2GOXA

Crystal structure of efb-c / c3d complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
297
structure length
297
Chain Sequence
GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/toxin
molecule keywords Complement C3
publication title A structural basis for complement inhibition by Staphylococcus aureus.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 297
sequence length 297
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2goxA00
2R2LB 2H6FB 3SFXB 4D4BA 1TNUB 3Q7AB 4LNGB 2SQCA 4KKJA 1KZPB 1FT2B 1QSJA 2XWJB 1LD7B 4M76A 1N9AB 3K7XA 3OEDA 1NL4B 1X81B 4GTOB 3DSXB 4LNVA 5FO7B 1H35A 2V3NA 1JCQB 3EUVB 2WY7A 3E33B 4GTRB 4GTSB 2NOJA 1N4RB 2V8IA 4C1SA 4L9PB 1S63B 2XQWA 5JPMB 1N95B 3Q73B 4V1SA 1C3DA 2H6IB 4GTVB 1FT1B 2ZIRB 1GXMA 1R76A 3E30B 1O1TB 1GHQA 1H39A 1SA4B 1H37A 1D8DB 1O6HA 1TNOB 1TN6B 2V3PA 2V8JA 5JPNB 1O79A 3RJ3A 3PZ3B 3DSUB 3DSTB 4GTQB 1KZOB 4YDOB 3D5SA 1O1RB 2F0YB 4GTTB 3PZ1B 1GSZA 1HZFA 3HXBB 3E37B 4FXKB 4D94A 4KKIA 3CU7A 1H36A 3OXUA 3Q79B 2PMVA 2BEDB 1GXOA 3DSWB 4GTMB 1TNYB 2XWBB 1JCSB 1TNZB 1W6JA 4D4CA 3PZ2B 1LD8B 2H6HB 4YDEB 1N4SB 3C72B 1H3CA 1N4QB 1NI1B 2B39A 1W6KA 3DPYB 2PN5A 1H3BA 4BOJA 4ZH1A 3DSVB 1O6RA 2V8KA 3KQ4A 1UMPA 4EHMB 1O1SB 2A73B 1N4PB 3HXDB 3DRAB 2WIIB 3Q75B 2BB5A 2G0DA 1GXNA 1TN8B 3EU5B 3HXCB 3E32B 1FPPB 3KLSA 1JCRB 5AGDA 1O6QA 3E34B 4D4DA 1N94B 1SQCA 5FO9B 4ZRQA 2BBCA 1TN7B 5FOBB 1DCEB 4V1RA 2G02A 4FXGB 1QQFA 1TNBB 2GOXA 2ZISB 4ONTA 4MBGB 3Q7FB 1D8EB 4D4AA 5FO8B 3SQCA 2IEJB 2BB6A 1MZCB 4LNBB 1H3AA 3G6JB 4ZRPA 2H6GB 4GTPB 3PZ4B 3SFYB 3HXEB 2WINB 2I07B 1S64B 1QBQB 4BOKA 1SA5B 3DSSB 3KSLB 3Q78B 3KSQB 2WY8A 1O5MB 3HXFB 4MU9A 3D5RA 1LTXB
chains in the Genus database with same CATH superfamily
3RX8A 1GAHA 3H7LA 1IA6A 5C05A 1LXKA 2BRWA 1KZPB 1LD7B 2CQTA 1GLMA 3RX7A 1NL4B 2WYNA 1H35A 1N7OA 2WY7A 3P5RA 1N4RB 1N7RA 1V7VA 4L9PB 2XQWA 2Z07A 5JPMB 1C3DA 4J5TA 1AYXA 1FT1B 3E30B 1GXMA 3E80A 5IL3A 1FAEA 1SA4B 1HMUA 3N0GA 1O79A 3ANKA 5DGQA 3SDTA 3N0FA 4GTQB 1KZOB 4GTTB 4D94A 1WZZA 3CU7A 5E2JA 1H36A 1N7QA 1H13A 2XWBB 2JG0A 1HN0A 3PZ2B 3SDQA 3ON6A 1LD8B 4YDEB 1AGMA 1KSDA 2FUZA 4OK4A 2B39A 4ZH1A 4BOJA 1O6RA 2DRSA 3GT5A 4DOEA 3K11A 3HXDB 3E73A 3ANJA 1X1JA 2BB5A 3TF4A 1TN8B 3NNBA 3W5NA 1X1IA 1FPPB 3E32B 3RSYA 3M02A 4OZVA 1IA7A 2ONHA 1SQCA 1F1SA 2BBCA 1TNBB 5ILIA 3Q7FB 1HV6A 4Z4LA 2WINB 1X9DA 2RI8A 3DSSB 3M73A 3KSQB 1X1HA 3HXFB 4FUSA 3QRYA 3QDEA 2R2LB 4OJZA 2BRPA 1G9GA 2ZBLA 3D3IA 3RRSA 5DHKA 2DROA 5DGRA 3OEDA 1FO2A 1X81B 2ZZRA 3SAEA 1KS8A 2ONGA 4MMHA 5FO7B 2X03A 1I8QA 2WDAA 1G9JA 3EUVB 3E33B 4GTSB 5MEHA 2V8IA 1G87A 4C1SA 4XUVA 5GZKA 3Q73B 5KKBA 1N21A 1KFGA 1RW9A 3WKHA 2YIKA 5ILYA 1H39A 1D8DB 2V8JA 3P5PA 3AFLA 1RWGA 1V5CA 3PZ3B 3VXDA 5ILZA 3H3KA 1N24A 4YDOB 3WC3A 3E37B 4FNVA 4KKIA 1OJNA 3WKGA 3OXUA 3M72A 3Q79B 1RWCA 1TNYB 4FJQA 4TF4A 4YCRA 3P2CA 1V7XA 1W6JA 3M75A 1H12A 4L0GA 3RENA 1KREA 3C72B 3EU8A 1JS4A 2D8LA 2PN5A 1H3BA 3EZ8A 3QWTA 3DSVB 2FUTA 4WVBA 4RNQA 3W7SA 1N7NA 3M7EA 1NXCA 1UMPA 5IL8A 2FBAA 1O1SB 2CQSA 2A73B 1WU5A 1K72A 1V7WA 2WIIB 3WIRA 4Z4JA 3GZKA 4AYQA 5M7YA 2EACA 2D5JA 2FV1A 1O6QA 3ACTA 1G6IA 2RGKA 1LOHA 1N94B 3M00A 5FOBB 3W7WA 4V1RA 2AHGA 4FXGB 1QQFA 5IK9A 4MBGB 4D4AA 3SDVA 1UG9A 2IEJB 2QNOA 3RX5A 3G6JB 4ZRPA 5IKHA 4GTPB 3SFYB 3S9VA 4BOKA 4CJ1A 4WU0A 4OZWA 3E7JA 5M7IA 2WY8A 5ILHA 3QT3A 1CLCA 1IS9A 3QSPA 2J5CA 3D5RA 5JMFA 3VW5A 4D4BA 1LF9A 1KWFA 2P0VA 1FT2B 2XWJB 3WKIA 3K7XA 3M77A 2FUQA 4QT9A 4GTOB 5CZLA 2WCOA 2V3NA 5IM1A 1XWQA 3T33A 1S63B 1N95B 4V1SA 2H6IB 1TF4A 4GAXA 3A0OA 1O1TB 1C82A 3KSLB 5JMDA 1H37A 1J0NA 1HXAA 1TNOB 2V3PA 3QT9A 3X17A 5JPNB 3M78A 2NVPA 3VSNA 3RJ3A 3DSUB 1W3YA 3DSTB 1XW2A 1H54A 3D5SA 2F0YB 1DL2A 1GSZA 1CB8A 1J0MA 1HZFA 4ZG8A 1WU4A 2BRVX 2BEDB 1GXOA 3M71A 1TNZB 1H14A 3QG0A 3WUXA 2EABA 1KRFA 2H6HB 2DRQA 3S4AA 1N4SB 1H3CA 1W6KA 2VN7A 3DPYB 3EQAA 1N1BA 1F9OA 2B4FA 3H2WA 2EADA 3WIWA 1HCUA 4EHMB 2DRRA 3A3VA 1GA2A 2F6DA 3M76A 3Q75B 2AFAA 1GXNA 1ULVA 4NEIA 3KLSA 3G4DA 4ZH5A 1FCEA 2Q1FA 5CA3A 1RWAA 4D4DA 2AHFA 5CD2A 4DI5A 2G02A 1HM3A 2GOXA 2ZISB 1D8EB 5FO8B 5IK0A 3SQCA 4LNBB 5EATA 1H3AA 3M01A 3HXEB 2GH4A 1QBQB 3PYAA 1SA5B 4Q88A 3Q78B 1O5MB 5DHIA 1F9DA 5GY3A 3SDUA 1V5DA 3QXFA 1LF6A 1KSCA 4EL8A 1XWTA 1LTXB 2H6FB 1OJOA 3SFXB 4KTPA 1OJMA 3QXQA 1TNUB 3Q7AB 5IKAA 5ILJA 3W7XA 4JJJA 3QFYA 4LNGB 1N23A 1HXGA 2SQCA 1GAIA 4KKJA 1FP3A 1QSJA 1N1ZA 5EAUA 3PYBA 2A8ZA 4M76A 1N9AB 1FO3A 5ILKA 3DSXB 4LNVA 4Q2BA 4CJ0A 1JCQB 1FMIA 2JJBA 3SDRA 4GTRB 2NOJA 5EASA 2JF4A 4AYPA 1HX9A 4GTVB 1N20A 3S4BA 1QAZA 2ZIRB 1R76A 3W5MA 1WU6A 2OKXA 1GHQA 1TN6B 1O6HA 4AYOA 1RWHA 2E22A 1HXCA 3S4CA 3S4DA 4F10A 1OJPA 3NFVA 3W7UA 1O1RB 3PZ1B 1FBWA 3HXBB 3M7CA 4FXKB 1LXMA 1N22A 2PMVA 3GLYA 3DSWB 4GTMB 3VSMA 1JCSB 3WKFA 3AFJA 1L2AA 4F13A 5IK6A 1UT9A 4LIXA 4TXTA 1N4QB 1NI1B 3WIQA 4GL3A 4OK2A 2RI9A 2V8KA 1KKTA 3KQ4A 1HM2A 1N4PB 3PMMA 1RQ5A 4L6XA 3QFZA 3DRAB 4DODA 2G0DA 3EU5B 3HXCB 4WVAA 3W7TA 1EGUA 1JCRB 3G4FA 4CE7A 1N7PA 3CIHA 3E6UA 5AGDA 4AYRA 1F9GA 4KTRA 3E34B 1CEMA 1FBOA 5FO9B 4ZRQA 1TN7B 1DCEB 5ILDA 1NC5A 4ONTA 1RWFA 2VN4A 3M74A 2BB6A 1MZCB 1VD5A 2XFGA 2H6GB 4MMIA 3PZ4B 3QPFA 3ANIA 2I07B 1S64B 3M7LA 2E24A 3ACSA 3LZ9A 2FV0A 3M7BA 1DOGA 4WVCA 5GW7A 1L1YA 4E1YA 2GZ6A 4MU9A 1HMWA 2EAEA 4D4CA
chains in the Genus database with same CATH topology
3RX8A 1GAHA 3H7LA 1IA6A 1KZPB 1LD7B 2CQTA 1GLMA 3RX7A 1NL4B 2WYNA 1H35A 2WY7A 3P5RA 1N4RB 1V7VA 4L9PB 2XQWA 2Z07A 5JPMB 1C3DA 4J5TA 1AYXA 1FT1B 3E30B 1GXMA 1FAEA 1SA4B 1O79A 3ANKA 5DGQA 3SDTA 4GTQB 1KZOB 4GTTB 4D94A 1WZZA 3CU7A 5E2JA 1H36A 1H13A 2XWBB 2JG0A 3PZ2B 3SDQA 3ON6A 1LD8B 4YDEB 1AGMA 1KSDA 2FUZA 2B39A 4ZH1A 4BOJA 1O6RA 2DRSA 3GT5A 4DOEA 3K11A 3HXDB 3E73A 3ANJA 2BB5A 3TF4A 1TN8B 3W5NA 3E32B 1FPPB 3RSYA 1IA7A 1SQCA 2BBCA 1TNBB 3Q7FB 4Z4LA 2WINB 1X9DA 2RI8A 3DSSB 3M73A 3KSQB 3HXFB 4FUSA 3QRYA 3QDEA 2R2LB 1G9GA 2ZBLA 3D3IA 3RRSA 2DROA 5DGRA 3OEDA 1FO2A 1X81B 2ZZRA 3SAEA 1KS8A 5FO7B 3EUVB 1G9JA 3E33B 4GTSB 5MEHA 2V8IA 1G87A 4C1SA 4XUVA 5GZKA 3Q73B 5KKBA 1KFGA 3WKHA 2YIKA 1H39A 1D8DB 2V8JA 3P5PA 1V5CA 3PZ3B 3VXDA 3H3KA 4YDOB 3WC3A 3E37B 4KKIA 3WKGA 3OXUA 3M72A 3Q79B 1TNYB 4TF4A 4YCRA 3P2CA 1V7XA 1W6JA 3M75A 1H12A 4L0GA 3RENA 1KREA 3C72B 3EU8A 1JS4A 2D8LA 2PN5A 1H3BA 3EZ8A 3QWTA 3DSVB 4WVBA 3W7SA 3M7EA 1NXCA 1UMPA 2FBAA 1O1SB 2CQSA 2A73B 1WU5A 1K72A 1V7WA 2WIIB 3WIRA 4Z4JA 3GZKA 4AYQA 5M7YA 2EACA 2D5JA 2FV1A 1O6QA 3ACTA 1G6IA 2RGKA 1N94B 5FOBB 3W7WA 4V1RA 2AHGA 4FXGB 1QQFA 4MBGB 4D4AA 3SDVA 1UG9A 2IEJB 2QNOA 3RX5A 3G6JB 4ZRPA 4GTPB 3SFYB 3S9VA 4BOKA 4CJ1A 4WU0A 5M7IA 2WY8A 3QT3A 1CLCA 1IS9A 3QSPA 3D5RA 3VW5A 4D4BA 1LF9A 1KWFA 2P0VA 1FT2B 2XWJB 3WKIA 3K7XA 3M77A 4QT9A 4GTOB 5CZLA 2V3NA 1XWQA 3T33A 1S63B 1N95B 4V1SA 2H6IB 1TF4A 1O1TB 3KSLB 3QT9A 1H37A 1TNOB 2V3PA 3X17A 5JPNB 3M78A 2NVPA 3RJ3A 3DSUB 3DSTB 1XW2A 1H54A 3D5SA 2F0YB 1DL2A 1GSZA 1HZFA 4ZG8A 1WU4A 2BEDB 1GXOA 3M71A 1TNZB 1H14A 3QG0A 3WUXA 2EABA 1KRFA 2H6HB 2DRQA 3S4AA 1N4SB 1H3CA 1W6KA 2VN7A 3DPYB 3EQAA 3H2WA 1F9OA 2B4FA 2EADA 3WIWA 1HCUA 4EHMB 2DRRA 3A3VA 1GA2A 2F6DA 3M76A 3Q75B 2AFAA 1GXNA 1ULVA 3KLSA 4ZH5A 1FCEA 5CA3A 4D4DA 2AHFA 5CD2A 2G02A 2GOXA 2ZISB 1D8EB 5FO8B 3SQCA 4LNBB 1H3AA 3HXEB 2GH4A 1QBQB 3PYAA 1SA5B 4Q88A 3Q78B 1O5MB 1F9DA 5GY3A 3SDUA 1V5DA 3QXFA 1LF6A 1KSCA 4EL8A 1XWTA 1LTXB 2H6FB 3SFXB 4KTPA 3QXQA 1TNUB 3Q7AB 3W7XA 4JJJA 3QFYA 4LNGB 2SQCA 1GAIA 4KKJA 1FP3A 1QSJA 3PYBA 2A8ZA 4M76A 1N9AB 1FO3A 3DSXB 4LNVA 4Q2BA 4CJ0A 1JCQB 1FMIA 2JJBA 3SDRA 4GTRB 2NOJA 2JF4A 4AYPA 4GTVB 3S4BA 2ZIRB 1R76A 3W5MA 1WU6A 2OKXA 1GHQA 1TN6B 1O6HA 4AYOA 3S4CA 3S4DA 3W7UA 1O1RB 3PZ1B 1FBWA 3HXBB 3M7CA 4FXKB 2PMVA 3GLYA 3DSWB 4GTMB 1JCSB 3WKFA 3AFJA 1L2AA 1UT9A 4LIXA 4TXTA 1N4QB 1NI1B 3WIQA 4GL3A 2RI9A 2V8KA 1KKTA 3KQ4A 1N4PB 3PMMA 1RQ5A 4L6XA 3QFZA 3DRAB 4DODA 2G0DA 3EU5B 3HXCB 4WVAA 3W7TA 1JCRB 4CE7A 3CIHA 3E6UA 5AGDA 4AYRA 4KTRA 3E34B 1CEMA 1FBOA 5FO9B 4ZRQA 1TN7B 1DCEB 1NC5A 4ONTA 2VN4A 3M74A 2BB6A 1MZCB 1VD5A 2XFGA 2H6GB 3PZ4B 3QPFA 3ANIA 2I07B 1S64B 3M7LA 3ACSA 2FV0A 3M7BA 1DOGA 4WVCA 5GW7A 1L1YA 2GZ6A 4MU9A 2EAEA 4D4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2L B;  2H6F B;  3SFX B;  4D4B A;  1TNU B;  3Q7A B;  4LNG B;  2SQC A;  4KKJ A;  1KZP B;  1FT2 B;  1QSJ A;  2XWJ B;  1LD7 B;  4M76 A;  1N9A B;  3K7X A;  3OED A;  1NL4 B;  1X81 B;  4GTO B;  3DSX B;  4LNV A;  5FO7 B;  1H35 A;  2V3N A;  1JCQ B;  3EUV B;  2WY7 A;  3E33 B;  4GTR B;  4GTS B;  2NOJ A;  1N4R B;  2V8I A;  4C1S A;  4L9P B;  1S63 B;  2XQW A;  5JPM B;  1N95 B;  3Q73 B;  4V1S A;  1C3D A;  2H6I B;  4GTV B;  1FT1 B;  2ZIR B;  1GXM A;  1R76 A;  3E30 B;  1O1T B;  1GHQ A;  1H39 A;  1SA4 B;  1H37 A;  1D8D B;  1O6H A;  1TNO B;  1TN6 B;  2V3P A;  2V8J A;  5JPN B;  1O79 A;  3RJ3 A;  3PZ3 B;  3DSU B;  3DST B;  4GTQ B;  1KZO B;  4YDO B;  3D5S A;  1O1R B;  2F0Y B;  4GTT B;  3PZ1 B;  1GSZ A;  1HZF A;  3HXB B;  3E37 B;  4FXK B;  4D94 A;  4KKI A;  3CU7 A;  1H36 A;  3OXU A;  3Q79 B;  2PMV A;  2BED B;  1GXO A;  3DSW B;  4GTM B;  1TNY B;  2XWB B;  1JCS B;  1TNZ B;  1W6J A;  4D4C A;  3PZ2 B;  1LD8 B;  2H6H B;  4YDE B;  1N4S B;  3C72 B;  1H3C A;  1N4Q B;  1NI1 B;  2B39 A;  1W6K A;  3DPY B;  2PN5 A;  1H3B A;  4BOJ A;  4ZH1 A;  3DSV B;  1O6R A;  2V8K A;  3KQ4 A;  1UMP A;  4EHM B;  1O1S B;  2A73 B;  1N4P B;  3HXD B;  3DRA B;  2WII B;  3Q75 B;  2BB5 A;  2G0D A;  1GXN A;  1TN8 B;  3EU5 B;  3HXC B;  3E32 B;  1FPP B;  3KLS A;  1JCR B;  5AGD A;  1O6Q A;  3E34 B;  4D4D A;  1N94 B;  1SQC A;  5FO9 B;  4ZRQ A;  2BBC A;  1TN7 B;  5FOB B;  1DCE B;  4V1R A;  2G02 A;  4FXG B;  1QQF A;  1TNB B;  2GOX A;  2ZIS B;  4ONT A;  4MBG B;  3Q7F B;  1D8E B;  4D4A A;  5FO8 B;  3SQC A;  2IEJ B;  2BB6 A;  1MZC B;  4LNB B;  1H3A A;  3G6J B;  4ZRP A;  2H6G B;  4GTP B;  3PZ4 B;  3SFY B;  3HXE B;  2WIN B;  2I07 B;  1S64 B;  1QBQ B;  4BOK A;  1SA5 B;  3DSS B;  3KSL B;  3Q78 B;  3KSQ B;  2WY8 A;  1O5M B;  3HXF B;  4MU9 A;  3D5R A;  1LTX B; 
#chains in the Genus database with same CATH topology
 3RX8 A;  1GAH A;  3H7L A;  1IA6 A;  5C05 A;  1LXK A;  2BRW A;  1KZP B;  1LD7 B;  2CQT A;  1GLM A;  3RX7 A;  1NL4 B;  2WYN A;  1H35 A;  1N7O A;  2WY7 A;  3P5R A;  1N4R B;  1N7R A;  1V7V A;  4L9P B;  2XQW A;  2Z07 A;  5JPM B;  1C3D A;  4J5T A;  1AYX A;  1FT1 B;  3E30 B;  1GXM A;  3E80 A;  5IL3 A;  1FAE A;  1SA4 B;  1HMU A;  3N0G A;  1O79 A;  3ANK A;  5DGQ A;  3SDT A;  3N0F A;  4GTQ B;  1KZO B;  4GTT B;  4D94 A;  1WZZ A;  3CU7 A;  5E2J A;  1H36 A;  1N7Q A;  1H13 A;  2XWB B;  2JG0 A;  1HN0 A;  3PZ2 B;  3SDQ A;  3ON6 A;  1LD8 B;  4YDE B;  1AGM A;  1KSD A;  2FUZ A;  4OK4 A;  2B39 A;  4ZH1 A;  4BOJ A;  1O6R A;  2DRS A;  3GT5 A;  4DOE A;  3K11 A;  3HXD B;  3E73 A;  3ANJ A;  1X1J A;  2BB5 A;  3TF4 A;  1TN8 B;  3NNB A;  3W5N A;  1X1I A;  1FPP B;  3E32 B;  3RSY A;  3M02 A;  4OZV A;  1IA7 A;  2ONH A;  1SQC A;  1F1S A;  2BBC A;  1TNB B;  5ILI A;  3Q7F B;  1HV6 A;  4Z4L A;  2WIN B;  1X9D A;  2RI8 A;  3DSS B;  3M73 A;  3KSQ B;  1X1H A;  3HXF B;  4FUS A;  3QRY A;  3QDE A;  2R2L B;  4OJZ A;  2BRP A;  1G9G A;  2ZBL A;  3D3I A;  3RRS A;  5DHK A;  2DRO A;  5DGR A;  3OED A;  1FO2 A;  1X81 B;  2ZZR A;  3SAE A;  1KS8 A;  2ONG A;  4MMH A;  5FO7 B;  2X03 A;  1I8Q A;  2WDA A;  1G9J A;  3EUV B;  3E33 B;  4GTS B;  5MEH A;  2V8I A;  1G87 A;  4C1S A;  4XUV A;  5GZK A;  3Q73 B;  5KKB A;  1N21 A;  1KFG A;  1RW9 A;  3WKH A;  2YIK A;  5ILY A;  1H39 A;  1D8D B;  2V8J A;  3P5P A;  3AFL A;  1RWG A;  1V5C A;  3PZ3 B;  3VXD A;  5ILZ A;  3H3K A;  1N24 A;  4YDO B;  3WC3 A;  3E37 B;  4FNV A;  4KKI A;  1OJN A;  3WKG A;  3OXU A;  3M72 A;  3Q79 B;  1RWC A;  1TNY B;  4FJQ A;  4TF4 A;  4YCR A;  3P2C A;  1V7X A;  1W6J A;  3M75 A;  1H12 A;  4L0G A;  3REN A;  1KRE A;  3C72 B;  3EU8 A;  1JS4 A;  2D8L A;  2PN5 A;  1H3B A;  3EZ8 A;  3QWT A;  3DSV B;  2FUT A;  4WVB A;  4RNQ A;  3W7S A;  1N7N A;  3M7E A;  1NXC A;  1UMP A;  5IL8 A;  2FBA A;  1O1S B;  2CQS A;  2A73 B;  1WU5 A;  1K72 A;  1V7W A;  2WII B;  3WIR A;  4Z4J A;  3GZK A;  4AYQ A;  5M7Y A;  2EAC A;  2D5J A;  2FV1 A;  1O6Q A;  3ACT A;  1G6I A;  2RGK A;  1LOH A;  1N94 B;  3M00 A;  5FOB B;  3W7W A;  4V1R A;  2AHG A;  4FXG B;  1QQF A;  5IK9 A;  4MBG B;  4D4A A;  3SDV A;  1UG9 A;  2IEJ B;  2QNO A;  3RX5 A;  3G6J B;  4ZRP A;  5IKH A;  4GTP B;  3SFY B;  3S9V A;  4BOK A;  4CJ1 A;  4WU0 A;  4OZW A;  3E7J A;  5M7I A;  2WY8 A;  5ILH A;  3QT3 A;  1CLC A;  1IS9 A;  3QSP A;  2J5C A;  3D5R A;  5JMF A;  3VW5 A;  4D4B A;  1LF9 A;  1KWF A;  2P0V A;  1FT2 B;  2XWJ B;  3WKI A;  3K7X A;  3M77 A;  2FUQ A;  4QT9 A;  4GTO B;  5CZL A;  2WCO A;  2V3N A;  5IM1 A;  1XWQ A;  3T33 A;  1S63 B;  1N95 B;  4V1S A;  2H6I B;  1TF4 A;  4GAX A;  3A0O A;  1O1T B;  1C82 A;  3KSL B;  5JMD A;  1H37 A;  1J0N A;  1HXA A;  1TNO B;  2V3P A;  3QT9 A;  3X17 A;  5JPN B;  3M78 A;  2NVP A;  3VSN A;  3RJ3 A;  3DSU B;  1W3Y A;  3DST B;  1XW2 A;  1H54 A;  3D5S A;  2F0Y B;  1DL2 A;  1GSZ A;  1CB8 A;  1J0M A;  1HZF A;  4ZG8 A;  1WU4 A;  2BRV X;  2BED B;  1GXO A;  3M71 A;  1TNZ B;  1H14 A;  3QG0 A;  3WUX A;  2EAB A;  1KRF A;  2H6H B;  2DRQ A;  3S4A A;  1N4S B;  1H3C A;  1W6K A;  2VN7 A;  3DPY B;  3EQA A;  1N1B A;  1F9O A;  2B4F A;  3H2W A;  2EAD A;  3WIW A;  1HCU A;  4EHM B;  2DRR A;  3A3V A;  1GA2 A;  2F6D A;  3M76 A;  3Q75 B;  2AFA A;  1GXN A;  1ULV A;  4NEI A;  3KLS A;  3G4D A;  4ZH5 A;  1FCE A;  2Q1F A;  5CA3 A;  1RWA A;  4D4D A;  2AHF A;  5CD2 A;  4DI5 A;  2G02 A;  1HM3 A;  2GOX A;  2ZIS B;  1D8E B;  5FO8 B;  5IK0 A;  3SQC A;  4LNB B;  5EAT A;  1H3A A;  3M01 A;  3HXE B;  2GH4 A;  1QBQ B;  3PYA A;  1SA5 B;  4Q88 A;  3Q78 B;  1O5M B;  5DHI A;  1F9D A;  5GY3 A;  3SDU A;  1V5D A;  3QXF A;  1LF6 A;  1KSC A;  4EL8 A;  1XWT A;  1LTX B;  2H6F B;  1OJO A;  3SFX B;  4KTP A;  1OJM A;  3QXQ A;  1TNU B;  3Q7A B;  5IKA A;  5ILJ A;  3W7X A;  4JJJ A;  3QFY A;  4LNG B;  1N23 A;  1HXG A;  2SQC A;  1GAI A;  4KKJ A;  1FP3 A;  1QSJ A;  1N1Z A;  5EAU A;  3PYB A;  2A8Z A;  4M76 A;  1N9A B;  1FO3 A;  5ILK A;  3DSX B;  4LNV A;  4Q2B A;  4CJ0 A;  1JCQ B;  1FMI A;  2JJB A;  3SDR A;  4GTR B;  2NOJ A;  5EAS A;  2JF4 A;  4AYP A;  1HX9 A;  4GTV B;  1N20 A;  3S4B A;  1QAZ A;  2ZIR B;  1R76 A;  3W5M A;  1WU6 A;  2OKX A;  1GHQ A;  1TN6 B;  1O6H A;  4AYO A;  1RWH A;  2E22 A;  1HXC A;  3S4C A;  3S4D A;  4F10 A;  1OJP A;  3NFV A;  3W7U A;  1O1R B;  3PZ1 B;  1FBW A;  3HXB B;  3M7C A;  4FXK B;  1LXM A;  1N22 A;  2PMV A;  3GLY A;  3DSW B;  4GTM B;  3VSM A;  1JCS B;  3WKF A;  3AFJ A;  1L2A A;  4F13 A;  5IK6 A;  1UT9 A;  4LIX A;  4TXT A;  1N4Q B;  1NI1 B;  3WIQ A;  4GL3 A;  4OK2 A;  2RI9 A;  2V8K A;  1KKT A;  3KQ4 A;  1HM2 A;  1N4P B;  3PMM A;  1RQ5 A;  4L6X A;  3QFZ A;  3DRA B;  4DOD A;  2G0D A;  3EU5 B;  3HXC B;  4WVA A;  3W7T A;  1EGU A;  1JCR B;  3G4F A;  4CE7 A;  1N7P A;  3CIH A;  3E6U A;  5AGD A;  4AYR A;  1F9G A;  4KTR A;  3E34 B;  1CEM A;  1FBO A;  5FO9 B;  4ZRQ A;  1TN7 B;  1DCE B;  5ILD A;  1NC5 A;  4ONT A;  1RWF A;  2VN4 A;  3M74 A;  2BB6 A;  1MZC B;  1VD5 A;  2XFG A;  2H6G B;  4MMI A;  3PZ4 B;  3QPF A;  3ANI A;  2I07 B;  1S64 B;  3M7L A;  2E24 A;  3ACS A;  3LZ9 A;  2FV0 A;  3M7B A;  1DOG A;  4WVC A;  5GW7 A;  1L1Y A;  4E1Y A;  2GZ6 A;  4MU9 A;  1HMW A;  2EAE A;  4D4C A; 
#chains in the Genus database with same CATH homology
 3RX8 A;  1GAH A;  3H7L A;  1IA6 A;  1KZP B;  1LD7 B;  2CQT A;  1GLM A;  3RX7 A;  1NL4 B;  2WYN A;  1H35 A;  2WY7 A;  3P5R A;  1N4R B;  1V7V A;  4L9P B;  2XQW A;  2Z07 A;  5JPM B;  1C3D A;  4J5T A;  1AYX A;  1FT1 B;  3E30 B;  1GXM A;  1FAE A;  1SA4 B;  1O79 A;  3ANK A;  5DGQ A;  3SDT A;  4GTQ B;  1KZO B;  4GTT B;  4D94 A;  1WZZ A;  3CU7 A;  5E2J A;  1H36 A;  1H13 A;  2XWB B;  2JG0 A;  3PZ2 B;  3SDQ A;  3ON6 A;  1LD8 B;  4YDE B;  1AGM A;  1KSD A;  2FUZ A;  2B39 A;  4ZH1 A;  4BOJ A;  1O6R A;  2DRS A;  3GT5 A;  4DOE A;  3K11 A;  3HXD B;  3E73 A;  3ANJ A;  2BB5 A;  3TF4 A;  1TN8 B;  3W5N A;  3E32 B;  1FPP B;  3RSY A;  1IA7 A;  1SQC A;  2BBC A;  1TNB B;  3Q7F B;  4Z4L A;  2WIN B;  1X9D A;  2RI8 A;  3DSS B;  3M73 A;  3KSQ B;  3HXF B;  4FUS A;  3QRY A;  3QDE A;  2R2L B;  1G9G A;  2ZBL A;  3D3I A;  3RRS A;  2DRO A;  5DGR A;  3OED A;  1FO2 A;  1X81 B;  2ZZR A;  3SAE A;  1KS8 A;  5FO7 B;  3EUV B;  1G9J A;  3E33 B;  4GTS B;  5MEH A;  2V8I A;  1G87 A;  4C1S A;  4XUV A;  5GZK A;  3Q73 B;  5KKB A;  1KFG A;  3WKH A;  2YIK A;  1H39 A;  1D8D B;  2V8J A;  3P5P A;  1V5C A;  3PZ3 B;  3VXD A;  3H3K A;  4YDO B;  3WC3 A;  3E37 B;  4KKI A;  3WKG A;  3OXU A;  3M72 A;  3Q79 B;  1TNY B;  4TF4 A;  4YCR A;  3P2C A;  1V7X A;  1W6J A;  3M75 A;  1H12 A;  4L0G A;  3REN A;  1KRE A;  3C72 B;  3EU8 A;  1JS4 A;  2D8L A;  2PN5 A;  1H3B A;  3EZ8 A;  3QWT A;  3DSV B;  4WVB A;  3W7S A;  3M7E A;  1NXC A;  1UMP A;  2FBA A;  1O1S B;  2CQS A;  2A73 B;  1WU5 A;  1K72 A;  1V7W A;  2WII B;  3WIR A;  4Z4J A;  3GZK A;  4AYQ A;  5M7Y A;  2EAC A;  2D5J A;  2FV1 A;  1O6Q A;  3ACT A;  1G6I A;  2RGK A;  1N94 B;  5FOB B;  3W7W A;  4V1R A;  2AHG A;  4FXG B;  1QQF A;  4MBG B;  4D4A A;  3SDV A;  1UG9 A;  2IEJ B;  2QNO A;  3RX5 A;  3G6J B;  4ZRP A;  4GTP B;  3SFY B;  3S9V A;  4BOK A;  4CJ1 A;  4WU0 A;  5M7I A;  2WY8 A;  3QT3 A;  1CLC A;  1IS9 A;  3QSP A;  3D5R A;  3VW5 A;  4D4B A;  1LF9 A;  1KWF A;  2P0V A;  1FT2 B;  2XWJ B;  3WKI A;  3K7X A;  3M77 A;  4QT9 A;  4GTO B;  5CZL A;  2V3N A;  1XWQ A;  3T33 A;  1S63 B;  1N95 B;  4V1S A;  2H6I B;  1TF4 A;  1O1T B;  3KSL B;  3QT9 A;  1H37 A;  1TNO B;  2V3P A;  3X17 A;  5JPN B;  3M78 A;  2NVP A;  3RJ3 A;  3DSU B;  3DST B;  1XW2 A;  1H54 A;  3D5S A;  2F0Y B;  1DL2 A;  1GSZ A;  1HZF A;  4ZG8 A;  1WU4 A;  2BED B;  1GXO A;  3M71 A;  1TNZ B;  1H14 A;  3QG0 A;  3WUX A;  2EAB A;  1KRF A;  2H6H B;  2DRQ A;  3S4A A;  1N4S B;  1H3C A;  1W6K A;  2VN7 A;  3DPY B;  3EQA A;  3H2W A;  1F9O A;  2B4F A;  2EAD A;  3WIW A;  1HCU A;  4EHM B;  2DRR A;  3A3V A;  1GA2 A;  2F6D A;  3M76 A;  3Q75 B;  2AFA A;  1GXN A;  1ULV A;  3KLS A;  4ZH5 A;  1FCE A;  5CA3 A;  4D4D A;  2AHF A;  5CD2 A;  2G02 A;  2GOX A;  2ZIS B;  1D8E B;  5FO8 B;  3SQC A;  4LNB B;  1H3A A;  3HXE B;  2GH4 A;  1QBQ B;  3PYA A;  1SA5 B;  4Q88 A;  3Q78 B;  1O5M B;  1F9D A;  5GY3 A;  3SDU A;  1V5D A;  3QXF A;  1LF6 A;  1KSC A;  4EL8 A;  1XWT A;  1LTX B;  2H6F B;  3SFX B;  4KTP A;  3QXQ A;  1TNU B;  3Q7A B;  3W7X A;  4JJJ A;  3QFY A;  4LNG B;  2SQC A;  1GAI A;  4KKJ A;  1FP3 A;  1QSJ A;  3PYB A;  2A8Z A;  4M76 A;  1N9A B;  1FO3 A;  3DSX B;  4LNV A;  4Q2B A;  4CJ0 A;  1JCQ B;  1FMI A;  2JJB A;  3SDR A;  4GTR B;  2NOJ A;  2JF4 A;  4AYP A;  4GTV B;  3S4B A;  2ZIR B;  1R76 A;  3W5M A;  1WU6 A;  2OKX A;  1GHQ A;  1TN6 B;  1O6H A;  4AYO A;  3S4C A;  3S4D A;  3W7U A;  1O1R B;  3PZ1 B;  1FBW A;  3HXB B;  3M7C A;  4FXK B;  2PMV A;  3GLY A;  3DSW B;  4GTM B;  1JCS B;  3WKF A;  3AFJ A;  1L2A A;  1UT9 A;  4LIX A;  4TXT A;  1N4Q B;  1NI1 B;  3WIQ A;  4GL3 A;  2RI9 A;  2V8K A;  1KKT A;  3KQ4 A;  1N4P B;  3PMM A;  1RQ5 A;  4L6X A;  3QFZ A;  3DRA B;  4DOD A;  2G0D A;  3EU5 B;  3HXC B;  4WVA A;  3W7T A;  1JCR B;  4CE7 A;  3CIH A;  3E6U A;  5AGD A;  4AYR A;  4KTR A;  3E34 B;  1CEM A;  1FBO A;  5FO9 B;  4ZRQ A;  1TN7 B;  1DCE B;  1NC5 A;  4ONT A;  2VN4 A;  3M74 A;  2BB6 A;  1MZC B;  1VD5 A;  2XFG A;  2H6G B;  3PZ4 B;  3QPF A;  3ANI A;  2I07 B;  1S64 B;  3M7L A;  3ACS A;  2FV0 A;  3M7B A;  1DOG A;  4WVC A;  5GW7 A;  1L1Y A;  2GZ6 A;  4MU9 A;  2EAE A;  4D4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...