4F10A

Alginate lyase a1-iii h192a complexed with tetrasaccharide
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
353
structure length
353
Chain Sequence
GSHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNASYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHYQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alginate lyase
publication title Induced-fit motion of a lid loop involved in catalysis in alginate lyase A1-III
pubmed doi rcsb
source organism Sphingomonas
total genus 134
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4f10A00
1RWFA 3AFLA 1HM2A 1OJNA 2BRWA 4OZWA 1RWAA 4FNVA 4OZVA 4MMHA 4OK4A 1RWGA 1X1HA 4NEIA 1HMUA 1RW9A 3E7JA 4OJZA 1HV6A 4OK2A 1LXKA 1OJOA 2WCOA 1HN0A 2WDAA 2BRVX 1J0NA 1N7PA 1N7NA 1N7RA 3VSMA 1LXMA 1OJMA 1W3YA 3A0OA 5JMFA 1RWHA 1C82A 1RWCA 3NFVA 4MMIA 1EGUA 2BRPA 5JMDA 2E24A 1OJPA 2E22A 1HM3A 1LOHA 1X1IA 1I8QA 3NNBA 2FUQA 3E80A 4F10A 1QAZA 2X03A 4F13A 4E1YA 1CB8A 1F1SA 2FUTA 1F9GA 1J0MA 1N7QA 1X1JA 1N7OA 1HMWA 2Q1FA 3VSNA
chains in the Genus database with same CATH superfamily
1H3CA 3M7LA 3HXCB 4D4CA 4MMHA 2XWBB 1DOGA 4KTRA 4ZH1A 1N21A 4GL3A 4OJZA 5ILDA 1TNYB 1N4RB 3CIHA 1N22A 4LNBB 4CE7A 1N7RA 2DROA 5EAUA 3VXDA 1W3YA 4Z4LA 1N9AB 3SAEA 3P2CA 3NNBA 3ANJA 1O1RB 3H2WA 3KSLB 1X9DA 4C1SA 1N95B 4ONTA 5FO9B 5MEHA 2GOXA 3KQ4A 1C3DA 4GTMB 4TF4A 2RGKA 2WDAA 1JCSB 4FUSA 2V3PA 1LF9A 1TNZB 4MMIA 2P0VA 3X17A 2FBAA 1NXCA 3M7EA 2X03A 1DL2A 2DRQA 3WKGA 5FOBB 2GZ6A 5ILJA 1H54A 4GTSB 2ZZRA 3A3VA 4OZVA 3M7BA 2PMVA 3WIWA 4GTPB 3G4DA 4BOKA 1GSZA 3EU8A 3E73A 1KFGA 1UG9A 2BRVX 1GXOA 1SA5B 1D8EB 1UMPA 2JF4A 5IL3A 5DHIA 3G4FA 1FO2A 1FT2B 1O1SB 3Q79B 4KKIA 4TXTA 5IK6A 1H36A 2D5JA 1VD5A 5ILKA 5EATA 3Q7AB 5DGQA 5JPMB 3S9VA 2WINB 3OEDA 1GHQA 5EASA 1HCUA 2R2LB 5GY3A 1X1HA 1O6HA 1L2AA 1LF6A 3M72A 4WVCA 1WU4A 4V1SA 4DOEA 4AYPA 4JJJA 2ZIRB 3QT3A 2B39A 2ZBLA 1FAEA 3W7UA 1X81B 4ZRQA 3WIQA 1HZFA 4V1RA 1L1YA 2V3NA 1DCEB 2QNOA 5JPNB 2XFGA 4NEIA 2ZISB 4D4BA 2WYNA 1FBOA 5IKHA 3WKFA 5ILYA 4GTRB 4DODA 1HXCA 1LXMA 1H14A 2PN5A 2A73B 2AFAA 3E32B 1F9OA 3ACSA 3E80A 3ANKA 5KKBA 1O79A 4BOJA 1X1JA 3HXFB 5IK9A 1FP3A 1NI1B 2EADA 3HXBB 4WVAA 3W7XA 1NL4B 3RSYA 3T33A 4OZWA 3PYBA 1KREA 1RWGA 4KKJA 1F9DA 4LIXA 3PZ3B 3HXDB 4ZH5A 4OK2A 5GZKA 3K11A 3GT5A 2FV0A 3QT9A 2GH4A 5ILZA 1GA2A 3M71A 1CEMA 4FXGB 5JMFA 3M01A 3KSQB 2EACA 3M00A 2I07B 3WKHA 2XWJB 1H12A 1N7OA 3P5RA 3K7XA 2BBCA 3E37B 1R76A 1RWFA 3AFLA 4L9PB 1QSJA 3WUXA 3D3IA 5ILIA 1HMUA 3RX7A 1GAIA 5CD2A 1LXKA 1N1ZA 3D5RA 1N4PB 1O6QA 1V7XA 1N7NA 3S4DA 2J5CA 1SA4B 3DSTB 1C82A 4GTQB 1K72A 1EGUA 1W6KA 2BB5A 2JG0A 3RRSA 2FUQA 3M02A 4MBGB 1V7VA 3SDQA 3EQAA 4D4DA 1W6JA 1JCRB 1S64B 3PZ2B 3Q78B 3VSNA 4FJQA 2H6HB 4Q88A 1QBQB 5FO7B 3AFJA 1RQ5A 3GZKA 3M76A 4XUVA 3RJ3A 3LZ9A 1H39A 5IK0A 1N20A 3M75A 2JJBA 3PMMA 1G9GA 3WIRA 4YDEB 1HM3A 1IA6A 1TN6B 3RX5A 2CQTA 2FV1A 1H37A 2F6DA 3N0GA 4M76A 3EUVB 3W7WA 3OXUA 1G9JA 1GXNA 3EZ8A 3SDVA 1RWAA 1RW9A 1TNOB 3SFXB 1HV6A 2ONGA 3QWTA 4D4AA 4GTVB 3M78A 1TN7B 2G0DA 3W5NA 2EABA 4GTOB 4YCRA 1RWHA 3NFVA 3SDTA 4FXKB 1N24A 3QRYA 1S63B 4AYOA 1X1IA 4F10A 4E1YA 2RI9A 3M7CA 3QFZA 1O1TB 2V8IA 3E34B 5AGDA 3RENA 3S4BA 1HM2A 1QQFA 3SDUA 3DSWB 3E7JA 2WY8A 4LNGB 3TF4A 1XWTA 3W7SA 2FUZA 1IS9A 2H6GB 3VW5A 1N94B 1NC5A 1FBWA 2NVPA 3HXEB 2BRPA 5JMDA 1V7WA 2E22A 3DPYB 1FT1B 1I8QA 4ZRPA 4Q2BA 5FO8B 1AYXA 3KLSA 1HMWA 3DSSB 3E6UA 5E2JA 1FCEA 1H13A 2BRWA 2WIIB 5CA3A 1FO3A 4DI5A 3ANIA 1HN0A 1WZZA 1CLCA 1O5MB 1LD8B 2WY7A 4EHMB 2NOJA 3QXQA 5IKAA 2VN4A 1N4SB 2V8JA 4F13A 2CQSA 4WU0A 1G6IA 2FUTA 1GAHA 1F9GA 1J0MA 3M77A 1HX9A 2EAEA 3G6JB 3P5PA 4L0GA 1H35A 4LNVA 3E30B 5IM1A 4MU9A 1OJOA 2WCOA 3QPFA 1J0NA 2AHGA 3QFYA 1N4QB 1RWCA 2D8LA 4GTTB 3PZ1B 2RI8A 1LD7B 1LOHA 3M73A 4KTPA 4AYRA 1QAZA 1CB8A 1UT9A 1O6RA 4QT9A 1SQCA 1JS4A 3QXFA 4YDOB 1TNUB 3SFYB 3N0FA 4CJ0A 2XQWA 2DRRA 3ON6A 2DRSA 2B4FA 4Z4JA 2ONHA 5ILHA 3VSMA 2IEJB 3EU5B 3DSUB 2BEDB 4GAXA 4CJ1A 2E24A 1H3BA 3H7LA 3S4AA 1HXGA 1N1BA 4AYQA 1HXAA 1KZOB 3S4CA 5DHKA 1FMIA 1JCQB 3DSXB 2Q1FA 1ULVA 3Q7FB 5M7YA 1OJNA 2Z07A 4FNVA 3C72B 4WVBA 5C05A 1MZCB 1AGMA 1H3AA 1TNBB 3W7TA 4EL8A 4J5TA 1N7PA 3QSPA 5GW7A 3GLYA 2AHFA 1LTXB 1KZPB 1OJPA 1V5CA 1TN8B 3RX8A 5CZLA 4RNQA 1F1SA 2A8ZA 3DRAB 3Q73B 2H6IB 3SDRA 3WKIA 2SQCA 1IA7A 1XWQA 3ACTA 1GXMA 1WU6A 1FPPB 3D5SA 5M7IA 3W5MA 5DGRA 1V5DA 3QDEA 1TF4A 3CU7A 5IL8A 2G02A 2VN7A 4D94A 3PZ4B 1KSDA 1KKTA 1N7QA 3QG0A 3DSVB 3SQCA 2H6FB 3WC3A 3H3KA 1KRFA 2V8KA 4ZG8A 4OK4A 1KWFA 3Q75B 3E33B 1N23A 1KS8A 1WU5A 2OKXA 2YIKA 1D8DB 1KSCA 1GLMA 1OJMA 3A0OA 3PYAA 2F0YB 1G87A 3M74A 2BB6A 1XW2A 4L6XA
chains in the Genus database with same CATH topology
1RWFA 3AFLA 1HM2A 1OJNA 2BRWA 4OZWA 1RWAA 4FNVA 4OZVA 4MMHA 4OK4A 1RWGA 1X1HA 4NEIA 1HMUA 1RW9A 3E7JA 4OJZA 1HV6A 4OK2A 1LXKA 1OJOA 2WCOA 1HN0A 2WDAA 2BRVX 1J0NA 1N7PA 1N7NA 1N7RA 3VSMA 1LXMA 1OJMA 1W3YA 3A0OA 5JMFA 1RWHA 1C82A 1RWCA 3NFVA 4MMIA 1EGUA 2BRPA 5JMDA 2E24A 1OJPA 2E22A 1HM3A 1LOHA 1X1IA 1I8QA 3NNBA 2FUQA 3E80A 4F10A 1QAZA 2X03A 4F13A 4E1YA 1CB8A 1F1SA 2FUTA 1F9GA 1J0MA 1N7QA 1X1JA 1N7OA 1HMWA 2Q1FA 3VSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWF A;  3AFL A;  1HM2 A;  1OJN A;  2BRW A;  4OZW A;  1RWA A;  4FNV A;  4OZV A;  4MMH A;  4OK4 A;  1RWG A;  1X1H A;  4NEI A;  1HMU A;  1RW9 A;  3E7J A;  4OJZ A;  1HV6 A;  4OK2 A;  1LXK A;  1OJO A;  2WCO A;  1HN0 A;  2WDA A;  2BRV X;  1J0N A;  1N7P A;  1N7N A;  1N7R A;  3VSM A;  1LXM A;  1OJM A;  1W3Y A;  3A0O A;  5JMF A;  1RWH A;  1C82 A;  1RWC A;  3NFV A;  4MMI A;  1EGU A;  2BRP A;  5JMD A;  2E24 A;  1OJP A;  2E22 A;  1HM3 A;  1LOH A;  1X1I A;  1I8Q A;  3NNB A;  2FUQ A;  3E80 A;  4F10 A;  1QAZ A;  2X03 A;  4F13 A;  4E1Y A;  1CB8 A;  1F1S A;  2FUT A;  1F9G A;  1J0M A;  1N7Q A;  1X1J A;  1N7O A;  1HMW A;  2Q1F A;  3VSN A; 
#chains in the Genus database with same CATH topology
 1H3C A;  3M7L A;  3HXC B;  4D4C A;  4MMH A;  2XWB B;  1DOG A;  4KTR A;  4ZH1 A;  1N21 A;  4GL3 A;  4OJZ A;  5ILD A;  1TNY B;  1N4R B;  3CIH A;  1N22 A;  4LNB B;  4CE7 A;  1N7R A;  2DRO A;  5EAU A;  3VXD A;  1W3Y A;  4Z4L A;  1N9A B;  3SAE A;  3P2C A;  3NNB A;  3ANJ A;  1O1R B;  3H2W A;  3KSL B;  1X9D A;  4C1S A;  1N95 B;  4ONT A;  5FO9 B;  5MEH A;  2GOX A;  3KQ4 A;  1C3D A;  4GTM B;  4TF4 A;  2RGK A;  2WDA A;  1JCS B;  4FUS A;  2V3P A;  1LF9 A;  1TNZ B;  4MMI A;  2P0V A;  3X17 A;  2FBA A;  1NXC A;  3M7E A;  2X03 A;  1DL2 A;  2DRQ A;  3WKG A;  5FOB B;  2GZ6 A;  5ILJ A;  1H54 A;  4GTS B;  2ZZR A;  3A3V A;  4OZV A;  3M7B A;  2PMV A;  3WIW A;  4GTP B;  3G4D A;  4BOK A;  1GSZ A;  3EU8 A;  3E73 A;  1KFG A;  1UG9 A;  2BRV X;  1GXO A;  1SA5 B;  1D8E B;  1UMP A;  2JF4 A;  5IL3 A;  5DHI A;  3G4F A;  1FO2 A;  1FT2 B;  1O1S B;  3Q79 B;  4KKI A;  4TXT A;  5IK6 A;  1H36 A;  2D5J A;  1VD5 A;  5ILK A;  5EAT A;  3Q7A B;  5DGQ A;  5JPM B;  3S9V A;  2WIN B;  3OED A;  1GHQ A;  5EAS A;  1HCU A;  2R2L B;  5GY3 A;  1X1H A;  1O6H A;  1L2A A;  1LF6 A;  3M72 A;  4WVC A;  1WU4 A;  4V1S A;  4DOE A;  4AYP A;  4JJJ A;  2ZIR B;  3QT3 A;  2B39 A;  2ZBL A;  1FAE A;  3W7U A;  1X81 B;  4ZRQ A;  3WIQ A;  1HZF A;  4V1R A;  1L1Y A;  2V3N A;  1DCE B;  2QNO A;  5JPN B;  2XFG A;  4NEI A;  2ZIS B;  4D4B A;  2WYN A;  1FBO A;  5IKH A;  3WKF A;  5ILY A;  4GTR B;  4DOD A;  1HXC A;  1LXM A;  1H14 A;  2PN5 A;  2A73 B;  2AFA A;  3E32 B;  1F9O A;  3ACS A;  3E80 A;  3ANK A;  5KKB A;  1O79 A;  4BOJ A;  1X1J A;  3HXF B;  5IK9 A;  1FP3 A;  1NI1 B;  2EAD A;  3HXB B;  4WVA A;  3W7X A;  1NL4 B;  3RSY A;  3T33 A;  4OZW A;  3PYB A;  1KRE A;  1RWG A;  4KKJ A;  1F9D A;  4LIX A;  3PZ3 B;  3HXD B;  4ZH5 A;  4OK2 A;  5GZK A;  3K11 A;  3GT5 A;  2FV0 A;  3QT9 A;  2GH4 A;  5ILZ A;  1GA2 A;  3M71 A;  1CEM A;  4FXG B;  5JMF A;  3M01 A;  3KSQ B;  2EAC A;  3M00 A;  2I07 B;  3WKH A;  2XWJ B;  1H12 A;  1N7O A;  3P5R A;  3K7X A;  2BBC A;  3E37 B;  1R76 A;  1RWF A;  3AFL A;  4L9P B;  1QSJ A;  3WUX A;  3D3I A;  5ILI A;  1HMU A;  3RX7 A;  1GAI A;  5CD2 A;  1LXK A;  1N1Z A;  3D5R A;  1N4P B;  1O6Q A;  1V7X A;  1N7N A;  3S4D A;  2J5C A;  1SA4 B;  3DST B;  1C82 A;  4GTQ B;  1K72 A;  1EGU A;  1W6K A;  2BB5 A;  2JG0 A;  3RRS A;  2FUQ A;  3M02 A;  4MBG B;  1V7V A;  3SDQ A;  3EQA A;  4D4D A;  1W6J A;  1JCR B;  1S64 B;  3PZ2 B;  3Q78 B;  3VSN A;  4FJQ A;  2H6H B;  4Q88 A;  1QBQ B;  5FO7 B;  3AFJ A;  1RQ5 A;  3GZK A;  3M76 A;  4XUV A;  3RJ3 A;  3LZ9 A;  1H39 A;  5IK0 A;  1N20 A;  3M75 A;  2JJB A;  3PMM A;  1G9G A;  3WIR A;  4YDE B;  1HM3 A;  1IA6 A;  1TN6 B;  3RX5 A;  2CQT A;  2FV1 A;  1H37 A;  2F6D A;  3N0G A;  4M76 A;  3EUV B;  3W7W A;  3OXU A;  1G9J A;  1GXN A;  3EZ8 A;  3SDV A;  1RWA A;  1RW9 A;  1TNO B;  3SFX B;  1HV6 A;  2ONG A;  3QWT A;  4D4A A;  4GTV B;  3M78 A;  1TN7 B;  2G0D A;  3W5N A;  2EAB A;  4GTO B;  4YCR A;  1RWH A;  3NFV A;  3SDT A;  4FXK B;  1N24 A;  3QRY A;  1S63 B;  4AYO A;  1X1I A;  4F10 A;  4E1Y A;  2RI9 A;  3M7C A;  3QFZ A;  1O1T B;  2V8I A;  3E34 B;  5AGD A;  3REN A;  3S4B A;  1HM2 A;  1QQF A;  3SDU A;  3DSW B;  3E7J A;  2WY8 A;  4LNG B;  3TF4 A;  1XWT A;  3W7S A;  2FUZ A;  1IS9 A;  2H6G B;  3VW5 A;  1N94 B;  1NC5 A;  1FBW A;  2NVP A;  3HXE B;  2BRP A;  5JMD A;  1V7W A;  2E22 A;  3DPY B;  1FT1 B;  1I8Q A;  4ZRP A;  4Q2B A;  5FO8 B;  1AYX A;  3KLS A;  1HMW A;  3DSS B;  3E6U A;  5E2J A;  1FCE A;  1H13 A;  2BRW A;  2WII B;  5CA3 A;  1FO3 A;  4DI5 A;  3ANI A;  1HN0 A;  1WZZ A;  1CLC A;  1O5M B;  1LD8 B;  2WY7 A;  4EHM B;  2NOJ A;  3QXQ A;  5IKA A;  2VN4 A;  1N4S B;  2V8J A;  4F13 A;  2CQS A;  4WU0 A;  1G6I A;  2FUT A;  1GAH A;  1F9G A;  1J0M A;  3M77 A;  1HX9 A;  2EAE A;  3G6J B;  3P5P A;  4L0G A;  1H35 A;  4LNV A;  3E30 B;  5IM1 A;  4MU9 A;  1OJO A;  2WCO A;  3QPF A;  1J0N A;  2AHG A;  3QFY A;  1N4Q B;  1RWC A;  2D8L A;  4GTT B;  3PZ1 B;  2RI8 A;  1LD7 B;  1LOH A;  3M73 A;  4KTP A;  4AYR A;  1QAZ A;  1CB8 A;  1UT9 A;  1O6R A;  4QT9 A;  1SQC A;  1JS4 A;  3QXF A;  4YDO B;  1TNU B;  3SFY B;  3N0F A;  4CJ0 A;  2XQW A;  2DRR A;  3ON6 A;  2DRS A;  2B4F A;  4Z4J A;  2ONH A;  5ILH A;  3VSM A;  2IEJ B;  3EU5 B;  3DSU B;  2BED B;  4GAX A;  4CJ1 A;  2E24 A;  1H3B A;  3H7L A;  3S4A A;  1HXG A;  1N1B A;  4AYQ A;  1HXA A;  1KZO B;  3S4C A;  5DHK A;  1FMI A;  1JCQ B;  3DSX B;  2Q1F A;  1ULV A;  3Q7F B;  5M7Y A;  1OJN A;  2Z07 A;  4FNV A;  3C72 B;  4WVB A;  5C05 A;  1MZC B;  1AGM A;  1H3A A;  1TNB B;  3W7T A;  4EL8 A;  4J5T A;  1N7P A;  3QSP A;  5GW7 A;  3GLY A;  2AHF A;  1LTX B;  1KZP B;  1OJP A;  1V5C A;  1TN8 B;  3RX8 A;  5CZL A;  4RNQ A;  1F1S A;  2A8Z A;  3DRA B;  3Q73 B;  2H6I B;  3SDR A;  3WKI A;  2SQC A;  1IA7 A;  1XWQ A;  3ACT A;  1GXM A;  1WU6 A;  1FPP B;  3D5S A;  5M7I A;  3W5M A;  5DGR A;  1V5D A;  3QDE A;  1TF4 A;  3CU7 A;  5IL8 A;  2G02 A;  2VN7 A;  4D94 A;  3PZ4 B;  1KSD A;  1KKT A;  1N7Q A;  3QG0 A;  3DSV B;  3SQC A;  2H6F B;  3WC3 A;  3H3K A;  1KRF A;  2V8K A;  4ZG8 A;  4OK4 A;  1KWF A;  3Q75 B;  3E33 B;  1N23 A;  1KS8 A;  1WU5 A;  2OKX A;  2YIK A;  1D8D B;  1KSC A;  1GLM A;  1OJM A;  3A0O A;  3PYA A;  2F0Y B;  1G87 A;  3M74 A;  2BB6 A;  1XW2 A;  4L6X A; 
#chains in the Genus database with same CATH homology
 1RWF A;  3AFL A;  1HM2 A;  1OJN A;  2BRW A;  4OZW A;  1RWA A;  4FNV A;  4OZV A;  4MMH A;  4OK4 A;  1RWG A;  1X1H A;  4NEI A;  1HMU A;  1RW9 A;  3E7J A;  4OJZ A;  1HV6 A;  4OK2 A;  1LXK A;  1OJO A;  2WCO A;  1HN0 A;  2WDA A;  2BRV X;  1J0N A;  1N7P A;  1N7N A;  1N7R A;  3VSM A;  1LXM A;  1OJM A;  1W3Y A;  3A0O A;  5JMF A;  1RWH A;  1C82 A;  1RWC A;  3NFV A;  4MMI A;  1EGU A;  2BRP A;  5JMD A;  2E24 A;  1OJP A;  2E22 A;  1HM3 A;  1LOH A;  1X1I A;  1I8Q A;  3NNB A;  2FUQ A;  3E80 A;  4F10 A;  1QAZ A;  2X03 A;  4F13 A;  4E1Y A;  1CB8 A;  1F1S A;  2FUT A;  1F9G A;  1J0M A;  1N7Q A;  1X1J A;  1N7O A;  1HMW A;  2Q1F A;  3VSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...