1IA7A

Crystal structure of the cellulase cel9m of c. cellulolyticium in complex with cellobiose
Total Genus 177
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
177
sequence length
431
structure length
431
Chain Sequence
AGTHDYSTALKDSIIFFDANKCGPQAGENNVFDWRGACHTTDGSDVGVDLTGGYHDAGDHVKFGLPQGYSAAILGWSLYEFKESFDATGNTTKMLQQLKYFTDYFLKSHPNSTTFYYQVGEGNADHTYWGAPEEQTGQRPSLYKADPSSPASDILSETSAALTLMYLNYKNIDSAYATKCLNAAKELYAMGKANQGVGNGQSFYQATSFGDDLAWAATWLYTATNDSTYITDAEQFITLGNTMNENKMQDKWTMCWDDMYVPAALRLAQITGKQIYKDAIEFNFNYWKTQVTTTPGGLKWLSNWGVLRYAAAESMVMLVYCKQNPDQSLLDLAKKQVDYILGDNPANMSYIIGYGSNWCIHPHHRAANGYTYANGDNAKPAKHLLTGALVGGPDQNDKFLDDANQYQYTEVALDYNAGLVGVLAGAIKFFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CELLULASE CEL9M
publication title Crystal structure of the cellulase Cel9M enlightens structure/function relationships of the variable catalytic modules in glycoside hydrolases.
pubmed doi rcsb
source organism Clostridium cellulolyticum
total genus 177
structure length 431
sequence length 431
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2001-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00759 Glyco_hydro_9 Glycosyl hydrolase family 9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ia7A00
2EADA 4Z4JA 3VXDA 2OKXA 4CJ1A 1G6IA 5M7IA 2AHFA 1VD5A 5DGQA 2JF4A 1RQ5A 3W5NA 2VN7A 2GZ6A 2F6DA 3W7WA 1WU5A 1XW2A 1GAIA 2RI8A 1KSCA 1KREA 1H13A 2GH4A 1L2AA 3GZKA 1AGMA 4WVCA 5CA3A 4WVBA 1KSDA 3ACTA 2CQTA 1FP3A 3EZ8A 3W7UA 1LF9A 3S4DA 3ANKA 5E2JA 3ON6A 1XWTA 1KFGA 3S4AA 3WKGA 4Q88A 2B4FA 2ZBLA 5GW7A 3A3VA 2JG0A 1FCEA 2NVPA 1V7VA 2AFAA 1G9JA 4ZH5A 3QDEA 3ANIA 2AHGA 2XFGA 3QFYA 1UT9A 3W7TA 1WZZA 2YIKA 4KTRA 2DRSA 5GY3A 3E6UA 2RI9A 1IA7A 4TF4A 4AYRA 4CJ0A 3QFZA 2EABA 3WKIA 1GLMA 3S4BA 1DL2A 4XUVA 1F9DA 2P0VA 1WU4A 3H3KA 3QPFA 1FBWA 4CE7A 4AYPA 4L6XA 1H14A 3W5MA 3WUXA 1KKTA 2DRRA 4Q2BA 1UG9A 2D8LA 2FV1A 3K11A 5CD2A 2JJBA 1G9GA 1IS9A 1FBOA 3QT3A 4AYOA 5MEHA 5M7YA 2QNOA 3ANJA 3QG0A 4J5TA 2FBAA 3RX8A 5KKBA 1WU6A 3P2CA 2DRQA 1V7XA 1FMIA 3W7XA 1TF4A 3QT9A 4KTPA 4DODA 3WIRA 1KS8A 3AFJA 2WYNA 3WIQA 5CZLA 1DOGA 1FO2A 3E73A 1NC5A 1F9OA 4WVAA 3QXFA 3D3IA 3S4CA 2FV0A 3PMMA 3RRSA 3TF4A 1HCUA 2A8ZA 1ULVA 4EL8A 3RENA 1CEMA 1IA6A 1XWQA 3EQAA 3QWTA 1V7WA 1L1YA 1NXCA 2DROA 3RSYA 1V5DA 3WKFA 1JS4A 1CLCA 4DOEA 3T33A 2Z07A 3RX7A 3QRYA 2CQSA 2VN4A 1X9DA 2ZZRA 3ACSA 3QXQA 3VW5A 3GLYA 3X17A 4L0GA 4WU0A 1AYXA 3RX5A 1H12A 3CIHA 2EAEA 5DGRA 3WIWA 1LF6A 4FUSA 4ZG8A 1GA2A 3GT5A 3WKHA 2EACA 1GAHA 3H7LA 1KRFA 2FUZA 1K72A 3QSPA 4AYQA 1FAEA 3WC3A 2RGKA 1KWFA 1FO3A 1G87A 1H54A 1V5CA 2D5JA 4TXTA 3W7SA 4Z4LA 3H2WA 4JJJA
chains in the Genus database with same CATH superfamily
1S63B 1OJMA 1JCSB 5IKHA 4D94A 1N7OA 4Z4JA 4BOJA 1G6IA 3CU7A 4YCRA 1XW2A 1KSCA 1L2AA 4LNGB 5JMDA 3W7UA 1GHQA 3ON6A 1XWTA 4V1SA 2ZBLA 2JG0A 3Q79B 2NVPA 3E32B 2AFAA 1G9JA 3PZ3B 2XFGA 5IKAA 1HXGA 3E6UA 4TF4A 2V3PA 3E37B 2EABA 1GLMA 3S4BA 1DL2A 4XUVA 1F9DA 1RW9A 1GXMA 1WU4A 4QT9A 3DPYB 4D4BA 3M7LA 2DRRA 1SQCA 1UG9A 5ILZA 1N21A 1G9GA 3QT3A 5MEHA 2E24A 2V8IA 3ANJA 2PN5A 3RX8A 1F9GA 2FBAA 3DSTB 1J0MA 3AFLA 2WINB 1FMIA 3W7XA 3EU8A 4ZH1A 1DCEB 4FNVA 3M76A 3AFJA 1RWHA 1EGUA 1FO2A 1F9OA 4WVAA 3PZ1B 3QXFA 4F10A 1OJOA 3D3IA 3N0GA 4FJQA 3RRSA 2BRPA 1N4SB 1O1RB 3TF4A 5IK0A 1ULVA 5IL8A 1O79A 1H37A 1HM2A 3M71A 3EQAA 3VSNA 1L1YA 1RWFA 3RSYA 2ONGA 4MBGB 1JS4A 5IK9A 3SDRA 1TNUB 1HXCA 3EU5B 1R76A 4ONTA 1TNYB 3GLYA 3X17A 3PZ4B 3E33B 4EHMB 5ILYA 5FO7B 4GTRB 2EAEA 2G02A 2BRWA 1FT2B 2EACA 4MMHA 5FO8B 4D4AA 1N7QA 1HX9A 1N1BA 1O1TB 3QSPA 3WC3A 2D5JA 1FO3A 3W7SA 5ILHA 1N94B 4GTQB 1N23A 1N1ZA 3G6JB 1N95B 5IK6A 2EADA 4DI5A 3A0OA 5M7IA 1N4RB 1RQ5A 5ILIA 2GZ6A 3W7WA 5FOBB 1LD7B 1TNBB 1GAIA 2F0YB 3SFXB 2RI8A 1KREA 5ILKA 4KKIA 2J5CA 2ONHA 1KSDA 2CQTA 3DSWB 4LNVA 3SDVA 1RWGA 3S4DA 5E2JA 1KFGA 1LXMA 1W6KA 1S64B 1FCEA 4M76A 3RJ3A 2BEDB 2ZIRB 1RWCA 3QDEA 2AHGA 2WIIB 1C3DA 1UT9A 3OXUA 3W7TA 5EATA 5GY3A 1HM3A 5JPNB 3PYBA 4AYRA 2P0VA 1TN6B 4CE7A 4YDOB 4E1YA 1TN8B 3KLSA 3WUXA 1KKTA 5CD2A 1FT1B 1FBOA 3VSMA 5EAUA 5M7YA 2QNOA 3QG0A 1N22A 4J5TA 3P2CA 1V7XA 3E7JA 4FXGB 1TF4A 2H6FB 3KQ4A 3QT9A 1OJNA 3M7CA 4DODA 2Q1FA 3KSQB 3WIQA 1KZPB 5CZLA 3E73A 3DSXB 3NFVA 1HCUA 3M7BA 1HMUA 1LXKA 1XWQA 1HN0A 3N0FA 3QWTA 3C72B 1V7WA 5FO9B 3WKFA 4RNQA 3T33A 5JMFA 3DSSB 3QRYA 2CQSA 3KSLB 2VN4A 3ACSA 3Q78B 4L0GA 1AYXA 2X03A 1GSZA 3M02A 4D4DA 4OK2A 4GTOB 1SA4B 1N9AB 5DGRA 3WIWA 3M75A 3GT5A 2E22A 3P5RA 2IEJB 1KRFA 2FUZA 1FAEA 2RGKA 1H3BA 1G87A 1H54A 1KWFA 4TXTA 3S9VA 3H2WA 3M72A 3M00A 1H36A 3SFYB 4GTMB 1HMWA 4MMIA 3E80A 2FUQA 3VXDA 4D4CA 2AHFA 1VD5A 5ILJA 3E30B 3HXFB 2GOXA 3W5NA 2VN7A 1LTXB 3Q7FB 1N7PA 2BB6A 1O5MB 2GH4A 2R2LB 3GZKA 5ILDA 4WVCA 5C05A 5CA3A 1X1HA 3ACTA 1J0NA 1LOHA 3ANKA 1O6HA 3K7XA 4Q88A 4OZVA 1TNOB 3Q73B 4GAXA 2H6GB 2G0DA 1UMPA 1V7VA 2FUTA 3ANIA 2H6HB 3QFYA 2ZISB 2RI9A 3P5PA 2H6IB 3WKIA 3QPFA 3G4FA 3SDUA 1H14A 1LD8B 4LIXA 2D8LA 2FV1A 3G4DA 1IS9A 2B39A 4AYOA 2BB5A 3DSUB 5KKBA 1H3AA 1WU6A 2DRQA 3SDQA 1QBQB 3PZ2B 2WCOA 3D5SA 3NNBA 1GXOA 1X1IA 3WIRA 1KS8A 1I8QA 1OJPA 2WYNA 4GTVB 2I07B 1DOGA 4ZRPA 1NC5A 4F13A 1N7NA 2FV0A 3PMMA 1GXNA 5IL3A 4EL8A 1MZCB 5EASA 1CEMA 1IA6A 3D5RA 3HXBB 3HXEB 2DROA 1V5DA 1O6QA 4BOKA 4DOEA 3RX7A 1H39A 1X9DA 2WY8A 3QXQA 3LZ9A 1NI1B 1LF6A 4FUSA 1H35A 1N7RA 1N24A 1NL4B 2V8JA 1FPPB 3HXCB 3SQCA 4MU9A 1D8EB 4AYQA 4V1RA 1V5CA 1W6JA 2WY7A 2BRVX 4Z4LA 4JJJA 4CJ0A 5IM1A 1O1SB 1CB8A 2PMVA 1O6RA 4L9PB 1RWAA 2OKXA 4CJ1A 5DGQA 2JF4A 4OJZA 2F6DA 1WU5A 1SA5B 1QAZA 4OZWA 5GZKA 1H13A 1C82A 1AGMA 4YDEB 1W3YA 4WVBA 5DHKA 1FP3A 3EZ8A 1LF9A 3S4AA 2SQCA 2V3NA 3WKGA 2B4FA 5GW7A 3A3VA 4ZH5A 3SAEA 1WZZA 2YIKA 4KTRA 2DRSA 1IA7A 3QFZA 4GL3A 3E34B 3DRAB 3H3KA 4FXKB 1X81B 1FBWA 4AYPA 3Q7AB 4L6XA 3W5MA 4Q2BA 3K11A 1HZFA 2JJBA 1HV6A 3SDTA 1TNZB 2XWJB 3M78A 3M01A 1JCRB 4ZRQA 3M77A 5JPMB 2V8KA 1HXAA 3DSVB 1N4PB 4KTPA 4OK4A 4GTSB 1QQFA 1N4QB 4KKJA 3S4CA 1X1JA 3Q75B 4C1SA 2A8ZA 3M7EA 3EUVB 2WDAA 1N20A 3RENA 1D8DB 4LNBB 2XWBB 4GTPB 1NXCA 1CLCA 2Z07A 1H3CA 2ZZRA 2XQWA 3VW5A 3OEDA 1JCQB 4WU0A 3M74A 2NOJA 1TN7B 3PYAA 5DHIA 3RX5A 1H12A 4NEIA 1F1SA 3CIHA 2A73B 4ZG8A 1GA2A 5AGDA 1KZOB 3HXDB 3WKHA 2BBCA 1GAHA 3M73A 1QSJA 3H7LA 1K72A 4GTTB
chains in the Genus database with same CATH topology
1S63B 4D94A 1JCSB 4Z4JA 4BOJA 1G6IA 3CU7A 4YCRA 1XW2A 1KSCA 1L2AA 4LNGB 3W7UA 1GHQA 3ON6A 1XWTA 4V1SA 2ZBLA 2JG0A 3Q79B 2NVPA 3E32B 2AFAA 1G9JA 3PZ3B 2XFGA 3E6UA 4TF4A 2V3PA 3E37B 2EABA 1GLMA 3S4BA 1DL2A 4XUVA 1F9DA 1GXMA 1WU4A 4QT9A 3DPYB 4D4BA 3M7LA 2DRRA 1SQCA 1UG9A 1G9GA 3QT3A 5MEHA 2V8IA 3ANJA 2PN5A 3RX8A 2FBAA 3DSTB 2WINB 1FMIA 3W7XA 3EU8A 4ZH1A 1DCEB 3M76A 3AFJA 1FO2A 1F9OA 4WVAA 3PZ1B 3QXFA 3D3IA 3RRSA 1N4SB 1O1RB 3TF4A 1ULVA 1O79A 1H37A 3M71A 3EQAA 1L1YA 3RSYA 4MBGB 1JS4A 3SDRA 1TNUB 3EU5B 1R76A 4ONTA 1TNYB 3GLYA 3X17A 3PZ4B 3E33B 4EHMB 5FO7B 4GTRB 2EAEA 2G02A 1FT2B 2EACA 5FO8B 4D4AA 1O1TB 3QSPA 3WC3A 2D5JA 1FO3A 3W7SA 1N94B 4GTQB 3G6JB 1N95B 2EADA 5M7IA 1N4RB 1RQ5A 2GZ6A 3W7WA 5FOBB 1LD7B 1TNBB 1GAIA 2F0YB 3SFXB 2RI8A 1KREA 4KKIA 1KSDA 2CQTA 3DSWB 4LNVA 3SDVA 3S4DA 5E2JA 1KFGA 1W6KA 1S64B 1FCEA 4M76A 3RJ3A 2BEDB 2ZIRB 3QDEA 2AHGA 2WIIB 1C3DA 1UT9A 3OXUA 3W7TA 5GY3A 5JPNB 3PYBA 4AYRA 2P0VA 1TN6B 4CE7A 4YDOB 1TN8B 3KLSA 3WUXA 1KKTA 5CD2A 1FT1B 1FBOA 5M7YA 2QNOA 3QG0A 4J5TA 3P2CA 1V7XA 4FXGB 1TF4A 2H6FB 3KQ4A 3QT9A 3M7CA 4DODA 3KSQB 3WIQA 1KZPB 5CZLA 3E73A 3DSXB 1HCUA 3M7BA 1XWQA 3QWTA 3C72B 1V7WA 5FO9B 3WKFA 3T33A 3DSSB 3QRYA 2CQSA 3KSLB 2VN4A 3ACSA 3Q78B 4L0GA 1AYXA 1GSZA 4D4DA 4GTOB 1SA4B 1N9AB 5DGRA 3WIWA 3M75A 3GT5A 3P5RA 2IEJB 1KRFA 2FUZA 1FAEA 2RGKA 1H3BA 1G87A 1H54A 1KWFA 4TXTA 3S9VA 3H2WA 3M72A 1H36A 3SFYB 4GTMB 3VXDA 4D4CA 2AHFA 1VD5A 3E30B 3HXFB 2GOXA 3W5NA 2VN7A 1LTXB 3Q7FB 2BB6A 1O5MB 2GH4A 2R2LB 3GZKA 4WVCA 5CA3A 3ACTA 3ANKA 1O6HA 3K7XA 4Q88A 1TNOB 3Q73B 2H6GB 2G0DA 1UMPA 1V7VA 3ANIA 2H6HB 3QFYA 2ZISB 2RI9A 3P5PA 2H6IB 3WKIA 3QPFA 3SDUA 1H14A 1LD8B 4LIXA 2D8LA 2FV1A 1IS9A 2B39A 4AYOA 2BB5A 3DSUB 5KKBA 1H3AA 1WU6A 2DRQA 3SDQA 1QBQB 3PZ2B 3D5SA 1GXOA 3WIRA 1KS8A 2WYNA 4GTVB 2I07B 1DOGA 4ZRPA 1NC5A 2FV0A 3PMMA 1GXNA 4EL8A 1MZCB 1CEMA 1IA6A 3D5RA 3HXBB 3HXEB 2DROA 1V5DA 1O6QA 4BOKA 4DOEA 3RX7A 1H39A 1X9DA 2WY8A 3QXQA 1NI1B 1LF6A 4FUSA 1H35A 1NL4B 2V8JA 1FPPB 3HXCB 3SQCA 4MU9A 1D8EB 4AYQA 4V1RA 1V5CA 1W6JA 2WY7A 4Z4LA 4JJJA 4CJ0A 1O1SB 2PMVA 4L9PB 1O6RA 2OKXA 4CJ1A 5DGQA 2JF4A 2F6DA 1WU5A 1SA5B 5GZKA 1H13A 1AGMA 4YDEB 4WVBA 1FP3A 3EZ8A 1LF9A 3S4AA 2SQCA 2V3NA 3WKGA 2B4FA 5GW7A 3A3VA 4ZH5A 3SAEA 1WZZA 2YIKA 4KTRA 2DRSA 1IA7A 3QFZA 4GL3A 3E34B 3DRAB 3H3KA 4FXKB 1X81B 1FBWA 4AYPA 3Q7AB 4L6XA 3W5MA 4Q2BA 3K11A 1HZFA 2JJBA 3SDTA 1TNZB 2XWJB 3M78A 1JCRB 4ZRQA 3M77A 5JPMB 2V8KA 3DSVB 1N4PB 4KTPA 4GTSB 1QQFA 1N4QB 4KKJA 3S4CA 3Q75B 4C1SA 2A8ZA 3M7EA 3EUVB 3RENA 1D8DB 4LNBB 2XWBB 4GTPB 1NXCA 1CLCA 2Z07A 1H3CA 2ZZRA 2XQWA 3VW5A 3OEDA 1JCQB 4WU0A 3M74A 2NOJA 1TN7B 3PYAA 3RX5A 1H12A 3CIHA 2A73B 4ZG8A 1GA2A 5AGDA 1KZOB 3HXDB 3WKHA 2BBCA 1GAHA 3M73A 1QSJA 3H7LA 1K72A 4GTTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAD A;  4Z4J A;  3VXD A;  2OKX A;  4CJ1 A;  1G6I A;  5M7I A;  2AHF A;  1VD5 A;  5DGQ A;  2JF4 A;  1RQ5 A;  3W5N A;  2VN7 A;  2GZ6 A;  2F6D A;  3W7W A;  1WU5 A;  1XW2 A;  1GAI A;  2RI8 A;  1KSC A;  1KRE A;  1H13 A;  2GH4 A;  1L2A A;  3GZK A;  1AGM A;  4WVC A;  5CA3 A;  4WVB A;  1KSD A;  3ACT A;  2CQT A;  1FP3 A;  3EZ8 A;  3W7U A;  1LF9 A;  3S4D A;  3ANK A;  5E2J A;  3ON6 A;  1XWT A;  1KFG A;  3S4A A;  3WKG A;  4Q88 A;  2B4F A;  2ZBL A;  5GW7 A;  3A3V A;  2JG0 A;  1FCE A;  2NVP A;  1V7V A;  2AFA A;  1G9J A;  4ZH5 A;  3QDE A;  3ANI A;  2AHG A;  2XFG A;  3QFY A;  1UT9 A;  3W7T A;  1WZZ A;  2YIK A;  4KTR A;  2DRS A;  5GY3 A;  3E6U A;  2RI9 A;  1IA7 A;  4TF4 A;  4AYR A;  4CJ0 A;  3QFZ A;  2EAB A;  3WKI A;  1GLM A;  3S4B A;  1DL2 A;  4XUV A;  1F9D A;  2P0V A;  1WU4 A;  3H3K A;  3QPF A;  1FBW A;  4CE7 A;  4AYP A;  4L6X A;  1H14 A;  3W5M A;  3WUX A;  1KKT A;  2DRR A;  4Q2B A;  1UG9 A;  2D8L A;  2FV1 A;  3K11 A;  5CD2 A;  2JJB A;  1G9G A;  1IS9 A;  1FBO A;  3QT3 A;  4AYO A;  5MEH A;  5M7Y A;  2QNO A;  3ANJ A;  3QG0 A;  4J5T A;  2FBA A;  3RX8 A;  5KKB A;  1WU6 A;  3P2C A;  2DRQ A;  1V7X A;  1FMI A;  3W7X A;  1TF4 A;  3QT9 A;  4KTP A;  4DOD A;  3WIR A;  1KS8 A;  3AFJ A;  2WYN A;  3WIQ A;  5CZL A;  1DOG A;  1FO2 A;  3E73 A;  1NC5 A;  1F9O A;  4WVA A;  3QXF A;  3D3I A;  3S4C A;  2FV0 A;  3PMM A;  3RRS A;  3TF4 A;  1HCU A;  2A8Z A;  1ULV A;  4EL8 A;  3REN A;  1CEM A;  1IA6 A;  1XWQ A;  3EQA A;  3QWT A;  1V7W A;  1L1Y A;  1NXC A;  2DRO A;  3RSY A;  1V5D A;  3WKF A;  1JS4 A;  1CLC A;  4DOE A;  3T33 A;  2Z07 A;  3RX7 A;  3QRY A;  2CQS A;  2VN4 A;  1X9D A;  2ZZR A;  3ACS A;  3QXQ A;  3VW5 A;  3GLY A;  3X17 A;  4L0G A;  4WU0 A;  1AYX A;  3RX5 A;  1H12 A;  3CIH A;  2EAE A;  5DGR A;  3WIW A;  1LF6 A;  4FUS A;  4ZG8 A;  1GA2 A;  3GT5 A;  3WKH A;  2EAC A;  1GAH A;  3H7L A;  1KRF A;  2FUZ A;  1K72 A;  3QSP A;  4AYQ A;  1FAE A;  3WC3 A;  2RGK A;  1KWF A;  1FO3 A;  1G87 A;  1H54 A;  1V5C A;  2D5J A;  4TXT A;  3W7S A;  4Z4L A;  3H2W A;  4JJJ A; 
#chains in the Genus database with same CATH topology
 1S63 B;  1OJM A;  1JCS B;  5IKH A;  4D94 A;  1N7O A;  4Z4J A;  4BOJ A;  1G6I A;  3CU7 A;  4YCR A;  1XW2 A;  1KSC A;  1L2A A;  4LNG B;  5JMD A;  3W7U A;  1GHQ A;  3ON6 A;  1XWT A;  4V1S A;  2ZBL A;  2JG0 A;  3Q79 B;  2NVP A;  3E32 B;  2AFA A;  1G9J A;  3PZ3 B;  2XFG A;  5IKA A;  1HXG A;  3E6U A;  4TF4 A;  2V3P A;  3E37 B;  2EAB A;  1GLM A;  3S4B A;  1DL2 A;  4XUV A;  1F9D A;  1RW9 A;  1GXM A;  1WU4 A;  4QT9 A;  3DPY B;  4D4B A;  3M7L A;  2DRR A;  1SQC A;  1UG9 A;  5ILZ A;  1N21 A;  1G9G A;  3QT3 A;  5MEH A;  2E24 A;  2V8I A;  3ANJ A;  2PN5 A;  3RX8 A;  1F9G A;  2FBA A;  3DST B;  1J0M A;  3AFL A;  2WIN B;  1FMI A;  3W7X A;  3EU8 A;  4ZH1 A;  1DCE B;  4FNV A;  3M76 A;  3AFJ A;  1RWH A;  1EGU A;  1FO2 A;  1F9O A;  4WVA A;  3PZ1 B;  3QXF A;  4F10 A;  1OJO A;  3D3I A;  3N0G A;  4FJQ A;  3RRS A;  2BRP A;  1N4S B;  1O1R B;  3TF4 A;  5IK0 A;  1ULV A;  5IL8 A;  1O79 A;  1H37 A;  1HM2 A;  3M71 A;  3EQA A;  3VSN A;  1L1Y A;  1RWF A;  3RSY A;  2ONG A;  4MBG B;  1JS4 A;  5IK9 A;  3SDR A;  1TNU B;  1HXC A;  3EU5 B;  1R76 A;  4ONT A;  1TNY B;  3GLY A;  3X17 A;  3PZ4 B;  3E33 B;  4EHM B;  5ILY A;  5FO7 B;  4GTR B;  2EAE A;  2G02 A;  2BRW A;  1FT2 B;  2EAC A;  4MMH A;  5FO8 B;  4D4A A;  1N7Q A;  1HX9 A;  1N1B A;  1O1T B;  3QSP A;  3WC3 A;  2D5J A;  1FO3 A;  3W7S A;  5ILH A;  1N94 B;  4GTQ B;  1N23 A;  1N1Z A;  3G6J B;  1N95 B;  5IK6 A;  2EAD A;  4DI5 A;  3A0O A;  5M7I A;  1N4R B;  1RQ5 A;  5ILI A;  2GZ6 A;  3W7W A;  5FOB B;  1LD7 B;  1TNB B;  1GAI A;  2F0Y B;  3SFX B;  2RI8 A;  1KRE A;  5ILK A;  4KKI A;  2J5C A;  2ONH A;  1KSD A;  2CQT A;  3DSW B;  4LNV A;  3SDV A;  1RWG A;  3S4D A;  5E2J A;  1KFG A;  1LXM A;  1W6K A;  1S64 B;  1FCE A;  4M76 A;  3RJ3 A;  2BED B;  2ZIR B;  1RWC A;  3QDE A;  2AHG A;  2WII B;  1C3D A;  1UT9 A;  3OXU A;  3W7T A;  5EAT A;  5GY3 A;  1HM3 A;  5JPN B;  3PYB A;  4AYR A;  2P0V A;  1TN6 B;  4CE7 A;  4YDO B;  4E1Y A;  1TN8 B;  3KLS A;  3WUX A;  1KKT A;  5CD2 A;  1FT1 B;  1FBO A;  3VSM A;  5EAU A;  5M7Y A;  2QNO A;  3QG0 A;  1N22 A;  4J5T A;  3P2C A;  1V7X A;  3E7J A;  4FXG B;  1TF4 A;  2H6F B;  3KQ4 A;  3QT9 A;  1OJN A;  3M7C A;  4DOD A;  2Q1F A;  3KSQ B;  3WIQ A;  1KZP B;  5CZL A;  3E73 A;  3DSX B;  3NFV A;  1HCU A;  3M7B A;  1HMU A;  1LXK A;  1XWQ A;  1HN0 A;  3N0F A;  3QWT A;  3C72 B;  1V7W A;  5FO9 B;  3WKF A;  4RNQ A;  3T33 A;  5JMF A;  3DSS B;  3QRY A;  2CQS A;  3KSL B;  2VN4 A;  3ACS A;  3Q78 B;  4L0G A;  1AYX A;  2X03 A;  1GSZ A;  3M02 A;  4D4D A;  4OK2 A;  4GTO B;  1SA4 B;  1N9A B;  5DGR A;  3WIW A;  3M75 A;  3GT5 A;  2E22 A;  3P5R A;  2IEJ B;  1KRF A;  2FUZ A;  1FAE A;  2RGK A;  1H3B A;  1G87 A;  1H54 A;  1KWF A;  4TXT A;  3S9V A;  3H2W A;  3M72 A;  3M00 A;  1H36 A;  3SFY B;  4GTM B;  1HMW A;  4MMI A;  3E80 A;  2FUQ A;  3VXD A;  4D4C A;  2AHF A;  1VD5 A;  5ILJ A;  3E30 B;  3HXF B;  2GOX A;  3W5N A;  2VN7 A;  1LTX B;  3Q7F B;  1N7P A;  2BB6 A;  1O5M B;  2GH4 A;  2R2L B;  3GZK A;  5ILD A;  4WVC A;  5C05 A;  5CA3 A;  1X1H A;  3ACT A;  1J0N A;  1LOH A;  3ANK A;  1O6H A;  3K7X A;  4Q88 A;  4OZV A;  1TNO B;  3Q73 B;  4GAX A;  2H6G B;  2G0D A;  1UMP A;  1V7V A;  2FUT A;  3ANI A;  2H6H B;  3QFY A;  2ZIS B;  2RI9 A;  3P5P A;  2H6I B;  3WKI A;  3QPF A;  3G4F A;  3SDU A;  1H14 A;  1LD8 B;  4LIX A;  2D8L A;  2FV1 A;  3G4D A;  1IS9 A;  2B39 A;  4AYO A;  2BB5 A;  3DSU B;  5KKB A;  1H3A A;  1WU6 A;  2DRQ A;  3SDQ A;  1QBQ B;  3PZ2 B;  2WCO A;  3D5S A;  3NNB A;  1GXO A;  1X1I A;  3WIR A;  1KS8 A;  1I8Q A;  1OJP A;  2WYN A;  4GTV B;  2I07 B;  1DOG A;  4ZRP A;  1NC5 A;  4F13 A;  1N7N A;  2FV0 A;  3PMM A;  1GXN A;  5IL3 A;  4EL8 A;  1MZC B;  5EAS A;  1CEM A;  1IA6 A;  3D5R A;  3HXB B;  3HXE B;  2DRO A;  1V5D A;  1O6Q A;  4BOK A;  4DOE A;  3RX7 A;  1H39 A;  1X9D A;  2WY8 A;  3QXQ A;  3LZ9 A;  1NI1 B;  1LF6 A;  4FUS A;  1H35 A;  1N7R A;  1N24 A;  1NL4 B;  2V8J A;  1FPP B;  3HXC B;  3SQC A;  4MU9 A;  1D8E B;  4AYQ A;  4V1R A;  1V5C A;  1W6J A;  2WY7 A;  2BRV X;  4Z4L A;  4JJJ A;  4CJ0 A;  5IM1 A;  1O1S B;  1CB8 A;  2PMV A;  1O6R A;  4L9P B;  1RWA A;  2OKX A;  4CJ1 A;  5DGQ A;  2JF4 A;  4OJZ A;  2F6D A;  1WU5 A;  1SA5 B;  1QAZ A;  4OZW A;  5GZK A;  1H13 A;  1C82 A;  1AGM A;  4YDE B;  1W3Y A;  4WVB A;  5DHK A;  1FP3 A;  3EZ8 A;  1LF9 A;  3S4A A;  2SQC A;  2V3N A;  3WKG A;  2B4F A;  5GW7 A;  3A3V A;  4ZH5 A;  3SAE A;  1WZZ A;  2YIK A;  4KTR A;  2DRS A;  1IA7 A;  3QFZ A;  4GL3 A;  3E34 B;  3DRA B;  3H3K A;  4FXK B;  1X81 B;  1FBW A;  4AYP A;  3Q7A B;  4L6X A;  3W5M A;  4Q2B A;  3K11 A;  1HZF A;  2JJB A;  1HV6 A;  3SDT A;  1TNZ B;  2XWJ B;  3M78 A;  3M01 A;  1JCR B;  4ZRQ A;  3M77 A;  5JPM B;  2V8K A;  1HXA A;  3DSV B;  1N4P B;  4KTP A;  4OK4 A;  4GTS B;  1QQF A;  1N4Q B;  4KKJ A;  3S4C A;  1X1J A;  3Q75 B;  4C1S A;  2A8Z A;  3M7E A;  3EUV B;  2WDA A;  1N20 A;  3REN A;  1D8D B;  4LNB B;  2XWB B;  4GTP B;  1NXC A;  1CLC A;  2Z07 A;  1H3C A;  2ZZR A;  2XQW A;  3VW5 A;  3OED A;  1JCQ B;  4WU0 A;  3M74 A;  2NOJ A;  1TN7 B;  3PYA A;  5DHI A;  3RX5 A;  1H12 A;  4NEI A;  1F1S A;  3CIH A;  2A73 B;  4ZG8 A;  1GA2 A;  5AGD A;  1KZO B;  3HXD B;  3WKH A;  2BBC A;  1GAH A;  3M73 A;  1QSJ A;  3H7L A;  1K72 A;  4GTT B; 
#chains in the Genus database with same CATH homology
 1S63 B;  4D94 A;  1JCS B;  4Z4J A;  4BOJ A;  1G6I A;  3CU7 A;  4YCR A;  1XW2 A;  1KSC A;  1L2A A;  4LNG B;  3W7U A;  1GHQ A;  3ON6 A;  1XWT A;  4V1S A;  2ZBL A;  2JG0 A;  3Q79 B;  2NVP A;  3E32 B;  2AFA A;  1G9J A;  3PZ3 B;  2XFG A;  3E6U A;  4TF4 A;  2V3P A;  3E37 B;  2EAB A;  1GLM A;  3S4B A;  1DL2 A;  4XUV A;  1F9D A;  1GXM A;  1WU4 A;  4QT9 A;  3DPY B;  4D4B A;  3M7L A;  2DRR A;  1SQC A;  1UG9 A;  1G9G A;  3QT3 A;  5MEH A;  2V8I A;  3ANJ A;  2PN5 A;  3RX8 A;  2FBA A;  3DST B;  2WIN B;  1FMI A;  3W7X A;  3EU8 A;  4ZH1 A;  1DCE B;  3M76 A;  3AFJ A;  1FO2 A;  1F9O A;  4WVA A;  3PZ1 B;  3QXF A;  3D3I A;  3RRS A;  1N4S B;  1O1R B;  3TF4 A;  1ULV A;  1O79 A;  1H37 A;  3M71 A;  3EQA A;  1L1Y A;  3RSY A;  4MBG B;  1JS4 A;  3SDR A;  1TNU B;  3EU5 B;  1R76 A;  4ONT A;  1TNY B;  3GLY A;  3X17 A;  3PZ4 B;  3E33 B;  4EHM B;  5FO7 B;  4GTR B;  2EAE A;  2G02 A;  1FT2 B;  2EAC A;  5FO8 B;  4D4A A;  1O1T B;  3QSP A;  3WC3 A;  2D5J A;  1FO3 A;  3W7S A;  1N94 B;  4GTQ B;  3G6J B;  1N95 B;  2EAD A;  5M7I A;  1N4R B;  1RQ5 A;  2GZ6 A;  3W7W A;  5FOB B;  1LD7 B;  1TNB B;  1GAI A;  2F0Y B;  3SFX B;  2RI8 A;  1KRE A;  4KKI A;  1KSD A;  2CQT A;  3DSW B;  4LNV A;  3SDV A;  3S4D A;  5E2J A;  1KFG A;  1W6K A;  1S64 B;  1FCE A;  4M76 A;  3RJ3 A;  2BED B;  2ZIR B;  3QDE A;  2AHG A;  2WII B;  1C3D A;  1UT9 A;  3OXU A;  3W7T A;  5GY3 A;  5JPN B;  3PYB A;  4AYR A;  2P0V A;  1TN6 B;  4CE7 A;  4YDO B;  1TN8 B;  3KLS A;  3WUX A;  1KKT A;  5CD2 A;  1FT1 B;  1FBO A;  5M7Y A;  2QNO A;  3QG0 A;  4J5T A;  3P2C A;  1V7X A;  4FXG B;  1TF4 A;  2H6F B;  3KQ4 A;  3QT9 A;  3M7C A;  4DOD A;  3KSQ B;  3WIQ A;  1KZP B;  5CZL A;  3E73 A;  3DSX B;  1HCU A;  3M7B A;  1XWQ A;  3QWT A;  3C72 B;  1V7W A;  5FO9 B;  3WKF A;  3T33 A;  3DSS B;  3QRY A;  2CQS A;  3KSL B;  2VN4 A;  3ACS A;  3Q78 B;  4L0G A;  1AYX A;  1GSZ A;  4D4D A;  4GTO B;  1SA4 B;  1N9A B;  5DGR A;  3WIW A;  3M75 A;  3GT5 A;  3P5R A;  2IEJ B;  1KRF A;  2FUZ A;  1FAE A;  2RGK A;  1H3B A;  1G87 A;  1H54 A;  1KWF A;  4TXT A;  3S9V A;  3H2W A;  3M72 A;  1H36 A;  3SFY B;  4GTM B;  3VXD A;  4D4C A;  2AHF A;  1VD5 A;  3E30 B;  3HXF B;  2GOX A;  3W5N A;  2VN7 A;  1LTX B;  3Q7F B;  2BB6 A;  1O5M B;  2GH4 A;  2R2L B;  3GZK A;  4WVC A;  5CA3 A;  3ACT A;  3ANK A;  1O6H A;  3K7X A;  4Q88 A;  1TNO B;  3Q73 B;  2H6G B;  2G0D A;  1UMP A;  1V7V A;  3ANI A;  2H6H B;  3QFY A;  2ZIS B;  2RI9 A;  3P5P A;  2H6I B;  3WKI A;  3QPF A;  3SDU A;  1H14 A;  1LD8 B;  4LIX A;  2D8L A;  2FV1 A;  1IS9 A;  2B39 A;  4AYO A;  2BB5 A;  3DSU B;  5KKB A;  1H3A A;  1WU6 A;  2DRQ A;  3SDQ A;  1QBQ B;  3PZ2 B;  3D5S A;  1GXO A;  3WIR A;  1KS8 A;  2WYN A;  4GTV B;  2I07 B;  1DOG A;  4ZRP A;  1NC5 A;  2FV0 A;  3PMM A;  1GXN A;  4EL8 A;  1MZC B;  1CEM A;  1IA6 A;  3D5R A;  3HXB B;  3HXE B;  2DRO A;  1V5D A;  1O6Q A;  4BOK A;  4DOE A;  3RX7 A;  1H39 A;  1X9D A;  2WY8 A;  3QXQ A;  1NI1 B;  1LF6 A;  4FUS A;  1H35 A;  1NL4 B;  2V8J A;  1FPP B;  3HXC B;  3SQC A;  4MU9 A;  1D8E B;  4AYQ A;  4V1R A;  1V5C A;  1W6J A;  2WY7 A;  4Z4L A;  4JJJ A;  4CJ0 A;  1O1S B;  2PMV A;  4L9P B;  1O6R A;  2OKX A;  4CJ1 A;  5DGQ A;  2JF4 A;  2F6D A;  1WU5 A;  1SA5 B;  5GZK A;  1H13 A;  1AGM A;  4YDE B;  4WVB A;  1FP3 A;  3EZ8 A;  1LF9 A;  3S4A A;  2SQC A;  2V3N A;  3WKG A;  2B4F A;  5GW7 A;  3A3V A;  4ZH5 A;  3SAE A;  1WZZ A;  2YIK A;  4KTR A;  2DRS A;  1IA7 A;  3QFZ A;  4GL3 A;  3E34 B;  3DRA B;  3H3K A;  4FXK B;  1X81 B;  1FBW A;  4AYP A;  3Q7A B;  4L6X A;  3W5M A;  4Q2B A;  3K11 A;  1HZF A;  2JJB A;  3SDT A;  1TNZ B;  2XWJ B;  3M78 A;  1JCR B;  4ZRQ A;  3M77 A;  5JPM B;  2V8K A;  3DSV B;  1N4P B;  4KTP A;  4GTS B;  1QQF A;  1N4Q B;  4KKJ A;  3S4C A;  3Q75 B;  4C1S A;  2A8Z A;  3M7E A;  3EUV B;  3REN A;  1D8D B;  4LNB B;  2XWB B;  4GTP B;  1NXC A;  1CLC A;  2Z07 A;  1H3C A;  2ZZR A;  2XQW A;  3VW5 A;  3OED A;  1JCQ B;  4WU0 A;  3M74 A;  2NOJ A;  1TN7 B;  3PYA A;  3RX5 A;  1H12 A;  3CIH A;  2A73 B;  4ZG8 A;  1GA2 A;  5AGD A;  1KZO B;  3HXD B;  3WKH A;  2BBC A;  1GAH A;  3M73 A;  1QSJ A;  3H7L A;  1K72 A;  4GTT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...