4F10A

Alginate lyase a1-iii h192a complexed with tetrasaccharide
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
353
structure length
353
Chain Sequence
GSHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNASYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHYQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSATLLAYKPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate lyase
publication title Induced-fit motion of a lid loop involved in catalysis in alginate lyase A1-III
pubmed doi rcsb
source organism Sphingomonas
molecule tags Lyase
total genus 134
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4f10A00
4OZVA 1EGUA 2Q1FA 1HM3A 2WCOA 1OJMA 3E80A 3AFLA 1F1SA 1X1HA 5JMFA 3A0OA 1LXMA 1HM2A 2FUTA 3E7JA 1LXKA 2E22A 1RWAA 4NEIA 1I8QA 1J0NA 1OJNA 1RWCA 2BRWA 4OK2A 1N7QA 1HMUA 4MMHA 1RWFA 1CB8A 1N7NA 1N7OA 1RWHA 1HN0A 1X1IA 1RW9A 2WDAA 4OZWA 2BRVX 1OJOA 3VSNA 4E1YA 1C82A 1N7RA 4OJZA 4F10A 1OJPA 1LOHA 1W3YA 1HMWA 1HV6A 4OK4A 2E24A 1QAZA 4MMIA 2FUQA 3NFVA 4FNVA 1J0MA 1RWGA 2BRPA 3VSMA 4F13A 1X1JA 3NNBA 5JMDA 2X03A 1N7PA 1F9GA
chains in the Genus database with same CATH superfamily
4L6XA 2B39A 1FO2A 1LXMA 4FUSA 3HXCB 1FP3A 1RWCA 1X9DA 2BRWA 3Q79B 3SFYB 3T33A 3W7XA 2EACA 3ANJA 2WDAA 3QRYA 3PYBA 3KLSA 4E1YA 3M7EA 1HMWA 1SQCA 1FT1B 4M76A 2VN7A 3ON6A 4KKIA 2ONGA 2R2LB 3E37B 3H2WA 2G02A 5DHKA 3DSWB 3NNBA 2Z07A 3W7UA 1QQFA 2Q1FA 1FPPB 3D5SA 3QPFA 5KKBA 4GTRB 3S4DA 1RWFA 3QXFA 3EU8A 1GHQA 1N20A 1RW9A 4D4DA 2F0YB 4CJ0A 1H13A 2DRRA 1HXAA 3QSPA 2WY8A 3QG0A 1TN8B 3D3IA 4J5TA 1FBOA 1O1SB 4YDOB 4FNVA 4DOEA 3QWTA 4Z4JA 4GTTB 5JMDA 1TF4A 5JPNB 1TN6B 2WCOA 1X81B 2V8JA 2WYNA 3AFLA 3SDTA 1F9OA 2AHFA 3M76A 1HMUA 3ANIA 3AFJA 1V7XA 3S9VA 4WVBA 3M02A 5ILZA 5IK9A 2EABA 3HXEB 4FXKB 4GTQB 3RRSA 1FBWA 1WU5A 1CLCA 1UMPA 2ONHA 5C05A 1O6QA 3C72B 1D8DB 5M7IA 5FO8B 4AYOA 1OJOA 3P5PA 4YCRA 4V1RA 3N0GA 1N21A 1NXCA 2FUTA 4CJ1A 2A8ZA 3P5RA 2CQTA 1FT2B 4BOKA 1X1IA 2DRQA 3HXDB 1KSDA 4F10A 5FO7B 2EAEA 3ACTA 3M71A 3RENA 5AGDA 3WKGA 2FUQA 1ULVA 3LZ9A 4AYQA 1GXOA 3GZKA 2D5JA 1N4QB 1F9GA 3S4CA 2D8LA 4GTMB 1KSCA 4MU9A 3EZ8A 1SA5B 5EASA 1IS9A 2XFGA 1OJNA 5CZLA 4GTOB 4LNBB 1H14A 4L0GA 1G87A 3OXUA 3VSNA 5IM1A 4TXTA 1DL2A 3M72A 1LD8B 2E24A 1H54A 3CU7A 1K72A 1WZZA 5EAUA 3QT9A 3EQAA 1H37A 4OZVA 3W7WA 1F1SA 5JMFA 1F9DA 1H12A 3DSUB 3E6UA 2BB6A 3E34B 1RQ5A 2NOJA 3G4DA 1N7OA 3SAEA 3G4FA 4OZWA 1N4RB 1KKTA 1XW2A 3W5MA 2ZZRA 1N23A 1MZCB 4LNVA 2JG0A 3WIWA 1NC5A 1QAZA 1G9JA 2GZ6A 4KTPA 4JJJA 1J0MA 1JS4A 3QFZA 3Q7FB 3PZ4B 3WKHA 1N7PA 2FBAA 1AYXA 1V5CA 2H6GB 2WIIB 1X1HA 4DI5A 1N95B 4AYRA 3WIRA 5DGRA 1H3CA 2P0VA 5M7YA 1V7WA 2RGKA 4WVAA 4OJZA 1OJPA 3D5RA 3PMMA 1O79A 1IA6A 3A3VA 1QBQB 5FO9B 3W7SA 1IA7A 2AHGA 4KTRA 2BBCA 1H35A 1DOGA 4L9PB 3M00A 3E80A 5ILIA 2RI9A 3QFYA 4V1SA 2NVPA 4ZRPA 4FXGB 3KSQB 1N7NA 2V8IA 3WKFA 2I07B 3VW5A 3RSYA 3S4BA 4LIXA 2WINB 4D4AA 4ZG8A 3N0FA 2CQSA 1HX9A 3EUVB 3TF4A 1O5MB 1TNZB 2H6FB 3PZ2B 1GXNA 3DPYB 1L2AA 1EGUA 2QNOA 1OJMA 2WY7A 3ACSA 1LXKA 2E22A 2YIKA 3DSSB 3WUXA 3K11A 3HXFB 1D8EB 3PYAA 5IL3A 2B4FA 2GOXA 4ONTA 2XQWA 1W3YA 1KREA 1HV6A 1N4PB 1H3AA 2SQCA 3H7LA 3SDVA 1O6HA 2PMVA 3M73A 1RWGA 5IK6A 2GH4A 2JJBA 3VSMA 3H3KA 3KQ4A 1W6JA 4ZH1A 1KFGA 1AGMA 1GA2A 1N4SB 2AFAA 4KKJA 1I8QA 1VD5A 3OEDA 1FMIA 3QDEA 3WIQA 4D94A 1H36A 1O1TB 4ZH5A 2PN5A 2RI8A 1C82A 1O6RA 1R76A 3E73A 2OKXA 3GLYA 1V7VA 4XUVA 1HXCA 5ILKA 1FAEA 5IKHA 1W6KA 1TN7B 4Q2BA 4GL3A 4CE7A 2F6DA 1LTXB 4C1SA 3VXDA 2DROA 1NL4B 2J5CA 1KZPB 1N7RA 1LOHA 2G0DA 2DRSA 1FO3A 4D4CA 4DODA 3HXBB 3PZ3B 1HCUA 1LD7B 2EADA 3DSTB 3E32B 2BRPA 1S63B 1TNOB 3DSVB 4LNGB 1TNUB 1HM3A 4D4BA 3S4AA 1H3BA 3SFXB 1RWAA 1TNYB 2FV1A 3M7BA 2BB5A 1HXGA 1N7QA 5EATA 3SDRA 1G6IA 5ILDA 1H39A 3RX7A 5JPMB 3E33B 2BRVX 4FJQA 3Q73B 3DSXB 1UG9A 5E2JA 4MBGB 4WVCA 3X17A 1GAHA 5FOBB 3NFVA 3W5NA 3QXQA 3KSLB 3DRAB 3SDQA 3W7TA 3P2CA 3Q75B 5ILYA 3M78A 5MEHA 4EL8A 4Q88A 1WU6A 1V5DA 1CB8A 1N1ZA 1RWHA 4GAXA 1KWFA 4WU0A 5ILHA 4QT9A 1FCEA 1LF9A 1UT9A 1GSZA 1X1JA 1O1RB 2X03A 1GXMA 4GTVB 2ZIRB 4ZRQA 3ANKA 1L1YA 3M7CA 2V3PA 4RNQA 3EU5B 1KS8A 3PZ1B 1N1BA 3QT3A 1JCQB 1C3DA 1XWTA 5DHIA 1WU4A 3Q7AB 4MMIA 3CIHA 2H6HB 4TF4A 2ZBLA 1N22A 3G6JB 2BEDB 5IKAA 3RX5A 1XWQA 2H6IB 5DGQA 3WKIA 3SDUA 1LF6A 1N9AB 1NI1B 5GY3A 2FUZA 1DCEB 4AYPA 2V3NA 1JCRB 3M74A 5CA3A 5ILJA 5GZKA 1KRFA 1G9GA 1KZOB 2VN4A 3GT5A 2V8KA 1N94B 5IK0A 3SQCA 1CEMA 4F13A 1TNBB 4BOJA 3M01A 3Q78B 3M75A 1GLMA 2JF4A 3A0OA 1HM2A 4Z4LA 1N24A 3E7JA 1QSJA 4NEIA 2IEJB 1J0NA 4OK2A 4MMHA 3M7LA 4EHMB 5IL8A 1JCSB 3WC3A 1HN0A 3RX8A 4YDEB 1GAIA 3E30B 3K7XA 5CD2A 3M77A 2XWJB 1HZFA 3RJ3A 4OK4A 5GW7A 2ZISB 1SA4B 2A73B 1S64B 4GTSB 4GTPB 2FV0A 2XWBB
chains in the Genus database with same CATH topology
4OZVA 1EGUA 2Q1FA 1HM3A 2WCOA 1OJMA 3E80A 3AFLA 1F1SA 1X1HA 5JMFA 3A0OA 1LXMA 1HM2A 2FUTA 3E7JA 1LXKA 2E22A 1RWAA 4NEIA 1I8QA 1J0NA 1OJNA 1RWCA 2BRWA 4OK2A 1N7QA 1HMUA 4MMHA 1RWFA 1CB8A 1N7NA 1N7OA 1RWHA 1HN0A 1X1IA 1RW9A 2WDAA 4OZWA 2BRVX 1OJOA 3VSNA 4E1YA 1C82A 1N7RA 4OJZA 4F10A 1OJPA 1LOHA 1W3YA 1HMWA 1HV6A 4OK4A 2E24A 1QAZA 4MMIA 2FUQA 3NFVA 4FNVA 1J0MA 1RWGA 2BRPA 3VSMA 4F13A 1X1JA 3NNBA 5JMDA 2X03A 1N7PA 1F9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZV A;  1EGU A;  2Q1F A;  1HM3 A;  2WCO A;  1OJM A;  3E80 A;  3AFL A;  1F1S A;  1X1H A;  5JMF A;  3A0O A;  1LXM A;  1HM2 A;  2FUT A;  3E7J A;  1LXK A;  2E22 A;  1RWA A;  4NEI A;  1I8Q A;  1J0N A;  1OJN A;  1RWC A;  2BRW A;  4OK2 A;  1N7Q A;  1HMU A;  4MMH A;  1RWF A;  1CB8 A;  1N7N A;  1N7O A;  1RWH A;  1HN0 A;  1X1I A;  1RW9 A;  2WDA A;  4OZW A;  2BRV X;  1OJO A;  3VSN A;  4E1Y A;  1C82 A;  1N7R A;  4OJZ A;  4F10 A;  1OJP A;  1LOH A;  1W3Y A;  1HMW A;  1HV6 A;  4OK4 A;  2E24 A;  1QAZ A;  4MMI A;  2FUQ A;  3NFV A;  4FNV A;  1J0M A;  1RWG A;  2BRP A;  3VSM A;  4F13 A;  1X1J A;  3NNB A;  5JMD A;  2X03 A;  1N7P A;  1F9G A; 
#chains in the Genus database with same CATH topology
 4L6X A;  2B39 A;  1FO2 A;  1LXM A;  4FUS A;  3HXC B;  1FP3 A;  1RWC A;  1X9D A;  2BRW A;  3Q79 B;  3SFY B;  3T33 A;  3W7X A;  2EAC A;  3ANJ A;  2WDA A;  3QRY A;  3PYB A;  3KLS A;  4E1Y A;  3M7E A;  1HMW A;  1SQC A;  1FT1 B;  4M76 A;  2VN7 A;  3ON6 A;  4KKI A;  2ONG A;  2R2L B;  3E37 B;  3H2W A;  2G02 A;  5DHK A;  3DSW B;  3NNB A;  2Z07 A;  3W7U A;  1QQF A;  2Q1F A;  1FPP B;  3D5S A;  3QPF A;  5KKB A;  4GTR B;  3S4D A;  1RWF A;  3QXF A;  3EU8 A;  1GHQ A;  1N20 A;  1RW9 A;  4D4D A;  2F0Y B;  4CJ0 A;  1H13 A;  2DRR A;  1HXA A;  3QSP A;  2WY8 A;  3QG0 A;  1TN8 B;  3D3I A;  4J5T A;  1FBO A;  1O1S B;  4YDO B;  4FNV A;  4DOE A;  3QWT A;  4Z4J A;  4GTT B;  5JMD A;  1TF4 A;  5JPN B;  1TN6 B;  2WCO A;  1X81 B;  2V8J A;  2WYN A;  3AFL A;  3SDT A;  1F9O A;  2AHF A;  3M76 A;  1HMU A;  3ANI A;  3AFJ A;  1V7X A;  3S9V A;  4WVB A;  3M02 A;  5ILZ A;  5IK9 A;  2EAB A;  3HXE B;  4FXK B;  4GTQ B;  3RRS A;  1FBW A;  1WU5 A;  1CLC A;  1UMP A;  2ONH A;  5C05 A;  1O6Q A;  3C72 B;  1D8D B;  5M7I A;  5FO8 B;  4AYO A;  1OJO A;  3P5P A;  4YCR A;  4V1R A;  3N0G A;  1N21 A;  1NXC A;  2FUT A;  4CJ1 A;  2A8Z A;  3P5R A;  2CQT A;  1FT2 B;  4BOK A;  1X1I A;  2DRQ A;  3HXD B;  1KSD A;  4F10 A;  5FO7 B;  2EAE A;  3ACT A;  3M71 A;  3REN A;  5AGD A;  3WKG A;  2FUQ A;  1ULV A;  3LZ9 A;  4AYQ A;  1GXO A;  3GZK A;  2D5J A;  1N4Q B;  1F9G A;  3S4C A;  2D8L A;  4GTM B;  1KSC A;  4MU9 A;  3EZ8 A;  1SA5 B;  5EAS A;  1IS9 A;  2XFG A;  1OJN A;  5CZL A;  4GTO B;  4LNB B;  1H14 A;  4L0G A;  1G87 A;  3OXU A;  3VSN A;  5IM1 A;  4TXT A;  1DL2 A;  3M72 A;  1LD8 B;  2E24 A;  1H54 A;  3CU7 A;  1K72 A;  1WZZ A;  5EAU A;  3QT9 A;  3EQA A;  1H37 A;  4OZV A;  3W7W A;  1F1S A;  5JMF A;  1F9D A;  1H12 A;  3DSU B;  3E6U A;  2BB6 A;  3E34 B;  1RQ5 A;  2NOJ A;  3G4D A;  1N7O A;  3SAE A;  3G4F A;  4OZW A;  1N4R B;  1KKT A;  1XW2 A;  3W5M A;  2ZZR A;  1N23 A;  1MZC B;  4LNV A;  2JG0 A;  3WIW A;  1NC5 A;  1QAZ A;  1G9J A;  2GZ6 A;  4KTP A;  4JJJ A;  1J0M A;  1JS4 A;  3QFZ A;  3Q7F B;  3PZ4 B;  3WKH A;  1N7P A;  2FBA A;  1AYX A;  1V5C A;  2H6G B;  2WII B;  1X1H A;  4DI5 A;  1N95 B;  4AYR A;  3WIR A;  5DGR A;  1H3C A;  2P0V A;  5M7Y A;  1V7W A;  2RGK A;  4WVA A;  4OJZ A;  1OJP A;  3D5R A;  3PMM A;  1O79 A;  1IA6 A;  3A3V A;  1QBQ B;  5FO9 B;  3W7S A;  1IA7 A;  2AHG A;  4KTR A;  2BBC A;  1H35 A;  1DOG A;  4L9P B;  3M00 A;  3E80 A;  5ILI A;  2RI9 A;  3QFY A;  4V1S A;  2NVP A;  4ZRP A;  4FXG B;  3KSQ B;  1N7N A;  2V8I A;  3WKF A;  2I07 B;  3VW5 A;  3RSY A;  3S4B A;  4LIX A;  2WIN B;  4D4A A;  4ZG8 A;  3N0F A;  2CQS A;  1HX9 A;  3EUV B;  3TF4 A;  1O5M B;  1TNZ B;  2H6F B;  3PZ2 B;  1GXN A;  3DPY B;  1L2A A;  1EGU A;  2QNO A;  1OJM A;  2WY7 A;  3ACS A;  1LXK A;  2E22 A;  2YIK A;  3DSS B;  3WUX A;  3K11 A;  3HXF B;  1D8E B;  3PYA A;  5IL3 A;  2B4F A;  2GOX A;  4ONT A;  2XQW A;  1W3Y A;  1KRE A;  1HV6 A;  1N4P B;  1H3A A;  2SQC A;  3H7L A;  3SDV A;  1O6H A;  2PMV A;  3M73 A;  1RWG A;  5IK6 A;  2GH4 A;  2JJB A;  3VSM A;  3H3K A;  3KQ4 A;  1W6J A;  4ZH1 A;  1KFG A;  1AGM A;  1GA2 A;  1N4S B;  2AFA A;  4KKJ A;  1I8Q A;  1VD5 A;  3OED A;  1FMI A;  3QDE A;  3WIQ A;  4D94 A;  1H36 A;  1O1T B;  4ZH5 A;  2PN5 A;  2RI8 A;  1C82 A;  1O6R A;  1R76 A;  3E73 A;  2OKX A;  3GLY A;  1V7V A;  4XUV A;  1HXC A;  5ILK A;  1FAE A;  5IKH A;  1W6K A;  1TN7 B;  4Q2B A;  4GL3 A;  4CE7 A;  2F6D A;  1LTX B;  4C1S A;  3VXD A;  2DRO A;  1NL4 B;  2J5C A;  1KZP B;  1N7R A;  1LOH A;  2G0D A;  2DRS A;  1FO3 A;  4D4C A;  4DOD A;  3HXB B;  3PZ3 B;  1HCU A;  1LD7 B;  2EAD A;  3DST B;  3E32 B;  2BRP A;  1S63 B;  1TNO B;  3DSV B;  4LNG B;  1TNU B;  1HM3 A;  4D4B A;  3S4A A;  1H3B A;  3SFX B;  1RWA A;  1TNY B;  2FV1 A;  3M7B A;  2BB5 A;  1HXG A;  1N7Q A;  5EAT A;  3SDR A;  1G6I A;  5ILD A;  1H39 A;  3RX7 A;  5JPM B;  3E33 B;  2BRV X;  4FJQ A;  3Q73 B;  3DSX B;  1UG9 A;  5E2J A;  4MBG B;  4WVC A;  3X17 A;  1GAH A;  5FOB B;  3NFV A;  3W5N A;  3QXQ A;  3KSL B;  3DRA B;  3SDQ A;  3W7T A;  3P2C A;  3Q75 B;  5ILY A;  3M78 A;  5MEH A;  4EL8 A;  4Q88 A;  1WU6 A;  1V5D A;  1CB8 A;  1N1Z A;  1RWH A;  4GAX A;  1KWF A;  4WU0 A;  5ILH A;  4QT9 A;  1FCE A;  1LF9 A;  1UT9 A;  1GSZ A;  1X1J A;  1O1R B;  2X03 A;  1GXM A;  4GTV B;  2ZIR B;  4ZRQ A;  3ANK A;  1L1Y A;  3M7C A;  2V3P A;  4RNQ A;  3EU5 B;  1KS8 A;  3PZ1 B;  1N1B A;  3QT3 A;  1JCQ B;  1C3D A;  1XWT A;  5DHI A;  1WU4 A;  3Q7A B;  4MMI A;  3CIH A;  2H6H B;  4TF4 A;  2ZBL A;  1N22 A;  3G6J B;  2BED B;  5IKA A;  3RX5 A;  1XWQ A;  2H6I B;  5DGQ A;  3WKI A;  3SDU A;  1LF6 A;  1N9A B;  1NI1 B;  5GY3 A;  2FUZ A;  1DCE B;  4AYP A;  2V3N A;  1JCR B;  3M74 A;  5CA3 A;  5ILJ A;  5GZK A;  1KRF A;  1G9G A;  1KZO B;  2VN4 A;  3GT5 A;  2V8K A;  1N94 B;  5IK0 A;  3SQC A;  1CEM A;  4F13 A;  1TNB B;  4BOJ A;  3M01 A;  3Q78 B;  3M75 A;  1GLM A;  2JF4 A;  3A0O A;  1HM2 A;  4Z4L A;  1N24 A;  3E7J A;  1QSJ A;  4NEI A;  2IEJ B;  1J0N A;  4OK2 A;  4MMH A;  3M7L A;  4EHM B;  5IL8 A;  1JCS B;  3WC3 A;  1HN0 A;  3RX8 A;  4YDE B;  1GAI A;  3E30 B;  3K7X A;  5CD2 A;  3M77 A;  2XWJ B;  1HZF A;  3RJ3 A;  4OK4 A;  5GW7 A;  2ZIS B;  1SA4 B;  2A73 B;  1S64 B;  4GTS B;  4GTP B;  2FV0 A;  2XWB B; 
#chains in the Genus database with same CATH homology
 4OZV A;  1EGU A;  2Q1F A;  1HM3 A;  2WCO A;  1OJM A;  3E80 A;  3AFL A;  1F1S A;  1X1H A;  5JMF A;  3A0O A;  1LXM A;  1HM2 A;  2FUT A;  3E7J A;  1LXK A;  2E22 A;  1RWA A;  4NEI A;  1I8Q A;  1J0N A;  1OJN A;  1RWC A;  2BRW A;  4OK2 A;  1N7Q A;  1HMU A;  4MMH A;  1RWF A;  1CB8 A;  1N7N A;  1N7O A;  1RWH A;  1HN0 A;  1X1I A;  1RW9 A;  2WDA A;  4OZW A;  2BRV X;  1OJO A;  3VSN A;  4E1Y A;  1C82 A;  1N7R A;  4OJZ A;  4F10 A;  1OJP A;  1LOH A;  1W3Y A;  1HMW A;  1HV6 A;  4OK4 A;  2E24 A;  1QAZ A;  4MMI A;  2FUQ A;  3NFV A;  4FNV A;  1J0M A;  1RWG A;  2BRP A;  3VSM A;  4F13 A;  1X1J A;  3NNB A;  5JMD A;  2X03 A;  1N7P A;  1F9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...