2GOXA

Crystal structure of efb-c / c3d complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
297
structure length
297
Chain Sequence
b'GSRSTDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title A structural basis for complement inhibition by Staphylococcus aureus.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/toxin
total genus 118
structure length 297
sequence length 297
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2goxA00
3DSWB 1H39A 3Q7FB 4GTRB 2WY8A 1HZFA 1H3CA 1N4QB 3HXDB 1H3AA 2ZISB 3E30B 1H35A 1O6RA 3PZ2B 1LD7B 3Q73B 1N9AB 1GXNA 2G0DA 2V3NA 2GOXA 2V8JA 4BOKA 3RJ3A 4D94A 1LTXB 4LNBB 5FO8B 1FPPB 3KLSA 3PZ4B 5JPMB 4GTMB 3DSTB 3K7XA 1O5MB 1TN8B 3PZ3B 5FOBB 3DSUB 1GSZA 1N94B 1DCEB 1GHQA 5AGDA 5FO9B 2PMVA 1H37A 2BEDB 3DSXB 2H6IB 1O79A 3G6JB 1JCQB 1O6QA 2I07B 3SQCA 2WY7A 3DSSB 1LD8B 4ONTA 4KKJA 1O1RB 4MU9A 3C72B 1TNBB 4FXKB 4GTPB 4LNVA 2WINB 1D8DB 3Q79B 1N4PB 3Q7AB 1S63B 3D5SA 1R76A 4GTTB 3SFXB 3Q75B 1O1TB 2BB6A 1N95B 4KKIA 1UMPA 2V3PA 2B39A 1W6KA 1TNOB 3SFYB 3KQ4A 2A73B 5JPNB 5FO7B 3DSVB 3HXCB 4EHMB 2SQCA 1QBQB 3DRAB 2XWBB 1W6JA 3KSQB 1H3BA 1NL4B 1QSJA 1SQCA 4V1RA 4FXGB 2G02A 2V8IA 1MZCB 4ZH1A 1C3DA 1O6HA 1NI1B 2H6HB 1KZPB 1KZOB 3E33B 1JCSB 3E32B 3Q78B 4LNGB 1O1SB 3E34B 4YDEB 1QQFA 3HXEB 4C1SA 1SA5B 1TN6B 4D4BA 1N4RB 2F0YB 3D5RA 1TNZB 3E37B 1TNUB 1H36A 1SA4B 2BBCA 3EUVB 1FT1B 2H6FB 4GTSB 4M76A 2IEJB 4YDOB 4GTVB 4GTOB 2R2LB 1S64B 4MBGB 4BOJA 1GXMA 2XWJB 1JCRB 1TN7B 4L9PB 3KSLB 2XQWA 3EU5B 2NOJA 1GXOA 1TNYB 2H6GB 2ZIRB 3CU7A 1D8EB 2PN5A 4D4AA 3OEDA 1FT2B 2V8KA 4ZRQA 4V1SA 4D4CA 2WIIB 3OXUA 3HXBB 4D4DA 2BB5A 1X81B 3HXFB 1N4SB 3DPYB 4ZRPA 3PZ1B 4GTQB
chains in the Genus database with same CATH superfamily
1LOHA 3M77A 2Z07A 2FV0A 3QFYA 3SDQA 1HZFA 1H3CA 1X1HA 3HXDB 3M74A 1H54A 3E30B 1H35A 1GXNA 4FJQA 1N7RA 2B4FA 3P2CA 1N24A 4BOKA 3RJ3A 3WKHA 3PZ4B 3QT3A 5JPMB 3M01A 4GTMB 5FOBB 2EACA 1N94B 1DCEB 5EAUA 4JJJA 3WKIA 3RX7A 2PMVA 4GAXA 3DSXB 4L0GA 1X1JA 2H6IB 1O79A 5EATA 5DGRA 2P0VA 4MU9A 4AYRA 3C72B 3T33A 1TNBB 5CD2A 4LNVA 3VXDA 2DRSA 1D8DB 3PMMA 3Q7AB 3SFXB 3SDVA 1KSCA 1EGUA 5ILDA 3WIRA 3S4DA 4XUVA 1JS4A 3RENA 4F13A 3DSVB 3HXCB 3RX8A 3S4CA 4EHMB 3GZKA 5ILIA 3SDUA 2SQCA 2ZBLA 1QBQB 3DRAB 3S4BA 3NFVA 2AFAA 3ANIA 1H3BA 1WU5A 1NL4B 3WUXA 1MZCB 4OK2A 4WVBA 1C3DA 3W5NA 3E7JA 1NI1B 5E2JA 3M7EA 3ANJA 4MMHA 3A3VA 3HXEB 2ONGA 1H12A 1N4RB 2CQTA 3D5RA 1KS8A 1TNZB 3AFJA 1TNUB 1HXGA 2F6DA 1CLCA 1FT1B 4J5TA 1N21A 3M71A 1N20A 4YDOB 4MBGB 2XFGA 1OJNA 4BOJA 2GZ6A 3ANKA 1IA7A 2XQWA 2EABA 3EU5B 2H6GB 1TNYB 3CU7A 2JJBA 3TF4A 2PN5A 3QXFA 3N0GA 4D4AA 3OEDA 5DHIA 1FT2B 4D4CA 2WIIB 4DODA 1X81B 3HXFB 3QDEA 1IA6A 3PZ1B 3X17A 4F10A 3H3KA 3Q7FB 2ONHA 1N4QB 4OZWA 1RW9A 3G4DA 1H13A 1V7WA 3LZ9A 4WU0A 2V3NA 2WYNA 1KWFA 1HXAA 1XWQA 3RX5A 3KLSA 1WZZA 1VD5A 1AYXA 3K7XA 1LXKA 3PZ3B 3D3IA 1L2AA 1GHQA 3G4FA 3H7LA 3W7SA 1G9JA 5ILKA 1N7OA 1NXCA 3E73A 5EASA 2ZZRA 3G6JB 1JCQB 1O6QA 2I07B 4FUSA 2WY7A 4Q2BA 3SQCA 4ONTA 4KTRA 4AYQA 2X03A 1WU6A 1RWFA 1J0MA 2AHFA 2RGKA 4GL3A 3Q75B 5M7YA 2J5CA 2BB6A 1L1YA 2V3PA 2B39A 1W6KA 3KQ4A 5JMFA 1LF6A 1K72A 2WDAA 1H14A 3QPFA 1I8QA 1LF9A 2FBAA 1QSJA 1F9DA 1X9DA 3A0OA 4L6XA 2V8IA 4LIXA 3SDTA 3QXQA 4AYPA 2CQSA 4TXTA 5JMDA 1V7VA 5IKAA 1O1SB 5IL8A 3VW5A 1CEMA 2A8ZA 4D4BA 1N23A 2DRRA 3QRYA 2F0YB 1LXMA 3W7UA 1H36A 1OJOA 1FMIA 2BBCA 3EUVB 1NC5A 2H6FB 1V5DA 4GTVB 2R2LB 1S64B 1HM2A 3QWTA 5MEHA 1GXMA 3N0FA 1KSDA 3KSLB 2NOJA 1KKTA 3M7CA 1F9OA 2BRVX 2JF4A 2FV1A 3WKGA 3P5RA 1KFGA 1UG9A 2Q1FA 3HXBB 5CA3A 2BB5A 3QFZA 4E1YA 4WVCA 3W5MA 1TF4A 5DHKA 4MMIA 1HCUA 3RRSA 3WKFA 2ZISB 1O6RA 3PZ2B 3Q73B 2G0DA 3M7LA 5M7IA 1DOGA 1FCEA 2GOXA 1IS9A 1FO3A 4D94A 1LTXB 3ACSA 4LNBB 1G6IA 4DI5A 2EAEA 1QAZA 1O5MB 4OK4A 2BRWA 3VSMA 1G9GA 1FO2A 5AGDA 1GAHA 2BRPA 1DL2A 4AYOA 3EQAA 1HM3A 2BEDB 2D5JA 1C82A 5C05A 3DSSB 3RSYA 1LD8B 1CB8A 1WU4A 2WINB 3Q79B 5DGQA 1S63B 3D5SA 4GTTB 1HMUA 1OJMA 3M73A 2YIKA 3M00A 1UMPA 2DRQA 3NNBA 1TNOB 2D8LA 3M78A 3SFYB 2A73B 1KREA 1OJPA 5JPNB 5FO7B 3PYBA 2FUQA 3M72A 4ZH5A 4ZG8A 1AGMA 1F9GA 1W6JA 3KSQB 1FAEA 3W7TA 2E24A 3WIWA 1SQCA 3CIHA 5GZKA 1HMWA 3QT9A 4ZH1A 3WC3A 1O6HA 1RQ5A 2H6HB 1KZOB 3E32B 3Q78B 5ILJA 3E34B 4YDEB 1QQFA 1FP3A 3E37B 4QT9A 5IK0A 3M75A 1SA4B 2IEJB 3W7WA 4GTOB 1N7QA 1V5CA 3ON6A 4CJ1A 1GXOA 2ZIRB 3EZ8A 1RWCA 3WIQA 3SAEA 4TF4A 1V7XA 3GT5A 2QNOA 4D4DA 3M7BA 4WVAA 1RWAA 4DOEA 2OKXA 3DPYB 2RI9A 4ZRPA 1X1IA 5IKHA 4GTQB 1GAIA 3DSWB 1H39A 4GTRB 3QG0A 2WY8A 1J0NA 3SDRA 3EU8A 3ACTA 5KKBA 1H3AA 4CE7A 3VSNA 1LD7B 1RWGA 1N9AB 2E22A 1XW2A 4FNVA 5ILHA 1GA2A 5ILYA 2V8JA 4OJZA 5FO8B 1G87A 1FPPB 1GLMA 2FUZA 3DSTB 1TN8B 2NVPA 3DSUB 1GSZA 1FBWA 5FO9B 1F1SA 1H37A 3GLYA 2DROA 3M76A 2VN7A 4Z4LA 4KKJA 1O1RB 4FXKB 1HN0A 1N22A 4GTPB 4NEIA 2JG0A 1N1ZA 1W3YA 1N4PB 1R76A 1O1TB 4RNQA 4YCRA 4OZVA 1N95B 4KKIA 1N7NA 3E6UA 4CJ0A 3W7XA 4Z4JA 3E80A 2XWBB 2GH4A 1XWTA 2EADA 5IL3A 1FBOA 5GY3A 4V1RA 4FXGB 5ILZA 3S9VA 1HV6A 2G02A 4KTPA 5GW7A 1UT9A 1KZPB 3E33B 1JCSB 4LNGB 3M02A 4C1SA 4EL8A 1SA5B 1TN6B 5IK9A 2WCOA 4Q88A 4GTSB 4M76A 1HX9A 3QSPA 3K11A 1N7PA 2XWJB 1JCRB 1TN7B 2AHGA 2VN4A 3PYAA 4L9PB 1HXCA 1D8EB 3AFLA 2FUTA 1KRFA 5IM1A 5CZLA 2RI8A 1ULVA 2V8KA 3H2WA 4ZRQA 4V1SA 3OXUA 5IK6A 3P5PA 1N4SB 1RWHA 3S4AA 1N1BA
chains in the Genus database with same CATH topology
3M77A 2Z07A 2FV0A 3QFYA 3SDQA 1HZFA 1H3CA 3HXDB 3M74A 1H54A 3E30B 1H35A 1GXNA 2B4FA 3P2CA 4BOKA 3RJ3A 3WKHA 3PZ4B 3QT3A 5JPMB 4GTMB 5FOBB 2EACA 1N94B 1DCEB 4JJJA 3WKIA 3RX7A 2PMVA 3DSXB 4L0GA 2H6IB 1O79A 5DGRA 2P0VA 4MU9A 4AYRA 3C72B 3T33A 1TNBB 5CD2A 4LNVA 3VXDA 2DRSA 1D8DB 3PMMA 3Q7AB 3SFXB 3SDVA 1KSCA 3WIRA 3S4DA 4XUVA 1JS4A 3RENA 3DSVB 3HXCB 3RX8A 3S4CA 4EHMB 3GZKA 3SDUA 2SQCA 2ZBLA 1QBQB 3DRAB 3S4BA 2AFAA 3ANIA 1H3BA 1WU5A 1NL4B 3WUXA 1MZCB 4WVBA 1C3DA 3W5NA 1NI1B 5E2JA 3M7EA 3ANJA 3A3VA 3HXEB 1H12A 1N4RB 2CQTA 3D5RA 1KS8A 1TNZB 3AFJA 1TNUB 2F6DA 1CLCA 1FT1B 4J5TA 3M71A 4YDOB 4MBGB 2XFGA 4BOJA 2GZ6A 3ANKA 1IA7A 2XQWA 2EABA 3EU5B 2H6GB 1TNYB 3CU7A 2JJBA 3TF4A 2PN5A 3QXFA 4D4AA 3OEDA 1FT2B 4D4CA 2WIIB 4DODA 1X81B 3HXFB 3QDEA 3PZ1B 1IA6A 3X17A 3H3KA 3Q7FB 1N4QB 1H13A 1V7WA 4WU0A 2V3NA 2WYNA 1KWFA 1XWQA 3RX5A 3KLSA 1WZZA 1VD5A 1AYXA 3K7XA 3PZ3B 3D3IA 1L2AA 1GHQA 3H7LA 3W7SA 1G9JA 1NXCA 3E73A 2ZZRA 3G6JB 1JCQB 1O6QA 2I07B 4FUSA 2WY7A 4Q2BA 3SQCA 4ONTA 4KTRA 4AYQA 1WU6A 2AHFA 2RGKA 4GL3A 3Q75B 5M7YA 2BB6A 1L1YA 2V3PA 2B39A 1W6KA 3KQ4A 1LF6A 1K72A 1H14A 3QPFA 1LF9A 2FBAA 1QSJA 1F9DA 1X9DA 4L6XA 2V8IA 4LIXA 3SDTA 3QXQA 4AYPA 2CQSA 4TXTA 1V7VA 1O1SB 3VW5A 1CEMA 2A8ZA 4D4BA 2DRRA 3QRYA 2F0YB 3W7UA 1H36A 1FMIA 2BBCA 3EUVB 1NC5A 2H6FB 1V5DA 4GTVB 2R2LB 1S64B 3QWTA 5MEHA 1GXMA 3KSLB 1KSDA 2NOJA 1KKTA 3M7CA 1F9OA 2JF4A 2FV1A 3WKGA 3P5RA 1KFGA 1UG9A 3HXBB 5CA3A 2BB5A 3QFZA 4WVCA 3W5MA 1TF4A 1HCUA 3RRSA 3WKFA 2ZISB 1O6RA 3PZ2B 3Q73B 2G0DA 3M7LA 5M7IA 1DOGA 1FCEA 2GOXA 1IS9A 1FO3A 4D94A 1LTXB 3ACSA 4LNBB 1G6IA 2EAEA 1O5MB 1G9GA 1FO2A 5AGDA 1GAHA 1DL2A 4AYOA 3EQAA 2BEDB 2D5JA 3DSSB 3RSYA 1LD8B 1WU4A 2WINB 3Q79B 5DGQA 1S63B 3D5SA 4GTTB 3M73A 2YIKA 1UMPA 2DRQA 1TNOB 2D8LA 3M78A 3SFYB 2A73B 1KREA 5JPNB 5FO7B 3PYBA 3M72A 4ZH5A 4ZG8A 1AGMA 1W6JA 3KSQB 1FAEA 3W7TA 3WIWA 1SQCA 3CIHA 5GZKA 3QT9A 4ZH1A 3WC3A 1O6HA 1RQ5A 2H6HB 1KZOB 3E32B 3Q78B 3E34B 4YDEB 1QQFA 1FP3A 3E37B 4QT9A 3M75A 1SA4B 2IEJB 3W7WA 4GTOB 1V5CA 3ON6A 4CJ1A 1GXOA 2ZIRB 3EZ8A 3WIQA 3SAEA 4TF4A 1V7XA 3GT5A 2QNOA 4D4DA 3M7BA 4WVAA 4DOEA 2OKXA 3DPYB 2RI9A 4ZRPA 4GTQB 1GAIA 3DSWB 1H39A 4GTRB 3QG0A 2WY8A 3SDRA 3EU8A 3ACTA 5KKBA 1H3AA 4CE7A 1LD7B 1N9AB 1XW2A 1GA2A 2V8JA 5FO8B 1G87A 1FPPB 1GLMA 2FUZA 3DSTB 1TN8B 2NVPA 3DSUB 1GSZA 1FBWA 5FO9B 1H37A 3GLYA 2DROA 3M76A 2VN7A 4Z4LA 4KKJA 1O1RB 4FXKB 4GTPB 2JG0A 1N4PB 1R76A 1O1TB 4YCRA 1N95B 4KKIA 3E6UA 4CJ0A 3W7XA 4Z4JA 2XWBB 2GH4A 1XWTA 2EADA 1FBOA 5GY3A 4V1RA 4FXGB 3S9VA 2G02A 4KTPA 5GW7A 1UT9A 1KZPB 3E33B 1JCSB 4LNGB 4C1SA 4EL8A 1SA5B 1TN6B 4Q88A 4GTSB 4M76A 3QSPA 3K11A 2XWJB 1JCRB 3PYAA 1TN7B 2AHGA 2VN4A 4L9PB 1D8EB 1KRFA 5CZLA 2RI8A 1ULVA 2V8KA 3H2WA 4ZRQA 4V1SA 3OXUA 3P5PA 1N4SB 3S4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSW B;  1H39 A;  3Q7F B;  4GTR B;  2WY8 A;  1HZF A;  1H3C A;  1N4Q B;  3HXD B;  1H3A A;  2ZIS B;  3E30 B;  1H35 A;  1O6R A;  3PZ2 B;  1LD7 B;  3Q73 B;  1N9A B;  1GXN A;  2G0D A;  2V3N A;  2GOX A;  2V8J A;  4BOK A;  3RJ3 A;  4D94 A;  1LTX B;  4LNB B;  5FO8 B;  1FPP B;  3KLS A;  3PZ4 B;  5JPM B;  4GTM B;  3DST B;  3K7X A;  1O5M B;  1TN8 B;  3PZ3 B;  5FOB B;  3DSU B;  1GSZ A;  1N94 B;  1DCE B;  1GHQ A;  5AGD A;  5FO9 B;  2PMV A;  1H37 A;  2BED B;  3DSX B;  2H6I B;  1O79 A;  3G6J B;  1JCQ B;  1O6Q A;  2I07 B;  3SQC A;  2WY7 A;  3DSS B;  1LD8 B;  4ONT A;  4KKJ A;  1O1R B;  4MU9 A;  3C72 B;  1TNB B;  4FXK B;  4GTP B;  4LNV A;  2WIN B;  1D8D B;  3Q79 B;  1N4P B;  3Q7A B;  1S63 B;  3D5S A;  1R76 A;  4GTT B;  3SFX B;  3Q75 B;  1O1T B;  2BB6 A;  1N95 B;  4KKI A;  1UMP A;  2V3P A;  2B39 A;  1W6K A;  1TNO B;  3SFY B;  3KQ4 A;  2A73 B;  5JPN B;  5FO7 B;  3DSV B;  3HXC B;  4EHM B;  2SQC A;  1QBQ B;  3DRA B;  2XWB B;  1W6J A;  3KSQ B;  1H3B A;  1NL4 B;  1QSJ A;  1SQC A;  4V1R A;  4FXG B;  2G02 A;  2V8I A;  1MZC B;  4ZH1 A;  1C3D A;  1O6H A;  1NI1 B;  2H6H B;  1KZP B;  1KZO B;  3E33 B;  1JCS B;  3E32 B;  3Q78 B;  4LNG B;  1O1S B;  3E34 B;  4YDE B;  1QQF A;  3HXE B;  4C1S A;  1SA5 B;  1TN6 B;  4D4B A;  1N4R B;  2F0Y B;  3D5R A;  1TNZ B;  3E37 B;  1TNU B;  1H36 A;  1SA4 B;  2BBC A;  3EUV B;  1FT1 B;  2H6F B;  4GTS B;  4M76 A;  2IEJ B;  4YDO B;  4GTV B;  4GTO B;  2R2L B;  1S64 B;  4MBG B;  4BOJ A;  1GXM A;  2XWJ B;  1JCR B;  1TN7 B;  4L9P B;  3KSL B;  2XQW A;  3EU5 B;  2NOJ A;  1GXO A;  1TNY B;  2H6G B;  2ZIR B;  3CU7 A;  1D8E B;  2PN5 A;  4D4A A;  3OED A;  1FT2 B;  2V8K A;  4ZRQ A;  4V1S A;  4D4C A;  2WII B;  3OXU A;  3HXB B;  4D4D A;  2BB5 A;  1X81 B;  3HXF B;  1N4S B;  3DPY B;  4ZRP A;  3PZ1 B;  4GTQ B; 
#chains in the Genus database with same CATH topology
 1LOH A;  3M77 A;  2Z07 A;  2FV0 A;  3QFY A;  3SDQ A;  1HZF A;  1H3C A;  1X1H A;  3HXD B;  3M74 A;  1H54 A;  3E30 B;  1H35 A;  1GXN A;  4FJQ A;  1N7R A;  2B4F A;  3P2C A;  1N24 A;  4BOK A;  3RJ3 A;  3WKH A;  3PZ4 B;  3QT3 A;  5JPM B;  3M01 A;  4GTM B;  5FOB B;  2EAC A;  1N94 B;  1DCE B;  5EAU A;  4JJJ A;  3WKI A;  3RX7 A;  2PMV A;  4GAX A;  3DSX B;  4L0G A;  1X1J A;  2H6I B;  1O79 A;  5EAT A;  5DGR A;  2P0V A;  4MU9 A;  4AYR A;  3C72 B;  3T33 A;  1TNB B;  5CD2 A;  4LNV A;  3VXD A;  2DRS A;  1D8D B;  3PMM A;  3Q7A B;  3SFX B;  3SDV A;  1KSC A;  1EGU A;  5ILD A;  3WIR A;  3S4D A;  4XUV A;  1JS4 A;  3REN A;  4F13 A;  3DSV B;  3HXC B;  3RX8 A;  3S4C A;  4EHM B;  3GZK A;  5ILI A;  3SDU A;  2SQC A;  2ZBL A;  1QBQ B;  3DRA B;  3S4B A;  3NFV A;  2AFA A;  3ANI A;  1H3B A;  1WU5 A;  1NL4 B;  3WUX A;  1MZC B;  4OK2 A;  4WVB A;  1C3D A;  3W5N A;  3E7J A;  1NI1 B;  5E2J A;  3M7E A;  3ANJ A;  4MMH A;  3A3V A;  3HXE B;  2ONG A;  1H12 A;  1N4R B;  2CQT A;  3D5R A;  1KS8 A;  1TNZ B;  3AFJ A;  1TNU B;  1HXG A;  2F6D A;  1CLC A;  1FT1 B;  4J5T A;  1N21 A;  3M71 A;  1N20 A;  4YDO B;  4MBG B;  2XFG A;  1OJN A;  4BOJ A;  2GZ6 A;  3ANK A;  1IA7 A;  2XQW A;  2EAB A;  3EU5 B;  2H6G B;  1TNY B;  3CU7 A;  2JJB A;  3TF4 A;  2PN5 A;  3QXF A;  3N0G A;  4D4A A;  3OED A;  5DHI A;  1FT2 B;  4D4C A;  2WII B;  4DOD A;  1X81 B;  3HXF B;  3QDE A;  1IA6 A;  3PZ1 B;  3X17 A;  4F10 A;  3H3K A;  3Q7F B;  2ONH A;  1N4Q B;  4OZW A;  1RW9 A;  3G4D A;  1H13 A;  1V7W A;  3LZ9 A;  4WU0 A;  2V3N A;  2WYN A;  1KWF A;  1HXA A;  1XWQ A;  3RX5 A;  3KLS A;  1WZZ A;  1VD5 A;  1AYX A;  3K7X A;  1LXK A;  3PZ3 B;  3D3I A;  1L2A A;  1GHQ A;  3G4F A;  3H7L A;  3W7S A;  1G9J A;  5ILK A;  1N7O A;  1NXC A;  3E73 A;  5EAS A;  2ZZR A;  3G6J B;  1JCQ B;  1O6Q A;  2I07 B;  4FUS A;  2WY7 A;  4Q2B A;  3SQC A;  4ONT A;  4KTR A;  4AYQ A;  2X03 A;  1WU6 A;  1RWF A;  1J0M A;  2AHF A;  2RGK A;  4GL3 A;  3Q75 B;  5M7Y A;  2J5C A;  2BB6 A;  1L1Y A;  2V3P A;  2B39 A;  1W6K A;  3KQ4 A;  5JMF A;  1LF6 A;  1K72 A;  2WDA A;  1H14 A;  3QPF A;  1I8Q A;  1LF9 A;  2FBA A;  1QSJ A;  1F9D A;  1X9D A;  3A0O A;  4L6X A;  2V8I A;  4LIX A;  3SDT A;  3QXQ A;  4AYP A;  2CQS A;  4TXT A;  5JMD A;  1V7V A;  5IKA A;  1O1S B;  5IL8 A;  3VW5 A;  1CEM A;  2A8Z A;  4D4B A;  1N23 A;  2DRR A;  3QRY A;  2F0Y B;  1LXM A;  3W7U A;  1H36 A;  1OJO A;  1FMI A;  2BBC A;  3EUV B;  1NC5 A;  2H6F B;  1V5D A;  4GTV B;  2R2L B;  1S64 B;  1HM2 A;  3QWT A;  5MEH A;  1GXM A;  3N0F A;  1KSD A;  3KSL B;  2NOJ A;  1KKT A;  3M7C A;  1F9O A;  2BRV X;  2JF4 A;  2FV1 A;  3WKG A;  3P5R A;  1KFG A;  1UG9 A;  2Q1F A;  3HXB B;  5CA3 A;  2BB5 A;  3QFZ A;  4E1Y A;  4WVC A;  3W5M A;  1TF4 A;  5DHK A;  4MMI A;  1HCU A;  3RRS A;  3WKF A;  2ZIS B;  1O6R A;  3PZ2 B;  3Q73 B;  2G0D A;  3M7L A;  5M7I A;  1DOG A;  1FCE A;  2GOX A;  1IS9 A;  1FO3 A;  4D94 A;  1LTX B;  3ACS A;  4LNB B;  1G6I A;  4DI5 A;  2EAE A;  1QAZ A;  1O5M B;  4OK4 A;  2BRW A;  3VSM A;  1G9G A;  1FO2 A;  5AGD A;  1GAH A;  2BRP A;  1DL2 A;  4AYO A;  3EQA A;  1HM3 A;  2BED B;  2D5J A;  1C82 A;  5C05 A;  3DSS B;  3RSY A;  1LD8 B;  1CB8 A;  1WU4 A;  2WIN B;  3Q79 B;  5DGQ A;  1S63 B;  3D5S A;  4GTT B;  1HMU A;  1OJM A;  3M73 A;  2YIK A;  3M00 A;  1UMP A;  2DRQ A;  3NNB A;  1TNO B;  2D8L A;  3M78 A;  3SFY B;  2A73 B;  1KRE A;  1OJP A;  5JPN B;  5FO7 B;  3PYB A;  2FUQ A;  3M72 A;  4ZH5 A;  4ZG8 A;  1AGM A;  1F9G A;  1W6J A;  3KSQ B;  1FAE A;  3W7T A;  2E24 A;  3WIW A;  1SQC A;  3CIH A;  5GZK A;  1HMW A;  3QT9 A;  4ZH1 A;  3WC3 A;  1O6H A;  1RQ5 A;  2H6H B;  1KZO B;  3E32 B;  3Q78 B;  5ILJ A;  3E34 B;  4YDE B;  1QQF A;  1FP3 A;  3E37 B;  4QT9 A;  5IK0 A;  3M75 A;  1SA4 B;  2IEJ B;  3W7W A;  4GTO B;  1N7Q A;  1V5C A;  3ON6 A;  4CJ1 A;  1GXO A;  2ZIR B;  3EZ8 A;  1RWC A;  3WIQ A;  3SAE A;  4TF4 A;  1V7X A;  3GT5 A;  2QNO A;  4D4D A;  3M7B A;  4WVA A;  1RWA A;  4DOE A;  2OKX A;  3DPY B;  2RI9 A;  4ZRP A;  1X1I A;  5IKH A;  4GTQ B;  1GAI A;  3DSW B;  1H39 A;  4GTR B;  3QG0 A;  2WY8 A;  1J0N A;  3SDR A;  3EU8 A;  3ACT A;  5KKB A;  1H3A A;  4CE7 A;  3VSN A;  1LD7 B;  1RWG A;  1N9A B;  2E22 A;  1XW2 A;  4FNV A;  5ILH A;  1GA2 A;  5ILY A;  2V8J A;  4OJZ A;  5FO8 B;  1G87 A;  1FPP B;  1GLM A;  2FUZ A;  3DST B;  1TN8 B;  2NVP A;  3DSU B;  1GSZ A;  1FBW A;  5FO9 B;  1F1S A;  1H37 A;  3GLY A;  2DRO A;  3M76 A;  2VN7 A;  4Z4L A;  4KKJ A;  1O1R B;  4FXK B;  1HN0 A;  1N22 A;  4GTP B;  4NEI A;  2JG0 A;  1N1Z A;  1W3Y A;  1N4P B;  1R76 A;  1O1T B;  4RNQ A;  4YCR A;  4OZV A;  1N95 B;  4KKI A;  1N7N A;  3E6U A;  4CJ0 A;  3W7X A;  4Z4J A;  3E80 A;  2XWB B;  2GH4 A;  1XWT A;  2EAD A;  5IL3 A;  1FBO A;  5GY3 A;  4V1R A;  4FXG B;  5ILZ A;  3S9V A;  1HV6 A;  2G02 A;  4KTP A;  5GW7 A;  1UT9 A;  1KZP B;  3E33 B;  1JCS B;  4LNG B;  3M02 A;  4C1S A;  4EL8 A;  1SA5 B;  1TN6 B;  5IK9 A;  2WCO A;  4Q88 A;  4GTS B;  4M76 A;  1HX9 A;  3QSP A;  3K11 A;  1N7P A;  2XWJ B;  1JCR B;  1TN7 B;  2AHG A;  2VN4 A;  3PYA A;  4L9P B;  1HXC A;  1D8E B;  3AFL A;  2FUT A;  1KRF A;  5IM1 A;  5CZL A;  2RI8 A;  1ULV A;  2V8K A;  3H2W A;  4ZRQ A;  4V1S A;  3OXU A;  5IK6 A;  3P5P A;  1N4S B;  1RWH A;  3S4A A;  1N1B A; 
#chains in the Genus database with same CATH homology
 3M77 A;  2Z07 A;  2FV0 A;  3QFY A;  3SDQ A;  1HZF A;  1H3C A;  3HXD B;  3M74 A;  1H54 A;  3E30 B;  1H35 A;  1GXN A;  2B4F A;  3P2C A;  4BOK A;  3RJ3 A;  3WKH A;  3PZ4 B;  3QT3 A;  5JPM B;  4GTM B;  5FOB B;  2EAC A;  1N94 B;  1DCE B;  4JJJ A;  3WKI A;  3RX7 A;  2PMV A;  3DSX B;  4L0G A;  2H6I B;  1O79 A;  5DGR A;  2P0V A;  4MU9 A;  4AYR A;  3C72 B;  3T33 A;  1TNB B;  5CD2 A;  4LNV A;  3VXD A;  2DRS A;  1D8D B;  3PMM A;  3Q7A B;  3SFX B;  3SDV A;  1KSC A;  3WIR A;  3S4D A;  4XUV A;  1JS4 A;  3REN A;  3DSV B;  3HXC B;  3RX8 A;  3S4C A;  4EHM B;  3GZK A;  3SDU A;  2SQC A;  2ZBL A;  1QBQ B;  3DRA B;  3S4B A;  2AFA A;  3ANI A;  1H3B A;  1WU5 A;  1NL4 B;  3WUX A;  1MZC B;  4WVB A;  1C3D A;  3W5N A;  1NI1 B;  5E2J A;  3M7E A;  3ANJ A;  3A3V A;  3HXE B;  1H12 A;  1N4R B;  2CQT A;  3D5R A;  1KS8 A;  1TNZ B;  3AFJ A;  1TNU B;  2F6D A;  1CLC A;  1FT1 B;  4J5T A;  3M71 A;  4YDO B;  4MBG B;  2XFG A;  4BOJ A;  2GZ6 A;  3ANK A;  1IA7 A;  2XQW A;  2EAB A;  3EU5 B;  2H6G B;  1TNY B;  3CU7 A;  2JJB A;  3TF4 A;  2PN5 A;  3QXF A;  4D4A A;  3OED A;  1FT2 B;  4D4C A;  2WII B;  4DOD A;  1X81 B;  3HXF B;  3QDE A;  3PZ1 B;  1IA6 A;  3X17 A;  3H3K A;  3Q7F B;  1N4Q B;  1H13 A;  1V7W A;  4WU0 A;  2V3N A;  2WYN A;  1KWF A;  1XWQ A;  3RX5 A;  3KLS A;  1WZZ A;  1VD5 A;  1AYX A;  3K7X A;  3PZ3 B;  3D3I A;  1L2A A;  1GHQ A;  3H7L A;  3W7S A;  1G9J A;  1NXC A;  3E73 A;  2ZZR A;  3G6J B;  1JCQ B;  1O6Q A;  2I07 B;  4FUS A;  2WY7 A;  4Q2B A;  3SQC A;  4ONT A;  4KTR A;  4AYQ A;  1WU6 A;  2AHF A;  2RGK A;  4GL3 A;  3Q75 B;  5M7Y A;  2BB6 A;  1L1Y A;  2V3P A;  2B39 A;  1W6K A;  3KQ4 A;  1LF6 A;  1K72 A;  1H14 A;  3QPF A;  1LF9 A;  2FBA A;  1QSJ A;  1F9D A;  1X9D A;  4L6X A;  2V8I A;  4LIX A;  3SDT A;  3QXQ A;  4AYP A;  2CQS A;  4TXT A;  1V7V A;  1O1S B;  3VW5 A;  1CEM A;  2A8Z A;  4D4B A;  2DRR A;  3QRY A;  2F0Y B;  3W7U A;  1H36 A;  1FMI A;  2BBC A;  3EUV B;  1NC5 A;  2H6F B;  1V5D A;  4GTV B;  2R2L B;  1S64 B;  3QWT A;  5MEH A;  1GXM A;  3KSL B;  1KSD A;  2NOJ A;  1KKT A;  3M7C A;  1F9O A;  2JF4 A;  2FV1 A;  3WKG A;  3P5R A;  1KFG A;  1UG9 A;  3HXB B;  5CA3 A;  2BB5 A;  3QFZ A;  4WVC A;  3W5M A;  1TF4 A;  1HCU A;  3RRS A;  3WKF A;  2ZIS B;  1O6R A;  3PZ2 B;  3Q73 B;  2G0D A;  3M7L A;  5M7I A;  1DOG A;  1FCE A;  2GOX A;  1IS9 A;  1FO3 A;  4D94 A;  1LTX B;  3ACS A;  4LNB B;  1G6I A;  2EAE A;  1O5M B;  1G9G A;  1FO2 A;  5AGD A;  1GAH A;  1DL2 A;  4AYO A;  3EQA A;  2BED B;  2D5J A;  3DSS B;  3RSY A;  1LD8 B;  1WU4 A;  2WIN B;  3Q79 B;  5DGQ A;  1S63 B;  3D5S A;  4GTT B;  3M73 A;  2YIK A;  1UMP A;  2DRQ A;  1TNO B;  2D8L A;  3M78 A;  3SFY B;  2A73 B;  1KRE A;  5JPN B;  5FO7 B;  3PYB A;  3M72 A;  4ZH5 A;  4ZG8 A;  1AGM A;  1W6J A;  3KSQ B;  1FAE A;  3W7T A;  3WIW A;  1SQC A;  3CIH A;  5GZK A;  3QT9 A;  4ZH1 A;  3WC3 A;  1O6H A;  1RQ5 A;  2H6H B;  1KZO B;  3E32 B;  3Q78 B;  3E34 B;  4YDE B;  1QQF A;  1FP3 A;  3E37 B;  4QT9 A;  3M75 A;  1SA4 B;  2IEJ B;  3W7W A;  4GTO B;  1V5C A;  3ON6 A;  4CJ1 A;  1GXO A;  2ZIR B;  3EZ8 A;  3WIQ A;  3SAE A;  4TF4 A;  1V7X A;  3GT5 A;  2QNO A;  4D4D A;  3M7B A;  4WVA A;  4DOE A;  2OKX A;  3DPY B;  2RI9 A;  4ZRP A;  4GTQ B;  1GAI A;  3DSW B;  1H39 A;  4GTR B;  3QG0 A;  2WY8 A;  3SDR A;  3EU8 A;  3ACT A;  5KKB A;  1H3A A;  4CE7 A;  1LD7 B;  1N9A B;  1XW2 A;  1GA2 A;  2V8J A;  5FO8 B;  1G87 A;  1FPP B;  1GLM A;  2FUZ A;  3DST B;  1TN8 B;  2NVP A;  3DSU B;  1GSZ A;  1FBW A;  5FO9 B;  1H37 A;  3GLY A;  2DRO A;  3M76 A;  2VN7 A;  4Z4L A;  4KKJ A;  1O1R B;  4FXK B;  4GTP B;  2JG0 A;  1N4P B;  1R76 A;  1O1T B;  4YCR A;  1N95 B;  4KKI A;  3E6U A;  4CJ0 A;  3W7X A;  4Z4J A;  2XWB B;  2GH4 A;  1XWT A;  2EAD A;  1FBO A;  5GY3 A;  4V1R A;  4FXG B;  3S9V A;  2G02 A;  4KTP A;  5GW7 A;  1UT9 A;  1KZP B;  3E33 B;  1JCS B;  4LNG B;  4C1S A;  4EL8 A;  1SA5 B;  1TN6 B;  4Q88 A;  4GTS B;  4M76 A;  3QSP A;  3K11 A;  2XWJ B;  1JCR B;  3PYA A;  1TN7 B;  2AHG A;  2VN4 A;  4L9P B;  1D8E B;  1KRF A;  5CZL A;  2RI8 A;  1ULV A;  2V8K A;  3H2W A;  4ZRQ A;  4V1S A;  3OXU A;  3P5P A;  1N4S B;  3S4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...