV0A 2D5JA 1NC5A 3GZKA 1XW2A 3EZ8A 2VN4A 2WYNA 4Q2BA 3W7XA 2GH4A 2P0VA 5DGQA 1CEMA 3WUXA 4AYOA 3W5NA 3QFYA 5MEHA 1KREA 3H3KA 3QPFA 1FO3A 1AGMA 3W7UA 1F9DA 3W7TA 2JF4A 3S4CA 1GAIA 1H54A 1DL2A 2DRSA 3WIRA 4AYQA 1AYXA 1G6IA 3S4BA 1CLCA 1KSCA 4DOEA 1G87A 2RI9A 3W7WA 2EADA 2JG0A 2A8ZA 1FBOA 1G9GA 5E2JA 2OKXA 3CIHA 3RENA 5GY3A 3RX8A 1V7WA 2CQSA 3P2CA 4WVBA 3WKIA 5CZLA 3RX7A 3RSYA 5M7IA 3S4DA 3QWTA 4Q88A 1FMIA 4Z4JA 2NVPA 2DRRA 3QSPA 3ANKA 3QXFA 3K11A 1WU4A 1WZZA 1DOGA 4L6XA 4ZG8A 3H7LA 2VN7A 4KTRA 3ANJA 1KFGA 3X17A 4Z4LA 2EAEA 2CQTA 1XWTA 3ON6A 4AYRA 3WIWA 4CJ1A 1FCEA 4KTPA 1GLMA 1TF4A 1HCUA 1RQ5A 1G9JA 3AFJA 3E73A 1WU5A 1IA6A 3QDEA 2ZBLA 4JJJA 3D3IA 5DGRA 2QNOA 1H12A 4DODA 1UG9A 2AHGA 1JS4A 2JJBA 4TF4A 4EL8A 1X9DA 1GAHA 2DRQA 1L1YA 5KKBA 1F9OA 5M7YA 3A3VA 3QFZA 1H14A 2RI8A 1FBWA 3GT5A 2B4FA 3VXDA 4TXTA 1FAEA 3W7SA 2RGKA 2XFGA 3S4AA 1K72A 4ZH5A 1UT9A 4L0GA 3H2WA 2EABA 2AHFA 1ULVA 1V7XA 3ACTA 5GW7A 1LF9A 1KKTA 2FV1A 3QG0A 2DROA 2ZZRA 3RX5A 3WIQA 4AYPA 2YIKA 4CE7A 1VD5A 1KRFA 4WVCA 5CA3A 3WKHA 1KWFA 1GA2A 2FUZA 2AFAA 3E6UA 3PMMA 4WVAA 2F6DA 3EQAA 1KSDA 3W5MA 1NXCA 3ACSA 1L2AA 1IA7A 3QT9A 1KS8A 2D8LA 3VW5A 3RRSA 2GZ6A 3QRYA 3TF4A 1FP3A 3GLYA 5CD2A 1WU6A 1FO2A 3WC3A 3WKFA 2FBAA 1V5CA 3QXQA 2Z07A 1XWQA 2EACA
chains in the Genus database with same CATH superfamily
2H6IB 1F1SA 3WKGA 2H6FB 4M76A 3M77A 1LF6A 4CJ0A 4FUSA 3T33A 3N0GA 3QT3A 2PN5A 4OK4A 5IK6A 2FUTA 4OJZA 4Q2BA 2GH4A 5DGQA 3VSNA 3Q7FB 1F9GA 4F13A 1W3YA 4ZRPA 3KSLB 3SDUA 1KREA 3H3KA 3QPFA 5ILKA 2FUQA 3G6JB 3W7UA 1H36A 3W7TA 1O6HA 2ONGA 1AYXA 2BRWA 1HX9A 1X1JA 5DHKA 1N7QA 1CLCA 1KSCA 3NNBA 1TNZB 4BOJA 2WY8A 1G87A 3W7WA 1FBOA 1H3AA 3NFVA 1N20A 2V3PA 3KLSA 5E2JA 2OKXA 3CIHA 2Q1FA 1N95B 2XWBB 3PZ3B 5M7IA 4OZWA 5EATA 1FMIA 3DSWB 2J5CA 3HXBB 3SAEA 3QSPA 4D4AA 3E34B 3DSVB 1DOGA 4L6XA 4ZG8A 1N7OA 2VN7A 1J0MA 1KFGA 4EHMB 2WY7A 1FCEA 3PZ2B 1TF4A 3P5PA 1G9JA 3M00A 3KSQB 1TNUB 3D3IA 5DGRA 2ZIRB 3M78A 4GTQB 1H12A 5EASA 5ILDA 1X9DA 5M7YA 5ILZA 4KKIA 2RI8A 1HZFA 3VXDA 1J0NA 1TN8B 4GTTB 2H6GB 1N1BA 1FPPB 2WDAA 1HXAA 2BB5A 2BBCA 4GTVB 5GW7A 3K7XA 3QG0A 2DROA 1O79A 1N9AB 4L9PB 4CE7A 3M71A 2AFAA 3E6UA 4WVAA 1KSDA 3W5MA 3ACSA 4FXKB 2ZISB 4GAXA 5CD2A 2V8KA 1TNBB 2FBAA 5ILHA 2Z07A 1H37A 3W7XA 2EACA 2SQCA 2E24A 3PZ4B 3E80A 4OZVA 1JCRB 1HN0A 1FT2B 2A73B 3M7LA 1V5DA 3PYBA 3ANIA 3DSSB 1XW2A 1D8DB 2WYNA 4GTSB 3E7JA 3QFYA 5MEHA 3M75A 3D5RA 1OJOA 1H54A 3Q7AB 3M7CA 1TN6B 1QBQB 2XWJB 4AYQA 1G6IA 4D4BA 4DOEA 4LIXA 2RI9A 2EADA 4MU9A 5IKHA 3P5RA 1O1RB 1NL4B 3RENA 3E33B 2IEJB 3SDRA 1RWCA 3P2CA 3PZ1B 5FO7B 3N0FA 3QWTA 4V1SA 3E37B 4Z4JA 2NVPA 2DRRA 2XQWA 1EGUA 3ANKA 1DCEB 3SFXB 1WU4A 3H7LA 3KQ4A 3Q78B 4AYRA 3ON6A 3M01A 1QQFA 1GLMA 5JPMB 1HCUA 1RQ5A 4V1RA 3E73A 1JS4A 1SQCA 4TF4A 4EL8A 1QSJA 1L1YA 2V3NA 1LTXB 1F9OA 3QFZA 3GT5A 4TXTA 2XFGA 1N4PB 3E32B 4L0GA 1HMUA 1ULVA 3ACTA 4GTOB 1LF9A 1KKTA 2FV1A 3WIQA 1RWAA 2WIIB 1KRFA 3M7BA 4WVCA 5CA3A 1KWFA 5EAUA 2FUZA 4OK2A 4F10A 5JMDA 5ILIA 1HXGA 3EQAA 1H3CA 1IA7A 2NOJA 1OJPA 4QT9A 3SDTA 3VW5A 3RRSA 4MBGB 5AGDA 3TF4A 1N23A 3WKFA 1GXNA 5ILYA 3AFLA 1RWHA 1HM2A 1XWQA 1LXMA 1GXMA 1I8QA 1H3BA 1IS9A 4LNVA 3HXEB 4GTPB 1V7VA 4J5TA 1R76A 1TNYB 5DHIA 1NC5A 3GZKA 4D4CA 5IL8A 2WINB 1N22A 5JPNB 3WUXA 1O6RA 1S64B 3DSXB 2BRPA 1FO3A 1AGMA 1N4SB 4MMHA 3SDVA 4RNQA 3S4CA 1GAIA 1DL2A 2DRSA 3EU8A 5ILJA 4C1SA 3SFYB 3S4BA 3EU5B 5IK0A 3SDQA 1H35A 3M74A 1RWGA 1N1ZA 4D94A 1N7NA 2A8ZA 1G9GA 2ONHA 1TNOB 5GY3A 4MMIA 1N24A 3RX8A 1V7WA 2GOXA 3HXFB 2G02A 2CQSA 3Q79B 4WVBA 5CZLA 3RX7A 3RSYA 3PYAA 4Q88A 5FO9B 1W6JA 1X1HA 3OEDA 4ONTA 3M7EA 4KTRA 3ANJA 4Z4LA 4CJ1A 3WIWA 4GL3A 3D5SA 4KTPA 5FO8B 1O1SB 4DI5A 1O1TB 3A0OA 1WU5A 1HMWA 3QDEA 4LNBB 2QNOA 4DODA 1UG9A 2WCOA 1KZOB 2JJBA 4D4DA 2DRQA 1OJNA 5KKBA 3M02A 3LZ9A 2E22A 1H14A 2B4FA 3S9VA 1FAEA 1HM3A 1N7PA 2RGKA 1TN7B 3OXUA 1K72A 1N7RA 3G4DA 1UT9A 2G0DA 2EABA 3RX5A 4BOKA 1KZPB 1VD5A 5C05A 2BRVX 1GA2A 3PMMA 3M76A 1L2AA 2H6HB 3QT9A 2D8LA 3DSUB 3QRYA 5IK9A 3EUVB 1FP3A 4ZRQA 1D8EB 1WU6A 4ZH1A 3QXQA 1GHQA 1O5MB 3HXDB 2ZBLA 1W6KA 2B39A 1RWFA 2V8JA 4XUVA 1JCSB 1LD7B 1C82A 4WU0A 5IKAA 4E1YA 1H13A 1GSZA 4GTMB 5FOBB 2FV0A 2D5JA 2VN4A 1LOHA 1SA4B 2P0VA 1CEMA 4AYOA 4FJQA 3W5NA 1N4QB 3E30B 1FT1B 2I07B 1F9DA 2JF4A 1LD8B 3WIRA 5IL3A 3DPYB 3HXCB 4LNGB 2JG0A 1X1IA 1H39A 1GXOA 3M72A 4YDEB 5IM1A 3WKIA 3S4DA 2X03A 3SQCA 3QXFA 3K11A 1WZZA 4GTRB 3Q75B 4NEIA 1NI1B 1X81B 3X17A 2EAEA 2CQTA 1XWTA 1O6QA 3AFJA 1IA6A 1C3DA 1S63B 4JJJA 5GZKA 3M73A 4YCRA 2BB6A 2AHGA 3G4FA 1MZCB 1JCQB 4FNVA 1GAHA 3A3VA 1FBWA 3W7SA 2V8IA 3DRAB 4YDOB 3Q73B 2PMVA 3S4AA 4ZH5A 3H2WA 2AHFA 1LXKA 1SA5B 1V7XA 4KKJA 1N4RB 2ZZRA 4AYPA 3C72B 2YIKA 1N94B 1OJMA 1UMPA 3WKHA 2F6DA 1NXCA 3DSTB 1HXCA 3CU7A 1KS8A 2R2LB 3RJ3A 2GZ6A 3GLYA 3WC3A 1FO2A 1CB8A 2BEDB 1QAZA 1N21A 1V5CA 1HV6A 1RW9A 2F0YB 5JMFA 4FXGB 3VSMA 3EZ8A
chains in the Genus database with same CATH topology
2H6IB 3WKGA 2H6FB 4M76A 3M77A 1LF6A 4CJ0A 4FUSA 3T33A 3QT3A 2PN5A 4Q2BA 2GH4A 5DGQA 3Q7FB 4ZRPA 3KSLB 3SDUA 1KREA 3H3KA 3QPFA 3G6JB 3W7UA 1H36A 3W7TA 1O6HA 1AYXA 1CLCA 1KSCA 1TNZB 4BOJA 2WY8A 1G87A 3W7WA 1FBOA 1H3AA 2V3PA 3KLSA 5E2JA 2OKXA 3CIHA 1N95B 2XWBB 3PZ3B 5M7IA 1FMIA 3DSWB 3HXBB 3SAEA 3QSPA 4D4AA 3E34B 3DSVB 1DOGA 4L6XA 4ZG8A 2VN7A 1KFGA 4EHMB 2WY7A 1FCEA 3PZ2B 1TF4A 3P5PA 1G9JA 3KSQB 1TNUB 3D3IA 5DGRA 2ZIRB 3M78A 4GTQB 1H12A 1X9DA 5M7YA 4KKIA 2RI8A 1HZFA 3VXDA 1TN8B 4GTTB 2H6GB 1FPPB 2BB5A 2BBCA 4GTVB 5GW7A 3K7XA 3QG0A 2DROA 1O79A 1N9AB 4L9PB 4CE7A 3M71A 2AFAA 3E6UA 4WVAA 1KSDA 3W5MA 3ACSA 4FXKB 2ZISB 5CD2A 2V8KA 1TNBB 2FBAA 2Z07A 1H37A 3W7XA 2EACA 2SQCA 3PZ4B 1JCRB 1FT2B 2A73B 3M7LA 1V5DA 3PYBA 3ANIA 3DSSB 1XW2A 1D8DB 2WYNA 4GTSB 3QFYA 5MEHA 3M75A 3D5RA 1H54A 3Q7AB 3M7CA 1TN6B 1QBQB 2XWJB 4AYQA 1G6IA 4D4BA 4DOEA 4LIXA 2RI9A 2EADA 4MU9A 3P5RA 1O1RB 1NL4B 3RENA 3E33B 2IEJB 3SDRA 3P2CA 3PZ1B 5FO7B 3QWTA 4V1SA 3E37B 4Z4JA 2NVPA 2DRRA 2XQWA 3ANKA 1DCEB 3SFXB 1WU4A 3H7LA 3KQ4A 3Q78B 4AYRA 3ON6A 1QQFA 1GLMA 5JPMB 1HCUA 1RQ5A 4V1RA 3E73A 1JS4A 1SQCA 4TF4A 4EL8A 1QSJA 1L1YA 2V3NA 1LTXB 1F9OA 3QFZA 3GT5A 4TXTA 2XFGA 1N4PB 3E32B 4L0GA 1ULVA 3ACTA 4GTOB 1LF9A 1KKTA 2FV1A 3WIQA 2WIIB 1KRFA 3M7BA 4WVCA 5CA3A 1KWFA 2FUZA 3EQAA 1H3CA 1IA7A 2NOJA 4QT9A 3SDTA 3VW5A 3RRSA 4MBGB 5AGDA 3TF4A 3WKFA 1GXNA 1XWQA 1GXMA 1H3BA 1IS9A 4LNVA 3HXEB 4GTPB 1V7VA 4J5TA 1R76A 1TNYB 4D4CA 1NC5A 3GZKA 2WINB 5JPNB 3WUXA 1O6RA 1S64B 3DSXB 1FO3A 1AGMA 1N4SB 3SDVA 3S4CA 1GAIA 1DL2A 2DRSA 3EU8A 4C1SA 3SFYB 3S4BA 3EU5B 3SDQA 1H35A 3M74A 4D94A 2A8ZA 1G9GA 1TNOB 5GY3A 3RX8A 1V7WA 2GOXA 3HXFB 2G02A 2CQSA 3Q79B 4WVBA 5CZLA 3RX7A 3RSYA 3PYAA 4Q88A 5FO9B 1W6JA 3OEDA 4ONTA 3M7EA 4KTRA 3ANJA 4Z4LA 4CJ1A 3WIWA 4GL3A 3D5SA 4KTPA 5FO8B 1O1SB 1O1TB 1WU5A 3QDEA 4LNBB 2QNOA 4DODA 1UG9A 1KZOB 2JJBA 4D4DA 2DRQA 5KKBA 1H14A 2B4FA 3S9VA 1FAEA 2RGKA 1TN7B 3OXUA 1K72A 1UT9A 2G0DA 2EABA 3RX5A 4BOKA 1KZPB 1VD5A 1GA2A 3PMMA 3M76A 1L2AA 2H6HB 3QT9A 2D8LA 3DSUB 3QRYA 3EUVB 1FP3A 4ZRQA 1D8EB 1WU6A 4ZH1A 3QXQA 3HXDB 1O5MB 1GHQA 2ZBLA 1W6KA 2B39A 2V8JA 4XUVA 1JCSB 1LD7B 4WU0A 1H13A 1GSZA 4GTMB 5FOBB 2FV0A 2D5JA 2VN4A 1SA4B 2P0VA 1CEMA 4AYOA 3W5NA 1N4QB 3E30B 1FT1B 2I07B 1F9DA 2JF4A 1LD8B 3WIRA 3DPYB 3HXCB 4LNGB 2JG0A 1H39A 1GXOA 3M72A 4YDEB 3WKIA 3S4DA 3SQCA 3QXFA 3K11A 1WZZA 4GTRB 3Q75B 1NI1B 1X81B 3X17A 2EAEA 2CQTA 1XWTA 1O6QA 3AFJA 1IA6A 1C3DA 1S63B 4JJJA 5GZKA 3M73A 4YCRA 2BB6A 2AHGA 1MZCB 1JCQB 1GAHA 3A3VA 1FBWA 3W7SA 2V8IA 3DRAB 4YDOB 3Q73B 2PMVA 3S4AA 4ZH5A 3H2WA 2AHFA 1SA5B 1V7XA 4KKJA 1N4RB 2ZZRA 4AYPA 3C72B 2YIKA 1N94B 1UMPA 3WKHA 2F6DA 1NXCA 3DSTB 3CU7A 1KS8A 2R2LB 3RJ3A 2GZ6A 3GLYA 3WC3A 1FO2A 2BEDB 1V5CA 2F0YB 4FXGB 3EZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IS9 A;  3WKG A;  4XUV A;  1LF6 A;  4CJ0 A;  4FUS A;  4WU0 A;  3T33 A;  3QT3 A;  1V7V A;  4J5T A;  1H13 A;  1V5D A;  3ANI A;  2FV0 A;  2D5J A;  1NC5 A;  3GZK A;  1XW2 A;  3EZ8 A;  2VN4 A;  2WYN A;  4Q2B A;  3W7X A;  2GH4 A;  2P0V A;  5DGQ A;  1CEM A;  3WUX A;  4AYO A;  3W5N A;  3QFY A;  5MEH A;  1KRE A;  3H3K A;  3QPF A;  1FO3 A;  1AGM A;  3W7U A;  1F9D A;  3W7T A;  2JF4 A;  3S4C A;  1GAI A;  1H54 A;  1DL2 A;  2DRS A;  3WIR A;  4AYQ A;  1AYX A;  1G6I A;  3S4B A;  1CLC A;  1KSC A;  4DOE A;  1G87 A;  2RI9 A;  3W7W A;  2EAD A;  2JG0 A;  2A8Z A;  1FBO A;  1G9G A;  5E2J A;  2OKX A;  3CIH A;  3REN A;  5GY3 A;  3RX8 A;  1V7W A;  2CQS A;  3P2C A;  4WVB A;  3WKI A;  5CZL A;  3RX7 A;  3RSY A;  5M7I A;  3S4D A;  3QWT A;  4Q88 A;  1FMI A;  4Z4J A;  2NVP A;  2DRR A;  3QSP A;  3ANK A;  3QXF A;  3K11 A;  1WU4 A;  1WZZ A;  1DOG A;  4L6X A;  4ZG8 A;  3H7L A;  2VN7 A;  4KTR A;  3ANJ A;  1KFG A;  3X17 A;  4Z4L A;  2EAE A;  2CQT A;  1XWT A;  3ON6 A;  4AYR A;  3WIW A;  4CJ1 A;  1FCE A;  4KTP A;  1GLM A;  1TF4 A;  1HCU A;  1RQ5 A;  1G9J A;  3AFJ A;  3E73 A;  1WU5 A;  1IA6 A;  3QDE A;  2ZBL A;  4JJJ A;  3D3I A;  5DGR A;  2QNO A;  1H12 A;  4DOD A;  1UG9 A;  2AHG A;  1JS4 A;  2JJB A;  4TF4 A;  4EL8 A;  1X9D A;  1GAH A;  2DRQ A;  1L1Y A;  5KKB A;  1F9O A;  5M7Y A;  3A3V A;  3QFZ A;  1H14 A;  2RI8 A;  1FBW A;  3GT5 A;  2B4F A;  3VXD A;  4TXT A;  1FAE A;  3W7S A;  2RGK A;  2XFG A;  3S4A A;  1K72 A;  4ZH5 A;  1UT9 A;  4L0G A;  3H2W A;  2EAB A;  2AHF A;  1ULV A;  1V7X A;  3ACT A;  5GW7 A;  1LF9 A;  1KKT A;  2FV1 A;  3QG0 A;  2DRO A;  2ZZR A;  3RX5 A;  3WIQ A;  4AYP A;  2YIK A;  4CE7 A;  1VD5 A;  1KRF A;  4WVC A;  5CA3 A;  3WKH A;  1KWF A;  1GA2 A;  2FUZ A;  2AFA A;  3E6U A;  3PMM A;  4WVA A;  2F6D A;  3EQA A;  1KSD A;  3W5M A;  1NXC A;  3ACS A;  1L2A A;  1IA7 A;  3QT9 A;  1KS8 A;  2D8L A;  3VW5 A;  3RRS A;  2GZ6 A;  3QRY A;  3TF4 A;  1FP3 A;  3GLY A;  5CD2 A;  1WU6 A;  1FO2 A;  3WC3 A;  3WKF A;  2FBA A;  1V5C A;  3QXQ A;  2Z07 A;  1XWQ A;  2EAC A; 
#chains in the Genus database with same CATH topology
 2H6I B;  1F1S A;  3WKG A;  2H6F B;  4M76 A;  3M77 A;  1LF6 A;  4CJ0 A;  4FUS A;  3T33 A;  3N0G A;  3QT3 A;  2PN5 A;  4OK4 A;  5IK6 A;  2FUT A;  4OJZ A;  4Q2B A;  2GH4 A;  5DGQ A;  3VSN A;  3Q7F B;  1F9G A;  4F13 A;  1W3Y A;  4ZRP A;  3KSL B;  3SDU A;  1KRE A;  3H3K A;  3QPF A;  5ILK A;  2FUQ A;  3G6J B;  3W7U A;  1H36 A;  3W7T A;  1O6H A;  2ONG A;  1AYX A;  2BRW A;  1HX9 A;  1X1J A;  5DHK A;  1N7Q A;  1CLC A;  1KSC A;  3NNB A;  1TNZ B;  4BOJ A;  2WY8 A;  1G87 A;  3W7W A;  1FBO A;  1H3A A;  3NFV A;  1N20 A;  2V3P A;  3KLS A;  5E2J A;  2OKX A;  3CIH A;  2Q1F A;  1N95 B;  2XWB B;  3PZ3 B;  5M7I A;  4OZW A;  5EAT A;  1FMI A;  3DSW B;  2J5C A;  3HXB B;  3SAE A;  3QSP A;  4D4A A;  3E34 B;  3DSV B;  1DOG A;  4L6X A;  4ZG8 A;  1N7O A;  2VN7 A;  1J0M A;  1KFG A;  4EHM B;  2WY7 A;  1FCE A;  3PZ2 B;  1TF4 A;  3P5P A;  1G9J A;  3M00 A;  3KSQ B;  1TNU B;  3D3I A;  5DGR A;  2ZIR B;  3M78 A;  4GTQ B;  1H12 A;  5EAS A;  5ILD A;  1X9D A;  5M7Y A;  5ILZ A;  4KKI A;  2RI8 A;  1HZF A;  3VXD A;  1J0N A;  1TN8 B;  4GTT B;  2H6G B;  1N1B A;  1FPP B;  2WDA A;  1HXA A;  2BB5 A;  2BBC A;  4GTV B;  5GW7 A;  3K7X A;  3QG0 A;  2DRO A;  1O79 A;  1N9A B;  4L9P B;  4CE7 A;  3M71 A;  2AFA A;  3E6U A;  4WVA A;  1KSD A;  3W5M A;  3ACS A;  4FXK B;  2ZIS B;  4GAX A;  5CD2 A;  2V8K A;  1TNB B;  2FBA A;  5ILH A;  2Z07 A;  1H37 A;  3W7X A;  2EAC A;  2SQC A;  2E24 A;  3PZ4 B;  3E80 A;  4OZV A;  1JCR B;  1HN0 A;  1FT2 B;  2A73 B;  3M7L A;  1V5D A;  3PYB A;  3ANI A;  3DSS B;  1XW2 A;  1D8D B;  2WYN A;  4GTS B;  3E7J A;  3QFY A;  5MEH A;  3M75 A;  3D5R A;  1OJO A;  1H54 A;  3Q7A B;  3M7C A;  1TN6 B;  1QBQ B;  2XWJ B;  4AYQ A;  1G6I A;  4D4B A;  4DOE A;  4LIX A;  2RI9 A;  2EAD A;  4MU9 A;  5IKH A;  3P5R A;  1O1R B;  1NL4 B;  3REN A;  3E33 B;  2IEJ B;  3SDR A;  1RWC A;  3P2C A;  3PZ1 B;  5FO7 B;  3N0F A;  3QWT A;  4V1S A;  3E37 B;  4Z4J A;  2NVP A;  2DRR A;  2XQW A;  1EGU A;  3ANK A;  1DCE B;  3SFX B;  1WU4 A;  3H7L A;  3KQ4 A;  3Q78 B;  4AYR A;  3ON6 A;  3M01 A;  1QQF A;  1GLM A;  5JPM B;  1HCU A;  1RQ5 A;  4V1R A;  3E73 A;  1JS4 A;  1SQC A;  4TF4 A;  4EL8 A;  1QSJ A;  1L1Y A;  2V3N A;  1LTX B;  1F9O A;  3QFZ A;  3GT5 A;  4TXT A;  2XFG A;  1N4P B;  3E32 B;  4L0G A;  1HMU A;  1ULV A;  3ACT A;  4GTO B;  1LF9 A;  1KKT A;  2FV1 A;  3WIQ A;  1RWA A;  2WII B;  1KRF A;  3M7B A;  4WVC A;  5CA3 A;  1KWF A;  5EAU A;  2FUZ A;  4OK2 A;  4F10 A;  5JMD A;  5ILI A;  1HXG A;  3EQA A;  1H3C A;  1IA7 A;  2NOJ A;  1OJP A;  4QT9 A;  3SDT A;  3VW5 A;  3RRS A;  4MBG B;  5AGD A;  3TF4 A;  1N23 A;  3WKF A;  1GXN A;  5ILY A;  3AFL A;  1RWH A;  1HM2 A;  1XWQ A;  1LXM A;  1GXM A;  1I8Q A;  1H3B A;  1IS9 A;  4LNV A;  3HXE B;  4GTP B;  1V7V A;  4J5T A;  1R76 A;  1TNY B;  5DHI A;  1NC5 A;  3GZK A;  4D4C A;  5IL8 A;  2WIN B;  1N22 A;  5JPN B;  3WUX A;  1O6R A;  1S64 B;  3DSX B;  2BRP A;  1FO3 A;  1AGM A;  1N4S B;  4MMH A;  3SDV A;  4RNQ A;  3S4C A;  1GAI A;  1DL2 A;  2DRS A;  3EU8 A;  5ILJ A;  4C1S A;  3SFY B;  3S4B A;  3EU5 B;  5IK0 A;  3SDQ A;  1H35 A;  3M74 A;  1RWG A;  1N1Z A;  4D94 A;  1N7N A;  2A8Z A;  1G9G A;  2ONH A;  1TNO B;  5GY3 A;  4MMI A;  1N24 A;  3RX8 A;  1V7W A;  2GOX A;  3HXF B;  2G02 A;  2CQS A;  3Q79 B;  4WVB A;  5CZL A;  3RX7 A;  3RSY A;  3PYA A;  4Q88 A;  5FO9 B;  1W6J A;  1X1H A;  3OED A;  4ONT A;  3M7E A;  4KTR A;  3ANJ A;  4Z4L A;  4CJ1 A;  3WIW A;  4GL3 A;  3D5S A;  4KTP A;  5FO8 B;  1O1S B;  4DI5 A;  1O1T B;  3A0O A;  1WU5 A;  1HMW A;  3QDE A;  4LNB B;  2QNO A;  4DOD A;  1UG9 A;  2WCO A;  1KZO B;  2JJB A;  4D4D A;  2DRQ A;  1OJN A;  5KKB A;  3M02 A;  3LZ9 A;  2E22 A;  1H14 A;  2B4F A;  3S9V A;  1FAE A;  1HM3 A;  1N7P A;  2RGK A;  1TN7 B;  3OXU A;  1K72 A;  1N7R A;  3G4D A;  1UT9 A;  2G0D A;  2EAB A;  3RX5 A;  4BOK A;  1KZP B;  1VD5 A;  5C05 A;  2BRV X;  1GA2 A;  3PMM A;  3M76 A;  1L2A A;  2H6H B;  3QT9 A;  2D8L A;  3DSU B;  3QRY A;  5IK9 A;  3EUV B;  1FP3 A;  4ZRQ A;  1D8E B;  1WU6 A;  4ZH1 A;  3QXQ A;  1GHQ A;  1O5M B;  3HXD B;  2ZBL A;  1W6K A;  2B39 A;  1RWF A;  2V8J A;  4XUV A;  1JCS B;  1LD7 B;  1C82 A;  4WU0 A;  5IKA A;  4E1Y A;  1H13 A;  1GSZ A;  4GTM B;  5FOB B;  2FV0 A;  2D5J A;  2VN4 A;  1LOH A;  1SA4 B;  2P0V A;  1CEM A;  4AYO A;  4FJQ A;  3W5N A;  1N4Q B;  3E30 B;  1FT1 B;  2I07 B;  1F9D A;  2JF4 A;  1LD8 B;  3WIR A;  5IL3 A;  3DPY B;  3HXC B;  4LNG B;  2JG0 A;  1X1I A;  1H39 A;  1GXO A;  3M72 A;  4YDE B;  5IM1 A;  3WKI A;  3S4D A;  2X03 A;  3SQC A;  3QXF A;  3K11 A;  1WZZ A;  4GTR B;  3Q75 B;  4NEI A;  1NI1 B;  1X81 B;  3X17 A;  2EAE A;  2CQT A;  1XWT A;  1O6Q A;  3AFJ A;  1IA6 A;  1C3D A;  1S63 B;  4JJJ A;  5GZK A;  3M73 A;  4YCR A;  2BB6 A;  2AHG A;  3G4F A;  1MZC B;  1JCQ B;  4FNV A;  1GAH A;  3A3V A;  1FBW A;  3W7S A;  2V8I A;  3DRA B;  4YDO B;  3Q73 B;  2PMV A;  3S4A A;  4ZH5 A;  3H2W A;  2AHF A;  1LXK A;  1SA5 B;  1V7X A;  4KKJ A;  1N4R B;  2ZZR A;  4AYP A;  3C72 B;  2YIK A;  1N94 B;  1OJM A;  1UMP A;  3WKH A;  2F6D A;  1NXC A;  3DST B;  1HXC A;  3CU7 A;  1KS8 A;  2R2L B;  3RJ3 A;  2GZ6 A;  3GLY A;  3WC3 A;  1FO2 A;  1CB8 A;  2BED B;  1QAZ A;  1N21 A;  1V5C A;  1HV6 A;  1RW9 A;  2F0Y B;  5JMF A;  4FXG B;  3VSM A;  3EZ8 A; 
#chains in the Genus database with same CATH homology
 2H6I B;  3WKG A;  2H6F B;  4M76 A;  3M77 A;  1LF6 A;  4CJ0 A;  4FUS A;  3T33 A;  3QT3 A;  2PN5 A;  4Q2B A;  2GH4 A;  5DGQ A;  3Q7F B;  4ZRP A;  3KSL B;  3SDU A;  1KRE A;  3H3K A;  3QPF A;  3G6J B;  3W7U A;  1H36 A;  3W7T A;  1O6H A;  1AYX A;  1CLC A;  1KSC A;  1TNZ B;  4BOJ A;  2WY8 A;  1G87 A;  3W7W A;  1FBO A;  1H3A A;  2V3P A;  3KLS A;  5E2J A;  2OKX A;  3CIH A;  1N95 B;  2XWB B;  3PZ3 B;  5M7I A;  1FMI A;  3DSW B;  3HXB B;  3SAE A;  3QSP A;  4D4A A;  3E34 B;  3DSV B;  1DOG A;  4L6X A;  4ZG8 A;  2VN7 A;  1KFG A;  4EHM B;  2WY7 A;  1FCE A;  3PZ2 B;  1TF4 A;  3P5P A;  1G9J A;  3KSQ B;  1TNU B;  3D3I A;  5DGR A;  2ZIR B;  3M78 A;  4GTQ B;  1H12 A;  1X9D A;  5M7Y A;  4KKI A;  2RI8 A;  1HZF A;  3VXD A;  1TN8 B;  4GTT B;  2H6G B;  1FPP B;  2BB5 A;  2BBC A;  4GTV B;  5GW7 A;  3K7X A;  3QG0 A;  2DRO A;  1O79 A;  1N9A B;  4L9P B;  4CE7 A;  3M71 A;  2AFA A;  3E6U A;  4WVA A;  1KSD A;  3W5M A;  3ACS A;  4FXK B;  2ZIS B;  5CD2 A;  2V8K A;  1TNB B;  2FBA A;  2Z07 A;  1H37 A;  3W7X A;  2EAC A;  2SQC A;  3PZ4 B;  1JCR B;  1FT2 B;  2A73 B;  3M7L A;  1V5D A;  3PYB A;  3ANI A;  3DSS B;  1XW2 A;  1D8D B;  2WYN A;  4GTS B;  3QFY A;  5MEH A;  3M75 A;  3D5R A;  1H54 A;  3Q7A B;  3M7C A;  1TN6 B;  1QBQ B;  2XWJ B;  4AYQ A;  1G6I A;  4D4B A;  4DOE A;  4LIX A;  2RI9 A;  2EAD A;  4MU9 A;  3P5R A;  1O1R B;  1NL4 B;  3REN A;  3E33 B;  2IEJ B;  3SDR A;  3P2C A;  3PZ1 B;  5FO7 B;  3QWT A;  4V1S A;  3E37 B;  4Z4J A;  2NVP A;  2DRR A;  2XQW A;  3ANK A;  1DCE B;  3SFX B;  1WU4 A;  3H7L A;  3KQ4 A;  3Q78 B;  4AYR A;  3ON6 A;  1QQF A;  1GLM A;  5JPM B;  1HCU A;  1RQ5 A;  4V1R A;  3E73 A;  1JS4 A;  1SQC A;  4TF4 A;  4EL8 A;  1QSJ A;  1L1Y A;  2V3N A;  1LTX B;  1F9O A;  3QFZ A;  3GT5 A;  4TXT A;  2XFG A;  1N4P B;  3E32 B;  4L0G A;  1ULV A;  3ACT A;  4GTO B;  1LF9 A;  1KKT A;  2FV1 A;  3WIQ A;  2WII B;  1KRF A;  3M7B A;  4WVC A;  5CA3 A;  1KWF A;  2FUZ A;  3EQA A;  1H3C A;  1IA7 A;  2NOJ A;  4QT9 A;  3SDT A;  3VW5 A;  3RRS A;  4MBG B;  5AGD A;  3TF4 A;  3WKF A;  1GXN A;  1XWQ A;  1GXM A;  1H3B A;  1IS9 A;  4LNV A;  3HXE B;  4GTP B;  1V7V A;  4J5T A;  1R76 A;  1TNY B;  4D4C A;  1NC5 A;  3GZK A;  2WIN B;  5JPN B;  3WUX A;  1O6R A;  1S64 B;  3DSX B;  1FO3 A;  1AGM A;  1N4S B;  3SDV A;  3S4C A;  1GAI A;  1DL2 A;  2DRS A;  3EU8 A;  4C1S A;  3SFY B;  3S4B A;  3EU5 B;  3SDQ A;  1H35 A;  3M74 A;  4D94 A;  2A8Z A;  1G9G A;  1TNO B;  5GY3 A;  3RX8 A;  1V7W A;  2GOX A;  3HXF B;  2G02 A;  2CQS A;  3Q79 B;  4WVB A;  5CZL A;  3RX7 A;  3RSY A;  3PYA A;  4Q88 A;  5FO9 B;  1W6J A;  3OED A;  4ONT A;  3M7E A;  4KTR A;  3ANJ A;  4Z4L A;  4CJ1 A;  3WIW A;  4GL3 A;  3D5S A;  4KTP A;  5FO8 B;  1O1S B;  1O1T B;  1WU5 A;  3QDE A;  4LNB B;  2QNO A;  4DOD A;  1UG9 A;  1KZO B;  2JJB A;  4D4D A;  2DRQ A;  5KKB A;  1H14 A;  2B4F A;  3S9V A;  1FAE A;  2RGK A;  1TN7 B;  3OXU A;  1K72 A;  1UT9 A;  2G0D A;  2EAB A;  3RX5 A;  4BOK A;  1KZP B;  1VD5 A;  1GA2 A;  3PMM A;  3M76 A;  1L2A A;  2H6H B;  3QT9 A;  2D8L A;  3DSU B;  3QRY A;  3EUV B;  1FP3 A;  4ZRQ A;  1D8E B;  1WU6 A;  4ZH1 A;  3QXQ A;  3HXD B;  1O5M B;  1GHQ A;  2ZBL A;  1W6K A;  2B39 A;  2V8J A;  4XUV A;  1JCS B;  1LD7 B;  4WU0 A;  1H13 A;  1GSZ A;  4GTM B;  5FOB B;  2FV0 A;  2D5J A;  2VN4 A;  1SA4 B;  2P0V A;  1CEM A;  4AYO A;  3W5N A;  1N4Q B;  3E30 B;  1FT1 B;  2I07 B;  1F9D A;  2JF4 A;  1LD8 B;  3WIR A;  3DPY B;  3HXC B;  4LNG B;  2JG0 A;  1H39 A;  1GXO A;  3M72 A;  4YDE B;  3WKI A;  3S4D A;  3SQC A;  3QXF A;  3K11 A;  1WZZ A;  4GTR B;  3Q75 B;  1NI1 B;  1X81 B;  3X17 A;  2EAE A;  2CQT A;  1XWT A;  1O6Q A;  3AFJ A;  1IA6 A;  1C3D A;  1S63 B;  4JJJ A;  5GZK A;  3M73 A;  4YCR A;  2BB6 A;  2AHG A;  1MZC B;  1JCQ B;  1GAH A;  3A3V A;  1FBW A;  3W7S A;  2V8I A;  3DRA B;  4YDO B;  3Q73 B;  2PMV A;  3S4A A;  4ZH5 A;  3H2W A;  2AHF A;  1SA5 B;  1V7X A;  4KKJ A;  1N4R B;  2ZZR A;  4AYP A;  3C72 B;  2YIK A;  1N94 B;  1UMP A;  3WKH A;  2F6D A;  1NXC A;  3DST B;  3CU7 A;  1KS8 A;  2R2L B;  3RJ3 A;  2GZ6 A;  3GLY A;  3WC3 A;  1FO2 A;  2BED B;  1V5C A;  2F0Y B;  4FXG B;  3EZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...