2GOXA

Crystal structure of efb-c / c3d complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
297
structure length
297
Chain Sequence
GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title A structural basis for complement inhibition by Staphylococcus aureus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 118
structure length 297
sequence length 297
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2goxA00
1H39A 3Q75B 1LD7B 4KKIA 4ZRPA 2V3NA 2H6FB 4ZH1A 3PZ2B 1X81B 1N4RB 1TN6B 3EU5B 1MZCB 3DSSB 4GTMB 1GXOA 5FO8B 1N4SB 2ZIRB 2SQCA 1QBQB 3PZ1B 4ZRQA 1QQFA 4ONTA 3EUVB 4D4AA 1H37A 2BEDB 3KSLB 2BBCA 4GTSB 3SFXB 3Q7FB 2BB6A 2A73B 1UMPA 1O1TB 3OXUA 1O5MB 3D5SA 2H6HB 3RJ3A 1NI1B 1N9AB 1SA5B 1KZOB 2XWJB 3Q73B 1O6QA 1S63B 1H3AA 2ZISB 3DSXB 1GXNA 4YDOB 5JPMB 3E34B 3HXEB 1O6RA 3PZ4B 1FPPB 1D8DB 3C72B 4LNVA 3KSQB 3KQ4A 1O79A 1TN8B 2PMVA 1NL4B 4V1RA 3Q7AB 3PZ3B 3E32B 3CU7A 3HXDB 3HXBB 4GTTB 2WIIB 4C1SA 3KLSA 4FXGB 2V3PA 1TNUB 2IEJB 5AGDA 4D4CA 1LD8B 2I07B 3E37B 4D4DA 3DRAB 1KZPB 1N4PB 2G02A 1FT2B 1D8EB 2XQWA 1N94B 4D94A 4GTVB 4D4BA 1W6KA 2PN5A 3Q78B 3DSUB 2G0DA 1O6HA 1FT1B 1JCSB 3OEDA 4L9PB 1GSZA 1GXMA 2V8KA 4MU9A 2B39A 1N4QB 4GTPB 1JCQB 3SQCA 2NOJA 1TNYB 1TNBB 2WY8A 4V1SA 5FO9B 3E33B 1HZFA 3DSTB 1W6JA 1H35A 1DCEB 3DSVB 1H36A 1R76A 3HXFB 1SA4B 2V8IA 3DSWB 1LTXB 4FXKB 2F0YB 5FO7B 3G6JB 1C3DA 3K7XA 2BB5A 2GOXA 1O1SB 4GTRB 1QSJA 1H3BA 1S64B 1JCRB 1SQCA 1TNOB 4GTOB 3DPYB 2H6GB 2V8JA 1H3CA 4YDEB 1N95B 2XWBB 3SFYB 1GHQA 1O1RB 4LNBB 1TN7B 4MBGB 4BOKA 5JPNB 2H6IB 4EHMB 4BOJA 4LNGB 3D5RA 4KKJA 3Q79B 4M76A 1TNZB 2WINB 2WY7A 2R2LB 3HXCB 4GTQB 5FOBB 3E30B
chains in the Genus database with same CATH superfamily
1NC5A 1H39A 2D8LA 2VN7A 1KREA 4ZH1A 2CQTA 1TN6B 3M01A 5KKBA 4Q2BA 2FBAA 1OJMA 1N20A 2BRVX 2SQCA 2AHFA 1V7WA 1HXCA 3SDRA 4ONTA 3EUVB 2BEDB 3KSLB 2BBCA 5DHKA 3K11A 2BB6A 1RWAA 2A73B 1IA7A 5CZLA 3D5SA 4OK4A 1N9AB 5EATA 3M7EA 1RW9A 1KRFA 1S63B 3QPFA 2ZISB 4RNQA 3W7TA 4GAXA 2VN4A 1H14A 1N23A 3C72B 3KQ4A 3QRYA 1OJPA 1TN8B 2PMVA 3NFVA 4TXTA 4DI5A 1OJOA 3PZ3B 3E32B 1J0MA 3M72A 1GAIA 4GTTB 2JF4A 4Q88A 1LXKA 4FXGB 1XWTA 1LD8B 1RWFA 4FNVA 2G02A 5IK0A 2DRRA 3T33A 3P5PA 4D94A 2FUZA 2FUQA 4OZVA 2FV1A 5IKHA 2WYNA 3DSUB 1JCSB 3S4DA 3OEDA 4YCRA 3GT5A 1F9DA 1KSDA 1FP3A 1JS4A 1N22A 3W5NA 1HMWA 1TNYB 4V1SA 5FO9B 3WIRA 1HZFA 3QXQA 1W6JA 1H35A 1N7QA 3G4FA 3RX5A 3DSVB 3N0FA 1LTXB 2F0YB 1J0NA 5FO7B 2EACA 4Z4JA 3ANIA 3K7XA 2GOXA 4WVCA 1I8QA 1ULVA 1TNOB 3QWTA 2H6GB 2XWBB 1L2AA 5M7IA 3SFYB 1LF9A 1O1RB 3QT9A 4GL3A 1OJNA 4EHMB 4LNGB 3PMMA 3H3KA 5JMFA 2WINB 2WY7A 2R2LB 3HXCB 2WCOA 1AYXA 3W5MA 1HV6A 5GY3A 3PYBA 1WU5A 4EL8A 2H6FB 4CJ1A 1X81B 3DSSB 1HM3A 4GTMB 1H12A 2DROA 1F9GA 5CA3A 5E2JA 1KFGA 2E24A 1H37A 3ACTA 3SFXB 3G4DA 3OXUA 1O1TB 3EU8A 1O5MB 1NXCA 1X1JA 2H6HB 2P0VA 5IM1A 1KZOB 2XWJB 5JMDA 3Q73B 1WU4A 3S4AA 2ZZRA 1H3AA 1X1IA 1XWQA 4AYRA 3DSXB 3M73A 5ILIA 5JPMB 3E34B 4MMHA 1GA2A 1FPPB 1HXGA 4LIXA 3TF4A 3M76A 3PYAA 1NL4B 1EGUA 1WZZA 3CU7A 3QT3A 2GZ6A 1V7XA 3KLSA 1TNUB 2IEJB 5AGDA 2Z07A 3N0GA 3WIQA 2GH4A 1KZPB 1UG9A 1G9JA 3VSNA 2RGKA 3M02A 1WU6A 2PN5A 2ONGA 3QFYA 1GXMA 3SDUA 2RI8A 3VXDA 3WKGA 3WKFA 1X9DA 4GTPB 1JCQB 3SQCA 4FJQA 3E33B 1FO2A 3SAEA 1R76A 3ON6A 3E80A 1G9GA 3GZKA 1GAHA 1H3BA 3A3VA 1SQCA 4GTOB 1G6IA 3DPYB 1GLMA 2B4FA 2V8JA 1N95B 4FUSA 1RWGA 4BOKA 1V5CA 5C05A 2H6IB 4BOJA 1TNZB 2WDAA 3RENA 2ONHA 3Q75B 1LD7B 2AHGA 3S9VA 1V5DA 3ANKA 1F9OA 5ILHA 1MZCB 3CIHA 5FO8B 1LF6A 2OKXA 3W7UA 2YIKA 3PZ1B 2BRPA 5ILJA 1N7NA 5DGRA 4GTSB 1IS9A 1HXAA 1FCEA 1LXMA 3Q7FB 3RJ3A 1SA5B 4WVBA 1N24A 3ACSA 3M7CA 3H7LA 3M71A 3S4CA 4J5TA 4WVAA 2DRSA 3EZ8A 3X17A 1CLCA 1FAEA 3P2CA 1W3YA 1L1YA 1KKTA 3WKHA 1FO3A 1C82A 1X1HA 2EADA 3S4BA 3KSQB 1CB8A 1O79A 3AFLA 3GLYA 2J5CA 1KS8A 3SDVA 3Q7AB 3HXBB 4JJJA 4C1SA 3M00A 3WIWA 3E6UA 1N4PB 1CEMA 1N1BA 1FT2B 1D8EB 3QXFA 2XQWA 3QFZA 1N94B 4GTVB 1W6KA 5EASA 3Q78B 2G0DA 3LZ9A 1O6HA 1FT1B 3M7LA 2A8ZA 1RWCA 4QT9A 1AGMA 2V8KA 1N7RA 4MU9A 2B39A 4Z4LA 1N4QB 1V7VA 2NOJA 1TNBB 3RSYA 2WY8A 3SDTA 4ZG8A 2RI9A 1DCEB 1H36A 4AYQA 5ILYA 5ILDA 1H13A 1SA4B 2V8IA 3DSWB 4FXKB 3WKIA 3G6JB 1C3DA 4MMIA 1FMIA 5DHIA 1O1SB 4GTRB 1KSCA 1QSJA 1S64B 1JCRB 1TF4A 1H54A 4ZH5A 4KTPA 3ANJA 4LNBB 5JPNB 1HMUA 3M75A 5ILKA 5CD2A 3QG0A 3Q79B 4M76A 4WU0A 1HN0A 4GTQB 5FOBB 3E30B 2Q1FA 3D3IA 5GW7A 4KKIA 2JG0A 4ZRPA 2V3NA 1RWHA 1IA6A 3PZ2B 1N4RB 3EU5B 3E7JA 2X03A 1GXOA 1N4SB 3AFJA 2ZIRB 4XUVA 4F10A 1QBQB 1F1SA 3EQAA 4ZRQA 1QQFA 4DOEA 3QSPA 4D4AA 5EAUA 1VD5A 2EABA 2FUTA 3SDQA 2D5JA 2QNOA 1UMPA 5GZKA 2JJBA 1QAZA 2F6DA 3QDEA 1HM2A 1G87A 1NI1B 4CE7A 1O6QA 1DOGA 5IL8A 4DODA 1GXNA 4YDOB 3HXEB 3RRSA 1O6RA 3PZ4B 1D8DB 3M74A 3A0OA 1HX9A 3M78A 2AFAA 2NVPA 1FBOA 4LNVA 5IK6A 1N1ZA 3NNBA 3M7BA 4V1RA 3W7WA 4L0GA 3HXDB 1N7OA 1XW2A 5MEHA 2CQSA 1N7PA 2WIIB 1UT9A 3RX8A 2V3PA 4OJZA 3RX7A 4D4CA 5IK9A 2I07B 3E37B 4OK2A 4D4DA 3DRAB 1LOHA 4OZWA 5DGQA 4NEIA 4D4BA 3E73A 5IL3A 1RQ5A 3W7SA 2BRWA 3W7XA 4L9PB 5ILZA 1GSZA 1HCUA 4L6XA 3WC3A 1DL2A 1N21A 2FV0A 3DSTB 3M77A 3WUXA 3HXFB 5IKAA 2DRQA 4KTRA 3VW5A 3H2WA 4E1YA 2BB5A 4AYOA 4TF4A 4F13A 4YDEB 2EAEA 1H3CA 2ZBLA 1FBWA 2XFGA 1GHQA 4CJ0A 3P5RA 1TN7B 4MBGB 4AYPA 1K72A 3D5RA 3VSMA 1KWFA 4KKJA 2E22A 5M7YA
chains in the Genus database with same CATH topology
1NC5A 1H39A 2D8LA 2VN7A 1KREA 4ZH1A 2CQTA 1TN6B 5KKBA 4Q2BA 2FBAA 2SQCA 2AHFA 1V7WA 3SDRA 4ONTA 3EUVB 2BEDB 3KSLB 2BBCA 3K11A 2BB6A 2A73B 1IA7A 5CZLA 3D5SA 1N9AB 3M7EA 1KRFA 1S63B 3QPFA 2ZISB 3W7TA 2VN4A 1H14A 3C72B 3KQ4A 3QRYA 1TN8B 2PMVA 4TXTA 3PZ3B 3E32B 3M72A 1GAIA 4GTTB 2JF4A 4Q88A 4FXGB 1XWTA 1LD8B 2G02A 2DRRA 3T33A 3P5PA 4D94A 2FUZA 2FV1A 2WYNA 3DSUB 1JCSB 3S4DA 3OEDA 4YCRA 3GT5A 1F9DA 1KSDA 1FP3A 1JS4A 3W5NA 1TNYB 4V1SA 5FO9B 3WIRA 1HZFA 3QXQA 1W6JA 1H35A 3RX5A 3DSVB 1LTXB 2F0YB 5FO7B 2EACA 4Z4JA 3ANIA 3K7XA 2GOXA 4WVCA 1ULVA 1TNOB 3QWTA 2H6GB 2XWBB 1L2AA 5M7IA 3SFYB 1LF9A 1O1RB 3QT9A 4GL3A 4EHMB 4LNGB 3PMMA 3H3KA 2WINB 2WY7A 2R2LB 3HXCB 1AYXA 3W5MA 5GY3A 3PYBA 1WU5A 4EL8A 2H6FB 4CJ1A 1X81B 3DSSB 4GTMB 1H12A 2DROA 5CA3A 5E2JA 1KFGA 1H37A 3ACTA 3SFXB 3OXUA 1O1TB 3EU8A 1O5MB 1NXCA 2H6HB 2P0VA 1KZOB 2XWJB 3Q73B 1WU4A 3S4AA 2ZZRA 1H3AA 1XWQA 4AYRA 3DSXB 3M73A 5JPMB 3E34B 1GA2A 1FPPB 4LIXA 3TF4A 3M76A 3PYAA 1NL4B 1WZZA 3CU7A 3QT3A 2GZ6A 1V7XA 3KLSA 1TNUB 2IEJB 5AGDA 2Z07A 3WIQA 2GH4A 1KZPB 1UG9A 1G9JA 2RGKA 1WU6A 2PN5A 3QFYA 1GXMA 3SDUA 2RI8A 3VXDA 3WKGA 3WKFA 1X9DA 4GTPB 1JCQB 3SQCA 3E33B 1FO2A 3SAEA 1R76A 3ON6A 1G9GA 3GZKA 1GAHA 1H3BA 3A3VA 1SQCA 4GTOB 1G6IA 3DPYB 1GLMA 2B4FA 2V8JA 1N95B 4FUSA 4BOKA 1V5CA 2H6IB 4BOJA 1TNZB 3RENA 3Q75B 1LD7B 2AHGA 3S9VA 1V5DA 3ANKA 1F9OA 1MZCB 3CIHA 5FO8B 1LF6A 2OKXA 3W7UA 2YIKA 3PZ1B 5DGRA 4GTSB 1IS9A 1FCEA 3Q7FB 3RJ3A 1SA5B 4WVBA 3ACSA 3M7CA 3H7LA 3M71A 3S4CA 4J5TA 4WVAA 2DRSA 3EZ8A 3X17A 1CLCA 1FAEA 3P2CA 1L1YA 1KKTA 3WKHA 1FO3A 3S4BA 2EADA 3KSQB 1O79A 3GLYA 1KS8A 3SDVA 3Q7AB 3HXBB 4JJJA 4C1SA 3WIWA 3E6UA 1N4PB 1CEMA 1FT2B 1D8EB 3QXFA 2XQWA 3QFZA 1N94B 4GTVB 1W6KA 3Q78B 2G0DA 1O6HA 1FT1B 3M7LA 2A8ZA 4QT9A 1AGMA 2V8KA 4MU9A 2B39A 4Z4LA 1N4QB 1V7VA 2NOJA 1TNBB 3RSYA 2WY8A 3SDTA 4ZG8A 2RI9A 1DCEB 1H36A 4AYQA 1H13A 1SA4B 2V8IA 3DSWB 4FXKB 3WKIA 3G6JB 1C3DA 1FMIA 1O1SB 4GTRB 1KSCA 1QSJA 1S64B 1JCRB 1TF4A 1H54A 4ZH5A 4KTPA 3ANJA 4LNBB 5JPNB 3M75A 5CD2A 3QG0A 3Q79B 4M76A 4WU0A 4GTQB 5FOBB 3E30B 3D3IA 5GW7A 4KKIA 2JG0A 4ZRPA 2V3NA 1IA6A 3PZ2B 1N4RB 3EU5B 1GXOA 1N4SB 3AFJA 2ZIRB 4XUVA 1QBQB 3EQAA 4ZRQA 1QQFA 4DOEA 3QSPA 4D4AA 1VD5A 2EABA 3SDQA 2D5JA 2QNOA 1UMPA 5GZKA 2JJBA 2F6DA 3QDEA 1G87A 1NI1B 4CE7A 1O6QA 1DOGA 4DODA 1GXNA 4YDOB 3HXEB 3RRSA 1O6RA 3PZ4B 1D8DB 3M74A 3M78A 2NVPA 2AFAA 1FBOA 4LNVA 3M7BA 4V1RA 3W7WA 4L0GA 3HXDB 1XW2A 5MEHA 2CQSA 2WIIB 1UT9A 3RX8A 2V3PA 3RX7A 4D4CA 2I07B 3E37B 4D4DA 3DRAB 5DGQA 4D4BA 3E73A 1RQ5A 3W7SA 3W7XA 4L9PB 1GSZA 1HCUA 4L6XA 3WC3A 1DL2A 2FV0A 3DSTB 3M77A 3WUXA 3HXFB 2DRQA 4KTRA 3VW5A 3H2WA 2BB5A 4AYOA 4TF4A 4YDEB 2EAEA 1H3CA 2ZBLA 1FBWA 2XFGA 1GHQA 4CJ0A 3P5RA 1TN7B 4MBGB 4AYPA 1K72A 3D5RA 1KWFA 4KKJA 5M7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H39 A;  3Q75 B;  1LD7 B;  4KKI A;  4ZRP A;  2V3N A;  2H6F B;  4ZH1 A;  3PZ2 B;  1X81 B;  1N4R B;  1TN6 B;  3EU5 B;  1MZC B;  3DSS B;  4GTM B;  1GXO A;  5FO8 B;  1N4S B;  2ZIR B;  2SQC A;  1QBQ B;  3PZ1 B;  4ZRQ A;  1QQF A;  4ONT A;  3EUV B;  4D4A A;  1H37 A;  2BED B;  3KSL B;  2BBC A;  4GTS B;  3SFX B;  3Q7F B;  2BB6 A;  2A73 B;  1UMP A;  1O1T B;  3OXU A;  1O5M B;  3D5S A;  2H6H B;  3RJ3 A;  1NI1 B;  1N9A B;  1SA5 B;  1KZO B;  2XWJ B;  3Q73 B;  1O6Q A;  1S63 B;  1H3A A;  2ZIS B;  3DSX B;  1GXN A;  4YDO B;  5JPM B;  3E34 B;  3HXE B;  1O6R A;  3PZ4 B;  1FPP B;  1D8D B;  3C72 B;  4LNV A;  3KSQ B;  3KQ4 A;  1O79 A;  1TN8 B;  2PMV A;  1NL4 B;  4V1R A;  3Q7A B;  3PZ3 B;  3E32 B;  3CU7 A;  3HXD B;  3HXB B;  4GTT B;  2WII B;  4C1S A;  3KLS A;  4FXG B;  2V3P A;  1TNU B;  2IEJ B;  5AGD A;  4D4C A;  1LD8 B;  2I07 B;  3E37 B;  4D4D A;  3DRA B;  1KZP B;  1N4P B;  2G02 A;  1FT2 B;  1D8E B;  2XQW A;  1N94 B;  4D94 A;  4GTV B;  4D4B A;  1W6K A;  2PN5 A;  3Q78 B;  3DSU B;  2G0D A;  1O6H A;  1FT1 B;  1JCS B;  3OED A;  4L9P B;  1GSZ A;  1GXM A;  2V8K A;  4MU9 A;  2B39 A;  1N4Q B;  4GTP B;  1JCQ B;  3SQC A;  2NOJ A;  1TNY B;  1TNB B;  2WY8 A;  4V1S A;  5FO9 B;  3E33 B;  1HZF A;  3DST B;  1W6J A;  1H35 A;  1DCE B;  3DSV B;  1H36 A;  1R76 A;  3HXF B;  1SA4 B;  2V8I A;  3DSW B;  1LTX B;  4FXK B;  2F0Y B;  5FO7 B;  3G6J B;  1C3D A;  3K7X A;  2BB5 A;  2GOX A;  1O1S B;  4GTR B;  1QSJ A;  1H3B A;  1S64 B;  1JCR B;  1SQC A;  1TNO B;  4GTO B;  3DPY B;  2H6G B;  2V8J A;  1H3C A;  4YDE B;  1N95 B;  2XWB B;  3SFY B;  1GHQ A;  1O1R B;  4LNB B;  1TN7 B;  4MBG B;  4BOK A;  5JPN B;  2H6I B;  4EHM B;  4BOJ A;  4LNG B;  3D5R A;  4KKJ A;  3Q79 B;  4M76 A;  1TNZ B;  2WIN B;  2WY7 A;  2R2L B;  3HXC B;  4GTQ B;  5FOB B;  3E30 B; 
#chains in the Genus database with same CATH topology
 1NC5 A;  1H39 A;  2D8L A;  2VN7 A;  1KRE A;  4ZH1 A;  2CQT A;  1TN6 B;  3M01 A;  5KKB A;  4Q2B A;  2FBA A;  1OJM A;  1N20 A;  2BRV X;  2SQC A;  2AHF A;  1V7W A;  1HXC A;  3SDR A;  4ONT A;  3EUV B;  2BED B;  3KSL B;  2BBC A;  5DHK A;  3K11 A;  2BB6 A;  1RWA A;  2A73 B;  1IA7 A;  5CZL A;  3D5S A;  4OK4 A;  1N9A B;  5EAT A;  3M7E A;  1RW9 A;  1KRF A;  1S63 B;  3QPF A;  2ZIS B;  4RNQ A;  3W7T A;  4GAX A;  2VN4 A;  1H14 A;  1N23 A;  3C72 B;  3KQ4 A;  3QRY A;  1OJP A;  1TN8 B;  2PMV A;  3NFV A;  4TXT A;  4DI5 A;  1OJO A;  3PZ3 B;  3E32 B;  1J0M A;  3M72 A;  1GAI A;  4GTT B;  2JF4 A;  4Q88 A;  1LXK A;  4FXG B;  1XWT A;  1LD8 B;  1RWF A;  4FNV A;  2G02 A;  5IK0 A;  2DRR A;  3T33 A;  3P5P A;  4D94 A;  2FUZ A;  2FUQ A;  4OZV A;  2FV1 A;  5IKH A;  2WYN A;  3DSU B;  1JCS B;  3S4D A;  3OED A;  4YCR A;  3GT5 A;  1F9D A;  1KSD A;  1FP3 A;  1JS4 A;  1N22 A;  3W5N A;  1HMW A;  1TNY B;  4V1S A;  5FO9 B;  3WIR A;  1HZF A;  3QXQ A;  1W6J A;  1H35 A;  1N7Q A;  3G4F A;  3RX5 A;  3DSV B;  3N0F A;  1LTX B;  2F0Y B;  1J0N A;  5FO7 B;  2EAC A;  4Z4J A;  3ANI A;  3K7X A;  2GOX A;  4WVC A;  1I8Q A;  1ULV A;  1TNO B;  3QWT A;  2H6G B;  2XWB B;  1L2A A;  5M7I A;  3SFY B;  1LF9 A;  1O1R B;  3QT9 A;  4GL3 A;  1OJN A;  4EHM B;  4LNG B;  3PMM A;  3H3K A;  5JMF A;  2WIN B;  2WY7 A;  2R2L B;  3HXC B;  2WCO A;  1AYX A;  3W5M A;  1HV6 A;  5GY3 A;  3PYB A;  1WU5 A;  4EL8 A;  2H6F B;  4CJ1 A;  1X81 B;  3DSS B;  1HM3 A;  4GTM B;  1H12 A;  2DRO A;  1F9G A;  5CA3 A;  5E2J A;  1KFG A;  2E24 A;  1H37 A;  3ACT A;  3SFX B;  3G4D A;  3OXU A;  1O1T B;  3EU8 A;  1O5M B;  1NXC A;  1X1J A;  2H6H B;  2P0V A;  5IM1 A;  1KZO B;  2XWJ B;  5JMD A;  3Q73 B;  1WU4 A;  3S4A A;  2ZZR A;  1H3A A;  1X1I A;  1XWQ A;  4AYR A;  3DSX B;  3M73 A;  5ILI A;  5JPM B;  3E34 B;  4MMH A;  1GA2 A;  1FPP B;  1HXG A;  4LIX A;  3TF4 A;  3M76 A;  3PYA A;  1NL4 B;  1EGU A;  1WZZ A;  3CU7 A;  3QT3 A;  2GZ6 A;  1V7X A;  3KLS A;  1TNU B;  2IEJ B;  5AGD A;  2Z07 A;  3N0G A;  3WIQ A;  2GH4 A;  1KZP B;  1UG9 A;  1G9J A;  3VSN A;  2RGK A;  3M02 A;  1WU6 A;  2PN5 A;  2ONG A;  3QFY A;  1GXM A;  3SDU A;  2RI8 A;  3VXD A;  3WKG A;  3WKF A;  1X9D A;  4GTP B;  1JCQ B;  3SQC A;  4FJQ A;  3E33 B;  1FO2 A;  3SAE A;  1R76 A;  3ON6 A;  3E80 A;  1G9G A;  3GZK A;  1GAH A;  1H3B A;  3A3V A;  1SQC A;  4GTO B;  1G6I A;  3DPY B;  1GLM A;  2B4F A;  2V8J A;  1N95 B;  4FUS A;  1RWG A;  4BOK A;  1V5C A;  5C05 A;  2H6I B;  4BOJ A;  1TNZ B;  2WDA A;  3REN A;  2ONH A;  3Q75 B;  1LD7 B;  2AHG A;  3S9V A;  1V5D A;  3ANK A;  1F9O A;  5ILH A;  1MZC B;  3CIH A;  5FO8 B;  1LF6 A;  2OKX A;  3W7U A;  2YIK A;  3PZ1 B;  2BRP A;  5ILJ A;  1N7N A;  5DGR A;  4GTS B;  1IS9 A;  1HXA A;  1FCE A;  1LXM A;  3Q7F B;  3RJ3 A;  1SA5 B;  4WVB A;  1N24 A;  3ACS A;  3M7C A;  3H7L A;  3M71 A;  3S4C A;  4J5T A;  4WVA A;  2DRS A;  3EZ8 A;  3X17 A;  1CLC A;  1FAE A;  3P2C A;  1W3Y A;  1L1Y A;  1KKT A;  3WKH A;  1FO3 A;  1C82 A;  1X1H A;  2EAD A;  3S4B A;  3KSQ B;  1CB8 A;  1O79 A;  3AFL A;  3GLY A;  2J5C A;  1KS8 A;  3SDV A;  3Q7A B;  3HXB B;  4JJJ A;  4C1S A;  3M00 A;  3WIW A;  3E6U A;  1N4P B;  1CEM A;  1N1B A;  1FT2 B;  1D8E B;  3QXF A;  2XQW A;  3QFZ A;  1N94 B;  4GTV B;  1W6K A;  5EAS A;  3Q78 B;  2G0D A;  3LZ9 A;  1O6H A;  1FT1 B;  3M7L A;  2A8Z A;  1RWC A;  4QT9 A;  1AGM A;  2V8K A;  1N7R A;  4MU9 A;  2B39 A;  4Z4L A;  1N4Q B;  1V7V A;  2NOJ A;  1TNB B;  3RSY A;  2WY8 A;  3SDT A;  4ZG8 A;  2RI9 A;  1DCE B;  1H36 A;  4AYQ A;  5ILY A;  5ILD A;  1H13 A;  1SA4 B;  2V8I A;  3DSW B;  4FXK B;  3WKI A;  3G6J B;  1C3D A;  4MMI A;  1FMI A;  5DHI A;  1O1S B;  4GTR B;  1KSC A;  1QSJ A;  1S64 B;  1JCR B;  1TF4 A;  1H54 A;  4ZH5 A;  4KTP A;  3ANJ A;  4LNB B;  5JPN B;  1HMU A;  3M75 A;  5ILK A;  5CD2 A;  3QG0 A;  3Q79 B;  4M76 A;  4WU0 A;  1HN0 A;  4GTQ B;  5FOB B;  3E30 B;  2Q1F A;  3D3I A;  5GW7 A;  4KKI A;  2JG0 A;  4ZRP A;  2V3N A;  1RWH A;  1IA6 A;  3PZ2 B;  1N4R B;  3EU5 B;  3E7J A;  2X03 A;  1GXO A;  1N4S B;  3AFJ A;  2ZIR B;  4XUV A;  4F10 A;  1QBQ B;  1F1S A;  3EQA A;  4ZRQ A;  1QQF A;  4DOE A;  3QSP A;  4D4A A;  5EAU A;  1VD5 A;  2EAB A;  2FUT A;  3SDQ A;  2D5J A;  2QNO A;  1UMP A;  5GZK A;  2JJB A;  1QAZ A;  2F6D A;  3QDE A;  1HM2 A;  1G87 A;  1NI1 B;  4CE7 A;  1O6Q A;  1DOG A;  5IL8 A;  4DOD A;  1GXN A;  4YDO B;  3HXE B;  3RRS A;  1O6R A;  3PZ4 B;  1D8D B;  3M74 A;  3A0O A;  1HX9 A;  3M78 A;  2AFA A;  2NVP A;  1FBO A;  4LNV A;  5IK6 A;  1N1Z A;  3NNB A;  3M7B A;  4V1R A;  3W7W A;  4L0G A;  3HXD B;  1N7O A;  1XW2 A;  5MEH A;  2CQS A;  1N7P A;  2WII B;  1UT9 A;  3RX8 A;  2V3P A;  4OJZ A;  3RX7 A;  4D4C A;  5IK9 A;  2I07 B;  3E37 B;  4OK2 A;  4D4D A;  3DRA B;  1LOH A;  4OZW A;  5DGQ A;  4NEI A;  4D4B A;  3E73 A;  5IL3 A;  1RQ5 A;  3W7S A;  2BRW A;  3W7X A;  4L9P B;  5ILZ A;  1GSZ A;  1HCU A;  4L6X A;  3WC3 A;  1DL2 A;  1N21 A;  2FV0 A;  3DST B;  3M77 A;  3WUX A;  3HXF B;  5IKA A;  2DRQ A;  4KTR A;  3VW5 A;  3H2W A;  4E1Y A;  2BB5 A;  4AYO A;  4TF4 A;  4F13 A;  4YDE B;  2EAE A;  1H3C A;  2ZBL A;  1FBW A;  2XFG A;  1GHQ A;  4CJ0 A;  3P5R A;  1TN7 B;  4MBG B;  4AYP A;  1K72 A;  3D5R A;  3VSM A;  1KWF A;  4KKJ A;  2E22 A;  5M7Y A; 
#chains in the Genus database with same CATH homology
 1NC5 A;  1H39 A;  2D8L A;  2VN7 A;  1KRE A;  4ZH1 A;  2CQT A;  1TN6 B;  5KKB A;  4Q2B A;  2FBA A;  2SQC A;  2AHF A;  1V7W A;  3SDR A;  4ONT A;  3EUV B;  2BED B;  3KSL B;  2BBC A;  3K11 A;  2BB6 A;  2A73 B;  1IA7 A;  5CZL A;  3D5S A;  1N9A B;  3M7E A;  1KRF A;  1S63 B;  3QPF A;  2ZIS B;  3W7T A;  2VN4 A;  1H14 A;  3C72 B;  3KQ4 A;  3QRY A;  1TN8 B;  2PMV A;  4TXT A;  3PZ3 B;  3E32 B;  3M72 A;  1GAI A;  4GTT B;  2JF4 A;  4Q88 A;  4FXG B;  1XWT A;  1LD8 B;  2G02 A;  2DRR A;  3T33 A;  3P5P A;  4D94 A;  2FUZ A;  2FV1 A;  2WYN A;  3DSU B;  1JCS B;  3S4D A;  3OED A;  4YCR A;  3GT5 A;  1F9D A;  1KSD A;  1FP3 A;  1JS4 A;  3W5N A;  1TNY B;  4V1S A;  5FO9 B;  3WIR A;  1HZF A;  3QXQ A;  1W6J A;  1H35 A;  3RX5 A;  3DSV B;  1LTX B;  2F0Y B;  5FO7 B;  2EAC A;  4Z4J A;  3ANI A;  3K7X A;  2GOX A;  4WVC A;  1ULV A;  1TNO B;  3QWT A;  2H6G B;  2XWB B;  1L2A A;  5M7I A;  3SFY B;  1LF9 A;  1O1R B;  3QT9 A;  4GL3 A;  4EHM B;  4LNG B;  3PMM A;  3H3K A;  2WIN B;  2WY7 A;  2R2L B;  3HXC B;  1AYX A;  3W5M A;  5GY3 A;  3PYB A;  1WU5 A;  4EL8 A;  2H6F B;  4CJ1 A;  1X81 B;  3DSS B;  4GTM B;  1H12 A;  2DRO A;  5CA3 A;  5E2J A;  1KFG A;  1H37 A;  3ACT A;  3SFX B;  3OXU A;  1O1T B;  3EU8 A;  1O5M B;  1NXC A;  2H6H B;  2P0V A;  1KZO B;  2XWJ B;  3Q73 B;  1WU4 A;  3S4A A;  2ZZR A;  1H3A A;  1XWQ A;  4AYR A;  3DSX B;  3M73 A;  5JPM B;  3E34 B;  1GA2 A;  1FPP B;  4LIX A;  3TF4 A;  3M76 A;  3PYA A;  1NL4 B;  1WZZ A;  3CU7 A;  3QT3 A;  2GZ6 A;  1V7X A;  3KLS A;  1TNU B;  2IEJ B;  5AGD A;  2Z07 A;  3WIQ A;  2GH4 A;  1KZP B;  1UG9 A;  1G9J A;  2RGK A;  1WU6 A;  2PN5 A;  3QFY A;  1GXM A;  3SDU A;  2RI8 A;  3VXD A;  3WKG A;  3WKF A;  1X9D A;  4GTP B;  1JCQ B;  3SQC A;  3E33 B;  1FO2 A;  3SAE A;  1R76 A;  3ON6 A;  1G9G A;  3GZK A;  1GAH A;  1H3B A;  3A3V A;  1SQC A;  4GTO B;  1G6I A;  3DPY B;  1GLM A;  2B4F A;  2V8J A;  1N95 B;  4FUS A;  4BOK A;  1V5C A;  2H6I B;  4BOJ A;  1TNZ B;  3REN A;  3Q75 B;  1LD7 B;  2AHG A;  3S9V A;  1V5D A;  3ANK A;  1F9O A;  1MZC B;  3CIH A;  5FO8 B;  1LF6 A;  2OKX A;  3W7U A;  2YIK A;  3PZ1 B;  5DGR A;  4GTS B;  1IS9 A;  1FCE A;  3Q7F B;  3RJ3 A;  1SA5 B;  4WVB A;  3ACS A;  3M7C A;  3H7L A;  3M71 A;  3S4C A;  4J5T A;  4WVA A;  2DRS A;  3EZ8 A;  3X17 A;  1CLC A;  1FAE A;  3P2C A;  1L1Y A;  1KKT A;  3WKH A;  1FO3 A;  3S4B A;  2EAD A;  3KSQ B;  1O79 A;  3GLY A;  1KS8 A;  3SDV A;  3Q7A B;  3HXB B;  4JJJ A;  4C1S A;  3WIW A;  3E6U A;  1N4P B;  1CEM A;  1FT2 B;  1D8E B;  3QXF A;  2XQW A;  3QFZ A;  1N94 B;  4GTV B;  1W6K A;  3Q78 B;  2G0D A;  1O6H A;  1FT1 B;  3M7L A;  2A8Z A;  4QT9 A;  1AGM A;  2V8K A;  4MU9 A;  2B39 A;  4Z4L A;  1N4Q B;  1V7V A;  2NOJ A;  1TNB B;  3RSY A;  2WY8 A;  3SDT A;  4ZG8 A;  2RI9 A;  1DCE B;  1H36 A;  4AYQ A;  1H13 A;  1SA4 B;  2V8I A;  3DSW B;  4FXK B;  3WKI A;  3G6J B;  1C3D A;  1FMI A;  1O1S B;  4GTR B;  1KSC A;  1QSJ A;  1S64 B;  1JCR B;  1TF4 A;  1H54 A;  4ZH5 A;  4KTP A;  3ANJ A;  4LNB B;  5JPN B;  3M75 A;  5CD2 A;  3QG0 A;  3Q79 B;  4M76 A;  4WU0 A;  4GTQ B;  5FOB B;  3E30 B;  3D3I A;  5GW7 A;  4KKI A;  2JG0 A;  4ZRP A;  2V3N A;  1IA6 A;  3PZ2 B;  1N4R B;  3EU5 B;  1GXO A;  1N4S B;  3AFJ A;  2ZIR B;  4XUV A;  1QBQ B;  3EQA A;  4ZRQ A;  1QQF A;  4DOE A;  3QSP A;  4D4A A;  1VD5 A;  2EAB A;  3SDQ A;  2D5J A;  2QNO A;  1UMP A;  5GZK A;  2JJB A;  2F6D A;  3QDE A;  1G87 A;  1NI1 B;  4CE7 A;  1O6Q A;  1DOG A;  4DOD A;  1GXN A;  4YDO B;  3HXE B;  3RRS A;  1O6R A;  3PZ4 B;  1D8D B;  3M74 A;  3M78 A;  2NVP A;  2AFA A;  1FBO A;  4LNV A;  3M7B A;  4V1R A;  3W7W A;  4L0G A;  3HXD B;  1XW2 A;  5MEH A;  2CQS A;  2WII B;  1UT9 A;  3RX8 A;  2V3P A;  3RX7 A;  4D4C A;  2I07 B;  3E37 B;  4D4D A;  3DRA B;  5DGQ A;  4D4B A;  3E73 A;  1RQ5 A;  3W7S A;  3W7X A;  4L9P B;  1GSZ A;  1HCU A;  4L6X A;  3WC3 A;  1DL2 A;  2FV0 A;  3DST B;  3M77 A;  3WUX A;  3HXF B;  2DRQ A;  4KTR A;  3VW5 A;  3H2W A;  2BB5 A;  4AYO A;  4TF4 A;  4YDE B;  2EAE A;  1H3C A;  2ZBL A;  1FBW A;  2XFG A;  1GHQ A;  4CJ0 A;  3P5R A;  1TN7 B;  4MBG B;  4AYP A;  1K72 A;  3D5R A;  1KWF A;  4KKJ A;  5M7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...