1IA7A

Crystal structure of the cellulase cel9m of c. cellulolyticium in complex with cellobiose
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
431
structure length
431
Chain Sequence
b'AGTHDYSTALKDSIIFFDANKCGPQAGENNVFDWRGACHTTDGSDVGVDLTGGYHDAGDHVKFGLPQGYSAAILGWSLYEFKESFDATGNTTKMLQQLKYFTDYFLKSHPNSTTFYYQVGEGNADHTYWGAPEEQTGQRPSLYKADPSSPASDILSETSAALTLMYLNYKNIDSAYATKCLNAAKELYAMGKANQGVGNGQSFYQATSFGDDLAWAATWLYTATNDSTYITDAEQFITLGNTMNENKMQDKWTMCWDDMYVPAALRLAQITGKQIYKDAIEFNFNYWKTQVTTTPGGLKWLSNWGVLRYAAAESMVMLVYCKQNPDQSLLDLAKKQVDYILGDNPANMSYIIGYGSNWCIHPHHRAANGYTYANGDNAKPAKHLLTGALVGGPDQNDKFLDDANQYQYTEVALDYNAGLVGVLAGAIKFFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELLULASE CEL9M
publication title Crystal structure of the cellulase Cel9M enlightens structure/function relationships of the variable catalytic modules in glycoside hydrolases.
pubmed doi rcsb
source organism Clostridium cellulolyticum
molecule tags Hydrolase
total genus 177
structure length 431
sequence length 431
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ia7A00
5E2JA 3QXFA 1GA2A 4CE7A 3EZ8A 4WVBA 2P0VA 3S4DA 3ACSA 1JS4A 1V7WA 1IA7A 2DRRA 3ANIA 3ACTA 3K11A 4WVCA 1G6IA 3E73A 1AYXA 3QSPA 2YIKA 3WIRA 1H13A 3D3IA 1F9DA 5DGQA 3H3KA 4DOEA 3S4CA 3CIHA 1FBWA 2RI9A 1KSDA 3QRYA 2WYNA 3RSYA 2F6DA 1WU4A 2GH4A 2VN4A 3W7UA 4FUSA 4L0GA 1L1YA 3W7XA 2OKXA 1GAHA 1DL2A 4Q88A 1XW2A 1KFGA 4JJJA 4AYPA 3WC3A 3T33A 2DROA 4TXTA 5GW7A 1DOGA 3S4BA 1VD5A 3W7WA 4Z4JA 3QDEA 3W5NA 1AGMA 1FAEA 3QXQA 2XFGA 5DGRA 1FCEA 2B4FA 2FUZA 1GAIA 1F9OA 2CQSA 2FV0A 2D5JA 4DODA 3WKHA 1FO2A 2EADA 4WU0A 3W7SA 4AYOA 4XUVA 3WUXA 3H2WA 2D8LA 1GLMA 1WU5A 1G87A 4EL8A 1KREA 1X9DA 2EABA 3WIWA 1V7XA 2EAEA 1FBOA 3RX7A 3WKGA 4KTPA 1K72A 3RRSA 3QWTA 1RQ5A 3EQAA 4AYRA 1XWQA 3QG0A 3RX8A 2QNOA 2GZ6A 2EACA 3A3VA 1NC5A 1KRFA 2AFAA 2DRSA 1G9JA 1FP3A 2RGKA 3H7LA 3QFYA 5CA3A 4Z4LA 4Q2BA 3ANKA 2ZBLA 2NVPA 5M7YA 1WZZA 1XWTA 3ANJA 3RX5A 4ZH5A 2A8ZA 2CQTA 3GZKA 1CLCA 1HCUA 2RI8A 1V7VA 1G9GA 2FV1A 5CD2A 3S4AA 3VXDA 3WKIA 2DRQA 2VN7A 3W7TA 3W5MA 4CJ1A 1H12A 3VW5A 1FO3A 1V5DA 2Z07A 3E6UA 4J5TA 4CJ0A 5KKBA 5M7IA 3WIQA 3WKFA 3AFJA 4TF4A 3QFZA 4AYQA 5CZLA 2ZZRA 4WVAA 1KS8A 1FMIA 3RENA 1H14A 4L6XA 1LF6A 1H54A 1UT9A 2AHFA 1KKTA 1WU6A 1V5CA 2JJBA 1IS9A 3P2CA 1IA6A 2FBAA 1LF9A 5GY3A 1KWFA 1L2AA 5MEHA 4KTRA 3QT9A 3GT5A 3PMMA 1ULVA 4ZG8A 2AHGA 1CEMA 1KSCA 1TF4A 3QPFA 1UG9A 3QT3A 3ON6A 1NXCA 2JG0A 2JF4A 3GLYA 3TF4A 3X17A
chains in the Genus database with same CATH superfamily
1C82A 1N4RB 1GA2A 4LIXA 4MU9A 1RWAA 3P5PA 5FO9B 2BB6A 1V7WA 3KLSA 5IL8A 2WINB 1HX9A 1G6IA 3DRAB 1AYXA 4MBGB 3N0FA 3QSPA 4KKJA 1HMUA 2YIKA 3D3IA 4GTVB 3CIHA 3SFYB 1TNYB 2RI9A 3QRYA 1HMWA 3VSNA 3W7UA 1TNBB 1QAZA 3W7XA 3M7EA 2OKXA 1O1TB 3M78A 5IKAA 3N0GA 1N95B 2E22A 2DROA 5ILKA 5AGDA 3E32B 1VD5A 3NNBA 2XWBB 3QDEA 3C72B 1AGMA 2XFGA 2BB5A 3E30B 2B4FA 2WY8A 1GAIA 3DSUB 2D5JA 4DODA 1FT1B 3DSTB 4LNGB 4XUVA 3WUXA 1S64B 3H2WA 1G87A 4EL8A 3RX7A 1X81B 4YDEB 1O6HA 4FNVA 3RX8A 4LNBB 5JMFA 5JPNB 3EU5B 3DSXB 4ONTA 1KRFA 1FT2B 3S9VA 3H7LA 4Q2BA 2ZBLA 5M7YA 3EUVB 1OJNA 1XWTA 5FO7B 1HXAA 1CLCA 1N4SB 5DHIA 3PZ4B 5DHKA 4GL3A 3WKIA 3VXDA 3PYBA 2DRQA 2Z07A 4J5TA 5KKBA 4GTSB 1GSZA 1H3BA 1JCSB 1SQCA 4AYQA 2ZZRA 1HV6A 4WVAA 5EATA 2X03A 2NOJA 1N1BA 1TN6B 1H14A 1IA6A 1HXCA 2ONGA 1L2AA 4KTRA 3QT9A 3CU7A 3QPFA 4GTRB 3ON6A 3NFVA 2JF4A 3KSQB 3X17A 1O79A 2XQWA 3QXFA 1N9AB 1N7NA 1RWHA 4CE7A 4KKIA 4OZVA 1OJPA 3SDTA 3Q75B 1JS4A 1S63B 2SQCA 3ANIA 3K11A 3HXCB 1N4QB 4MMHA 1H13A 3G4DA 1F9DA 3M02A 5DGQA 4C1SA 3H3KA 4OK4A 4EHMB 3HXFB 1FBWA 2E24A 2F6DA 5ILDA 1O1RB 1L1YA 5IK9A 1OJOA 2BBCA 1HM2A 3A0OA 4GTMB 4Q88A 1XW2A 4YDOB 1TNZB 5EAUA 5ILYA 4Z4JA 5IK6A 3W5NA 1O5MB 1FAEA 1X1HA 3M00A 3Q79B 1N7QA 5ILJA 2R2LB 1H37A 1F9OA 2FV0A 3Q7FB 4LNVA 1GXNA 4F13A 1W6JA 2FUQA 2FUTA 2D8LA 1GLMA 5IKHA 1HZFA 1X9DA 2BRPA 4RNQA 2V3NA 1H3CA 4FXGB 1FBOA 3G4FA 4KTPA 1N1ZA 1RQ5A 5JPMB 2QNOA 4D4BA 3SQCA 2EACA 1QBQB 2BRWA 1NL4B 3RJ3A 4OJZA 3SDUA 3KQ4A 1QQFA 1HN0A 4MMIA 4OZWA 1FP3A 2WY7A 3QFYA 1X1IA 1N94B 1RWFA 2G02A 2B39A 3HXEB 3PZ1B 1R76A 2A8ZA 4YCRA 3LZ9A 3E80A 3PZ2B 1LXMA 2RI8A 1JCRB 1V7VA 1N24A 3E33B 3W7TA 3P5RA 4CJ1A 2ZISB 1V5DA 3E6UA 4CJ0A 3SAEA 1MZCB 1D8EB 2Q1FA 3WKFA 1D8DB 4TF4A 4FXKB 3Q7AB 1FMIA 3RENA 3M7BA 4L6XA 1H54A 1N4PB 1UT9A 2AHFA 1V5CA 3P2CA 4D94A 1F1SA 2I07B 3PMMA 1ULVA 4ZG8A 3SFXB 1UG9A 2XWJB 3D5SA 3M7CA 5E2JA 3EZ8A 3M7LA 2P0VA 4V1SA 3S4DA 1IA7A 4WVCA 3DSSB 4V1RA 3WIRA 1H39A 4D4AA 2PN5A 1TNUB 1X1JA 3S4CA 5IK0A 3RSYA 2GH4A 4FUSA 3Q78B 3OEDA 4NEIA 3E7JA 3M73A 1KFGA 3T33A 4ZH1A 4TXTA 3S4BA 2H6IB 1N7PA 2BEDB 3E34B 1F9GA 1DCEB 2WCOA 1FCEA 2FUZA 4AYOA 1UMPA 4D4DA 1WU5A 4OK2A 1KREA 3K7XA 3WIWA 2EAEA 3WKGA 1OJMA 3EQAA 4ZRPA 4AYRA 3M76A 3SDQA 3M77A 3QG0A 2H6GB 1RWCA 1O6QA 3KSLB 2G0DA 2AFAA 4GTPB 3VSMA 1HM3A 2RGKA 3OXUA 2F0YB 1JCQB 3ANKA 3ANJA 1J0NA 1WZZA 3EU8A 4GAXA 2V8KA 1N20A 1G9GA 1H35A 1NI1B 2VN7A 4FJQA 1FO3A 2V8JA 2V8IA 3WIQA 4BOJA 3QFZA 5CZLA 2ZIRB 1LOHA 1LF6A 1LD7B 1WU6A 1IS9A 2FBAA 1LF9A 2A73B 5GY3A 5MEHA 1TN8B 1LD8B 3GT5A 3M74A 1GXOA 1H36A 3SDRA 1CEMA 1SA4B 3QT3A 1N7OA 1N21A 1NXCA 1KZOB 2WIIB 3GLYA 3PZ3B 1I8QA 4E1YA 1RW9A 4WVBA 1H3AA 3ACSA 5IL3A 3SDVA 2DRRA 3ACTA 4D4CA 3DSWB 4GTQB 5FOBB 3E73A 1N22A 3M01A 1O1SB 3PYAA 4DOEA 1KSDA 2WYNA 3E37B 1WU4A 1TN7B 2VN4A 4L0GA 1N7RA 4QT9A 3HXBB 1CB8A 2GOXA 1GAHA 3M75A 1W6KA 1DL2A 1FPPB 4JJJA 4AYPA 3WC3A 3AFLA 2IEJB 5GW7A 1DOGA 1QSJA 3W7WA 2J5CA 2PMVA 3G6JB 3DPYB 3QXQA 5ILHA 1LXKA 5DGRA 4BOKA 2CQSA 3WKHA 1FO2A 2EADA 4WU0A 1C3DA 3W7SA 1W3YA 5GZKA 1N23A 2H6HB 1O6RA 2EABA 1V7XA 1K72A 3RRSA 3QWTA 1EGUA 1XWQA 2GZ6A 3A3VA 1NC5A 1RWGA 2DRSA 2BRVX 3Q73B 4F10A 1G9JA 5CA3A 4Z4LA 3DSVB 1J0MA 4GTTB 5IM1A 2NVPA 2ONHA 2V3PA 3RX5A 4ZH5A 2CQTA 3GZKA 2WDAA 3M71A 1GHQA 4DI5A 1HCUA 5JMDA 5FO8B 4GTOB 2FV1A 5CD2A 3S4AA 3M72A 5ILZA 3W5MA 1HXGA 1H12A 3VW5A 5M7IA 5ILIA 1KZPB 3AFJA 1GXMA 1TNOB 1LTXB 2H6FB 1KS8A 3HXDB 4M76A 1KKTA 5EASA 2JJBA 4ZRQA 1KWFA 3D5RA 4L9PB 2AHGA 1TF4A 1KSCA 1SA5B 5C05A 2JG0A 3TF4A
chains in the Genus database with same CATH topology
1N4RB 1GA2A 4LIXA 4MU9A 3P5PA 5FO9B 2BB6A 1V7WA 3KLSA 2WINB 1G6IA 3DRAB 1AYXA 4MBGB 3QSPA 4KKJA 2YIKA 3D3IA 4GTVB 3CIHA 3SFYB 1TNYB 2RI9A 3QRYA 3W7UA 1TNBB 3W7XA 3M7EA 2OKXA 1O1TB 3M78A 1N95B 2DROA 5AGDA 3E32B 1VD5A 2XWBB 3QDEA 3C72B 1AGMA 2XFGA 2BB5A 3E30B 2B4FA 2WY8A 1GAIA 3DSUB 2D5JA 4DODA 1FT1B 3DSTB 4LNGB 4XUVA 3WUXA 1S64B 3H2WA 1G87A 4EL8A 3RX7A 1X81B 4YDEB 1O6HA 3RX8A 4LNBB 5JPNB 3EU5B 3DSXB 4ONTA 1KRFA 1FT2B 3S9VA 3H7LA 4Q2BA 2ZBLA 5M7YA 1XWTA 3EUVB 5FO7B 1CLCA 1N4SB 3PZ4B 4GL3A 3WKIA 3VXDA 3PYBA 2DRQA 2Z07A 4J5TA 5KKBA 4GTSB 1GSZA 1H3BA 1JCSB 1SQCA 4AYQA 2ZZRA 4WVAA 2NOJA 1TN6B 1H14A 1IA6A 1L2AA 4KTRA 3QT9A 3CU7A 3QPFA 4GTRB 3ON6A 2JF4A 3KSQB 3X17A 1O79A 2XQWA 3QXFA 1N9AB 4CE7A 4KKIA 3SDTA 3Q75B 1JS4A 1S63B 2SQCA 3ANIA 3K11A 3HXCB 1N4QB 1H13A 1F9DA 5DGQA 4C1SA 3H3KA 4EHMB 3HXFB 1FBWA 2F6DA 1O1RB 1L1YA 2BBCA 4GTMB 4Q88A 1XW2A 4YDOB 1TNZB 4Z4JA 3W5NA 1O5MB 1FAEA 3Q79B 2R2LB 1H37A 1F9OA 2FV0A 3Q7FB 4LNVA 1GXNA 1W6JA 2D8LA 1GLMA 1HZFA 1X9DA 2V3NA 1H3CA 4FXGB 1FBOA 4KTPA 1RQ5A 5JPMB 2QNOA 4D4BA 3SQCA 2EACA 1QBQB 1NL4B 3RJ3A 3SDUA 3KQ4A 1QQFA 1FP3A 2WY7A 3QFYA 1N94B 2G02A 2B39A 3HXEB 3PZ1B 1R76A 2A8ZA 4YCRA 3PZ2B 2RI8A 1JCRB 1V7VA 3E33B 3W7TA 3P5RA 4CJ1A 2ZISB 1V5DA 3E6UA 4CJ0A 3SAEA 1MZCB 1D8EB 3WKFA 1D8DB 4TF4A 4FXKB 3Q7AB 1FMIA 3RENA 3M7BA 4L6XA 1H54A 1N4PB 1UT9A 2AHFA 1V5CA 3P2CA 4D94A 2I07B 3PMMA 1ULVA 4ZG8A 3SFXB 1UG9A 2XWJB 3D5SA 3M7CA 5E2JA 3EZ8A 3M7LA 2P0VA 4V1SA 3S4DA 1IA7A 4WVCA 3DSSB 4V1RA 3WIRA 1H39A 4D4AA 2PN5A 1TNUB 3S4CA 3RSYA 2GH4A 4FUSA 3Q78B 3OEDA 3M73A 1KFGA 3T33A 4ZH1A 4TXTA 3S4BA 2H6IB 2BEDB 3E34B 1DCEB 1FCEA 2FUZA 4AYOA 1UMPA 4D4DA 1WU5A 1KREA 3K7XA 3WIWA 2EAEA 3WKGA 3EQAA 4ZRPA 4AYRA 3M76A 3SDQA 3M77A 3QG0A 2H6GB 1O6QA 3KSLB 2G0DA 2AFAA 4GTPB 3OXUA 2RGKA 2F0YB 1JCQB 3ANKA 1WZZA 3ANJA 3EU8A 2V8KA 1G9GA 1H35A 1NI1B 2VN7A 1FO3A 2V8JA 2V8IA 3WIQA 4BOJA 3QFZA 5CZLA 2ZIRB 1LF6A 1LD7B 1WU6A 1IS9A 2FBAA 1LF9A 2A73B 5GY3A 5MEHA 1TN8B 1LD8B 3GT5A 3M74A 1GXOA 1H36A 3SDRA 1CEMA 1SA4B 3QT3A 1NXCA 1KZOB 3GLYA 3PZ3B 2WIIB 4WVBA 1H3AA 3ACSA 3SDVA 2DRRA 3ACTA 4D4CA 3DSWB 4GTQB 5FOBB 3E73A 1O1SB 3PYAA 4DOEA 1KSDA 2WYNA 3E37B 1WU4A 1TN7B 2VN4A 4L0GA 4QT9A 3HXBB 2GOXA 1GAHA 3M75A 1W6KA 1DL2A 1FPPB 4JJJA 4AYPA 3WC3A 2IEJB 5GW7A 1DOGA 1QSJA 3W7WA 2PMVA 3G6JB 3DPYB 3QXQA 5DGRA 4BOKA 2CQSA 3WKHA 1FO2A 2EADA 4WU0A 1C3DA 3W7SA 5GZKA 2H6HB 1O6RA 2EABA 1V7XA 1K72A 3RRSA 3QWTA 1XWQA 2GZ6A 3A3VA 1NC5A 2DRSA 3Q73B 1G9JA 5CA3A 4Z4LA 3DSVB 4GTTB 2NVPA 2V3PA 3RX5A 4ZH5A 2CQTA 3GZKA 3M71A 1GHQA 1HCUA 5FO8B 4GTOB 2FV1A 5CD2A 3S4AA 3M72A 3W5MA 1H12A 3VW5A 5M7IA 1KZPB 3AFJA 1GXMA 1TNOB 1LTXB 2H6FB 1KS8A 3HXDB 4M76A 1KKTA 2JJBA 4ZRQA 1KWFA 3D5RA 4L9PB 2AHGA 1TF4A 1KSCA 1SA5B 2JG0A 3TF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E2J A;  3QXF A;  1GA2 A;  4CE7 A;  3EZ8 A;  4WVB A;  2P0V A;  3S4D A;  3ACS A;  1JS4 A;  1V7W A;  1IA7 A;  2DRR A;  3ANI A;  3ACT A;  3K11 A;  4WVC A;  1G6I A;  3E73 A;  1AYX A;  3QSP A;  2YIK A;  3WIR A;  1H13 A;  3D3I A;  1F9D A;  5DGQ A;  3H3K A;  4DOE A;  3S4C A;  3CIH A;  1FBW A;  2RI9 A;  1KSD A;  3QRY A;  2WYN A;  3RSY A;  2F6D A;  1WU4 A;  2GH4 A;  2VN4 A;  3W7U A;  4FUS A;  4L0G A;  1L1Y A;  3W7X A;  2OKX A;  1GAH A;  1DL2 A;  4Q88 A;  1XW2 A;  1KFG A;  4JJJ A;  4AYP A;  3WC3 A;  3T33 A;  2DRO A;  4TXT A;  5GW7 A;  1DOG A;  3S4B A;  1VD5 A;  3W7W A;  4Z4J A;  3QDE A;  3W5N A;  1AGM A;  1FAE A;  3QXQ A;  2XFG A;  5DGR A;  1FCE A;  2B4F A;  2FUZ A;  1GAI A;  1F9O A;  2CQS A;  2FV0 A;  2D5J A;  4DOD A;  3WKH A;  1FO2 A;  2EAD A;  4WU0 A;  3W7S A;  4AYO A;  4XUV A;  3WUX A;  3H2W A;  2D8L A;  1GLM A;  1WU5 A;  1G87 A;  4EL8 A;  1KRE A;  1X9D A;  2EAB A;  3WIW A;  1V7X A;  2EAE A;  1FBO A;  3RX7 A;  3WKG A;  4KTP A;  1K72 A;  3RRS A;  3QWT A;  1RQ5 A;  3EQA A;  4AYR A;  1XWQ A;  3QG0 A;  3RX8 A;  2QNO A;  2GZ6 A;  2EAC A;  3A3V A;  1NC5 A;  1KRF A;  2AFA A;  2DRS A;  1G9J A;  1FP3 A;  2RGK A;  3H7L A;  3QFY A;  5CA3 A;  4Z4L A;  4Q2B A;  3ANK A;  2ZBL A;  2NVP A;  5M7Y A;  1WZZ A;  1XWT A;  3ANJ A;  3RX5 A;  4ZH5 A;  2A8Z A;  2CQT A;  3GZK A;  1CLC A;  1HCU A;  2RI8 A;  1V7V A;  1G9G A;  2FV1 A;  5CD2 A;  3S4A A;  3VXD A;  3WKI A;  2DRQ A;  2VN7 A;  3W7T A;  3W5M A;  4CJ1 A;  1H12 A;  3VW5 A;  1FO3 A;  1V5D A;  2Z07 A;  3E6U A;  4J5T A;  4CJ0 A;  5KKB A;  5M7I A;  3WIQ A;  3WKF A;  3AFJ A;  4TF4 A;  3QFZ A;  4AYQ A;  5CZL A;  2ZZR A;  4WVA A;  1KS8 A;  1FMI A;  3REN A;  1H14 A;  4L6X A;  1LF6 A;  1H54 A;  1UT9 A;  2AHF A;  1KKT A;  1WU6 A;  1V5C A;  2JJB A;  1IS9 A;  3P2C A;  1IA6 A;  2FBA A;  1LF9 A;  5GY3 A;  1KWF A;  1L2A A;  5MEH A;  4KTR A;  3QT9 A;  3GT5 A;  3PMM A;  1ULV A;  4ZG8 A;  2AHG A;  1CEM A;  1KSC A;  1TF4 A;  3QPF A;  1UG9 A;  3QT3 A;  3ON6 A;  1NXC A;  2JG0 A;  2JF4 A;  3GLY A;  3TF4 A;  3X17 A; 
#chains in the Genus database with same CATH topology
 1C82 A;  1N4R B;  1GA2 A;  4LIX A;  4MU9 A;  1RWA A;  3P5P A;  5FO9 B;  2BB6 A;  1V7W A;  3KLS A;  5IL8 A;  2WIN B;  1HX9 A;  1G6I A;  3DRA B;  1AYX A;  4MBG B;  3N0F A;  3QSP A;  4KKJ A;  1HMU A;  2YIK A;  3D3I A;  4GTV B;  3CIH A;  3SFY B;  1TNY B;  2RI9 A;  3QRY A;  1HMW A;  3VSN A;  3W7U A;  1TNB B;  1QAZ A;  3W7X A;  3M7E A;  2OKX A;  1O1T B;  3M78 A;  5IKA A;  3N0G A;  1N95 B;  2E22 A;  2DRO A;  5ILK A;  5AGD A;  3E32 B;  1VD5 A;  3NNB A;  2XWB B;  3QDE A;  3C72 B;  1AGM A;  2XFG A;  2BB5 A;  3E30 B;  2B4F A;  2WY8 A;  1GAI A;  3DSU B;  2D5J A;  4DOD A;  1FT1 B;  3DST B;  4LNG B;  4XUV A;  3WUX A;  1S64 B;  3H2W A;  1G87 A;  4EL8 A;  3RX7 A;  1X81 B;  4YDE B;  1O6H A;  4FNV A;  3RX8 A;  4LNB B;  5JMF A;  5JPN B;  3EU5 B;  3DSX B;  4ONT A;  1KRF A;  1FT2 B;  3S9V A;  3H7L A;  4Q2B A;  2ZBL A;  5M7Y A;  3EUV B;  1OJN A;  1XWT A;  5FO7 B;  1HXA A;  1CLC A;  1N4S B;  5DHI A;  3PZ4 B;  5DHK A;  4GL3 A;  3WKI A;  3VXD A;  3PYB A;  2DRQ A;  2Z07 A;  4J5T A;  5KKB A;  4GTS B;  1GSZ A;  1H3B A;  1JCS B;  1SQC A;  4AYQ A;  2ZZR A;  1HV6 A;  4WVA A;  5EAT A;  2X03 A;  2NOJ A;  1N1B A;  1TN6 B;  1H14 A;  1IA6 A;  1HXC A;  2ONG A;  1L2A A;  4KTR A;  3QT9 A;  3CU7 A;  3QPF A;  4GTR B;  3ON6 A;  3NFV A;  2JF4 A;  3KSQ B;  3X17 A;  1O79 A;  2XQW A;  3QXF A;  1N9A B;  1N7N A;  1RWH A;  4CE7 A;  4KKI A;  4OZV A;  1OJP A;  3SDT A;  3Q75 B;  1JS4 A;  1S63 B;  2SQC A;  3ANI A;  3K11 A;  3HXC B;  1N4Q B;  4MMH A;  1H13 A;  3G4D A;  1F9D A;  3M02 A;  5DGQ A;  4C1S A;  3H3K A;  4OK4 A;  4EHM B;  3HXF B;  1FBW A;  2E24 A;  2F6D A;  5ILD A;  1O1R B;  1L1Y A;  5IK9 A;  1OJO A;  2BBC A;  1HM2 A;  3A0O A;  4GTM B;  4Q88 A;  1XW2 A;  4YDO B;  1TNZ B;  5EAU A;  5ILY A;  4Z4J A;  5IK6 A;  3W5N A;  1O5M B;  1FAE A;  1X1H A;  3M00 A;  3Q79 B;  1N7Q A;  5ILJ A;  2R2L B;  1H37 A;  1F9O A;  2FV0 A;  3Q7F B;  4LNV A;  1GXN A;  4F13 A;  1W6J A;  2FUQ A;  2FUT A;  2D8L A;  1GLM A;  5IKH A;  1HZF A;  1X9D A;  2BRP A;  4RNQ A;  2V3N A;  1H3C A;  4FXG B;  1FBO A;  3G4F A;  4KTP A;  1N1Z A;  1RQ5 A;  5JPM B;  2QNO A;  4D4B A;  3SQC A;  2EAC A;  1QBQ B;  2BRW A;  1NL4 B;  3RJ3 A;  4OJZ A;  3SDU A;  3KQ4 A;  1QQF A;  1HN0 A;  4MMI A;  4OZW A;  1FP3 A;  2WY7 A;  3QFY A;  1X1I A;  1N94 B;  1RWF A;  2G02 A;  2B39 A;  3HXE B;  3PZ1 B;  1R76 A;  2A8Z A;  4YCR A;  3LZ9 A;  3E80 A;  3PZ2 B;  1LXM A;  2RI8 A;  1JCR B;  1V7V A;  1N24 A;  3E33 B;  3W7T A;  3P5R A;  4CJ1 A;  2ZIS B;  1V5D A;  3E6U A;  4CJ0 A;  3SAE A;  1MZC B;  1D8E B;  2Q1F A;  3WKF A;  1D8D B;  4TF4 A;  4FXK B;  3Q7A B;  1FMI A;  3REN A;  3M7B A;  4L6X A;  1H54 A;  1N4P B;  1UT9 A;  2AHF A;  1V5C A;  3P2C A;  4D94 A;  1F1S A;  2I07 B;  3PMM A;  1ULV A;  4ZG8 A;  3SFX B;  1UG9 A;  2XWJ B;  3D5S A;  3M7C A;  5E2J A;  3EZ8 A;  3M7L A;  2P0V A;  4V1S A;  3S4D A;  1IA7 A;  4WVC A;  3DSS B;  4V1R A;  3WIR A;  1H39 A;  4D4A A;  2PN5 A;  1TNU B;  1X1J A;  3S4C A;  5IK0 A;  3RSY A;  2GH4 A;  4FUS A;  3Q78 B;  3OED A;  4NEI A;  3E7J A;  3M73 A;  1KFG A;  3T33 A;  4ZH1 A;  4TXT A;  3S4B A;  2H6I B;  1N7P A;  2BED B;  3E34 B;  1F9G A;  1DCE B;  2WCO A;  1FCE A;  2FUZ A;  4AYO A;  1UMP A;  4D4D A;  1WU5 A;  4OK2 A;  1KRE A;  3K7X A;  3WIW A;  2EAE A;  3WKG A;  1OJM A;  3EQA A;  4ZRP A;  4AYR A;  3M76 A;  3SDQ A;  3M77 A;  3QG0 A;  2H6G B;  1RWC A;  1O6Q A;  3KSL B;  2G0D A;  2AFA A;  4GTP B;  3VSM A;  1HM3 A;  2RGK A;  3OXU A;  2F0Y B;  1JCQ B;  3ANK A;  3ANJ A;  1J0N A;  1WZZ A;  3EU8 A;  4GAX A;  2V8K A;  1N20 A;  1G9G A;  1H35 A;  1NI1 B;  2VN7 A;  4FJQ A;  1FO3 A;  2V8J A;  2V8I A;  3WIQ A;  4BOJ A;  3QFZ A;  5CZL A;  2ZIR B;  1LOH A;  1LF6 A;  1LD7 B;  1WU6 A;  1IS9 A;  2FBA A;  1LF9 A;  2A73 B;  5GY3 A;  5MEH A;  1TN8 B;  1LD8 B;  3GT5 A;  3M74 A;  1GXO A;  1H36 A;  3SDR A;  1CEM A;  1SA4 B;  3QT3 A;  1N7O A;  1N21 A;  1NXC A;  1KZO B;  2WII B;  3GLY A;  3PZ3 B;  1I8Q A;  4E1Y A;  1RW9 A;  4WVB A;  1H3A A;  3ACS A;  5IL3 A;  3SDV A;  2DRR A;  3ACT A;  4D4C A;  3DSW B;  4GTQ B;  5FOB B;  3E73 A;  1N22 A;  3M01 A;  1O1S B;  3PYA A;  4DOE A;  1KSD A;  2WYN A;  3E37 B;  1WU4 A;  1TN7 B;  2VN4 A;  4L0G A;  1N7R A;  4QT9 A;  3HXB B;  1CB8 A;  2GOX A;  1GAH A;  3M75 A;  1W6K A;  1DL2 A;  1FPP B;  4JJJ A;  4AYP A;  3WC3 A;  3AFL A;  2IEJ B;  5GW7 A;  1DOG A;  1QSJ A;  3W7W A;  2J5C A;  2PMV A;  3G6J B;  3DPY B;  3QXQ A;  5ILH A;  1LXK A;  5DGR A;  4BOK A;  2CQS A;  3WKH A;  1FO2 A;  2EAD A;  4WU0 A;  1C3D A;  3W7S A;  1W3Y A;  5GZK A;  1N23 A;  2H6H B;  1O6R A;  2EAB A;  1V7X A;  1K72 A;  3RRS A;  3QWT A;  1EGU A;  1XWQ A;  2GZ6 A;  3A3V A;  1NC5 A;  1RWG A;  2DRS A;  2BRV X;  3Q73 B;  4F10 A;  1G9J A;  5CA3 A;  4Z4L A;  3DSV B;  1J0M A;  4GTT B;  5IM1 A;  2NVP A;  2ONH A;  2V3P A;  3RX5 A;  4ZH5 A;  2CQT A;  3GZK A;  2WDA A;  3M71 A;  1GHQ A;  4DI5 A;  1HCU A;  5JMD A;  5FO8 B;  4GTO B;  2FV1 A;  5CD2 A;  3S4A A;  3M72 A;  5ILZ A;  3W5M A;  1HXG A;  1H12 A;  3VW5 A;  5M7I A;  5ILI A;  1KZP B;  3AFJ A;  1GXM A;  1TNO B;  1LTX B;  2H6F B;  1KS8 A;  3HXD B;  4M76 A;  1KKT A;  5EAS A;  2JJB A;  4ZRQ A;  1KWF A;  3D5R A;  4L9P B;  2AHG A;  1TF4 A;  1KSC A;  1SA5 B;  5C05 A;  2JG0 A;  3TF4 A; 
#chains in the Genus database with same CATH homology
 1N4R B;  1GA2 A;  4LIX A;  4MU9 A;  3P5P A;  5FO9 B;  2BB6 A;  1V7W A;  3KLS A;  2WIN B;  1G6I A;  3DRA B;  1AYX A;  4MBG B;  3QSP A;  4KKJ A;  2YIK A;  3D3I A;  4GTV B;  3CIH A;  3SFY B;  1TNY B;  2RI9 A;  3QRY A;  3W7U A;  1TNB B;  3W7X A;  3M7E A;  2OKX A;  1O1T B;  3M78 A;  1N95 B;  2DRO A;  5AGD A;  3E32 B;  1VD5 A;  2XWB B;  3QDE A;  3C72 B;  1AGM A;  2XFG A;  2BB5 A;  3E30 B;  2B4F A;  2WY8 A;  1GAI A;  3DSU B;  2D5J A;  4DOD A;  1FT1 B;  3DST B;  4LNG B;  4XUV A;  3WUX A;  1S64 B;  3H2W A;  1G87 A;  4EL8 A;  3RX7 A;  1X81 B;  4YDE B;  1O6H A;  3RX8 A;  4LNB B;  5JPN B;  3EU5 B;  3DSX B;  4ONT A;  1KRF A;  1FT2 B;  3S9V A;  3H7L A;  4Q2B A;  2ZBL A;  5M7Y A;  1XWT A;  3EUV B;  5FO7 B;  1CLC A;  1N4S B;  3PZ4 B;  4GL3 A;  3WKI A;  3VXD A;  3PYB A;  2DRQ A;  2Z07 A;  4J5T A;  5KKB A;  4GTS B;  1GSZ A;  1H3B A;  1JCS B;  1SQC A;  4AYQ A;  2ZZR A;  4WVA A;  2NOJ A;  1TN6 B;  1H14 A;  1IA6 A;  1L2A A;  4KTR A;  3QT9 A;  3CU7 A;  3QPF A;  4GTR B;  3ON6 A;  2JF4 A;  3KSQ B;  3X17 A;  1O79 A;  2XQW A;  3QXF A;  1N9A B;  4CE7 A;  4KKI A;  3SDT A;  3Q75 B;  1JS4 A;  1S63 B;  2SQC A;  3ANI A;  3K11 A;  3HXC B;  1N4Q B;  1H13 A;  1F9D A;  5DGQ A;  4C1S A;  3H3K A;  4EHM B;  3HXF B;  1FBW A;  2F6D A;  1O1R B;  1L1Y A;  2BBC A;  4GTM B;  4Q88 A;  1XW2 A;  4YDO B;  1TNZ B;  4Z4J A;  3W5N A;  1O5M B;  1FAE A;  3Q79 B;  2R2L B;  1H37 A;  1F9O A;  2FV0 A;  3Q7F B;  4LNV A;  1GXN A;  1W6J A;  2D8L A;  1GLM A;  1HZF A;  1X9D A;  2V3N A;  1H3C A;  4FXG B;  1FBO A;  4KTP A;  1RQ5 A;  5JPM B;  2QNO A;  4D4B A;  3SQC A;  2EAC A;  1QBQ B;  1NL4 B;  3RJ3 A;  3SDU A;  3KQ4 A;  1QQF A;  1FP3 A;  2WY7 A;  3QFY A;  1N94 B;  2G02 A;  2B39 A;  3HXE B;  3PZ1 B;  1R76 A;  2A8Z A;  4YCR A;  3PZ2 B;  2RI8 A;  1JCR B;  1V7V A;  3E33 B;  3W7T A;  3P5R A;  4CJ1 A;  2ZIS B;  1V5D A;  3E6U A;  4CJ0 A;  3SAE A;  1MZC B;  1D8E B;  3WKF A;  1D8D B;  4TF4 A;  4FXK B;  3Q7A B;  1FMI A;  3REN A;  3M7B A;  4L6X A;  1H54 A;  1N4P B;  1UT9 A;  2AHF A;  1V5C A;  3P2C A;  4D94 A;  2I07 B;  3PMM A;  1ULV A;  4ZG8 A;  3SFX B;  1UG9 A;  2XWJ B;  3D5S A;  3M7C A;  5E2J A;  3EZ8 A;  3M7L A;  2P0V A;  4V1S A;  3S4D A;  1IA7 A;  4WVC A;  3DSS B;  4V1R A;  3WIR A;  1H39 A;  4D4A A;  2PN5 A;  1TNU B;  3S4C A;  3RSY A;  2GH4 A;  4FUS A;  3Q78 B;  3OED A;  3M73 A;  1KFG A;  3T33 A;  4ZH1 A;  4TXT A;  3S4B A;  2H6I B;  2BED B;  3E34 B;  1DCE B;  1FCE A;  2FUZ A;  4AYO A;  1UMP A;  4D4D A;  1WU5 A;  1KRE A;  3K7X A;  3WIW A;  2EAE A;  3WKG A;  3EQA A;  4ZRP A;  4AYR A;  3M76 A;  3SDQ A;  3M77 A;  3QG0 A;  2H6G B;  1O6Q A;  3KSL B;  2G0D A;  2AFA A;  4GTP B;  3OXU A;  2RGK A;  2F0Y B;  1JCQ B;  3ANK A;  1WZZ A;  3ANJ A;  3EU8 A;  2V8K A;  1G9G A;  1H35 A;  1NI1 B;  2VN7 A;  1FO3 A;  2V8J A;  2V8I A;  3WIQ A;  4BOJ A;  3QFZ A;  5CZL A;  2ZIR B;  1LF6 A;  1LD7 B;  1WU6 A;  1IS9 A;  2FBA A;  1LF9 A;  2A73 B;  5GY3 A;  5MEH A;  1TN8 B;  1LD8 B;  3GT5 A;  3M74 A;  1GXO A;  1H36 A;  3SDR A;  1CEM A;  1SA4 B;  3QT3 A;  1NXC A;  1KZO B;  3GLY A;  3PZ3 B;  2WII B;  4WVB A;  1H3A A;  3ACS A;  3SDV A;  2DRR A;  3ACT A;  4D4C A;  3DSW B;  4GTQ B;  5FOB B;  3E73 A;  1O1S B;  3PYA A;  4DOE A;  1KSD A;  2WYN A;  3E37 B;  1WU4 A;  1TN7 B;  2VN4 A;  4L0G A;  4QT9 A;  3HXB B;  2GOX A;  1GAH A;  3M75 A;  1W6K A;  1DL2 A;  1FPP B;  4JJJ A;  4AYP A;  3WC3 A;  2IEJ B;  5GW7 A;  1DOG A;  1QSJ A;  3W7W A;  2PMV A;  3G6J B;  3DPY B;  3QXQ A;  5DGR A;  4BOK A;  2CQS A;  3WKH A;  1FO2 A;  2EAD A;  4WU0 A;  1C3D A;  3W7S A;  5GZK A;  2H6H B;  1O6R A;  2EAB A;  1V7X A;  1K72 A;  3RRS A;  3QWT A;  1XWQ A;  2GZ6 A;  3A3V A;  1NC5 A;  2DRS A;  3Q73 B;  1G9J A;  5CA3 A;  4Z4L A;  3DSV B;  4GTT B;  2NVP A;  2V3P A;  3RX5 A;  4ZH5 A;  2CQT A;  3GZK A;  3M71 A;  1GHQ A;  1HCU A;  5FO8 B;  4GTO B;  2FV1 A;  5CD2 A;  3S4A A;  3M72 A;  3W5M A;  1H12 A;  3VW5 A;  5M7I A;  1KZP B;  3AFJ A;  1GXM A;  1TNO B;  1LTX B;  2H6F B;  1KS8 A;  3HXD B;  4M76 A;  1KKT A;  2JJB A;  4ZRQ A;  1KWF A;  3D5R A;  4L9P B;  2AHG A;  1TF4 A;  1KSC A;  1SA5 B;  2JG0 A;  3TF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...