3QT3A

Analysis of a new family of widely distributed metal-independent alpha-mannosidases provides unique insight into the processing of n-linked glycans, clostridium perfringens cpe0426 apo-structure
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
425
structure length
425
Chain Sequence
SLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNYDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative uncharacterized protein CPE0426
publication title Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 157
structure length 425
sequence length 425
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3qt3A01
3RX8A 3W5MA 3E6UA 1XWTA 5E2JA 1HCUA 1DOGA 1FO3A 1H54A 2FV1A 3QPFA 3H2WA 3PMMA 2RI9A 3W7UA 1IA7A 2B4FA 3RENA 4DOEA 2EAEA 3P2CA 3QT3A 2XFGA 1GAIA 1NXCA 2YIKA 1V7VA 3W7WA 5M7IA 1UG9A 1KSDA 4DODA 2AHGA 1FMIA 4WVBA 4ZG8A 1AGMA 4KTRA 3TF4A 1NC5A 3RX7A 1WU5A 3WIQA 2DRSA 5GY3A 3ON6A 3RRSA 2RI8A 4XUVA 2ZBLA 2FBAA 1L1YA 3S4BA 1KKTA 4Q2BA 5DGRA 4EL8A 2EACA 1V7WA 3EQAA 4Q88A 2WYNA 3ACTA 4L6XA 1IA6A 3X17A 1LF6A 1JS4A 1GA2A 3EZ8A 1WU6A 2JJBA 1CEMA 1GLMA 1WU4A 5GW7A 1TF4A 3WKIA 1KS8A 1FBOA 1FP3A 3E73A 4TF4A 1FO2A 4Z4JA 1FAEA 1KWFA 1RQ5A 3QFYA 2AFAA 3S4DA 5KKBA 3GLYA 1G9GA 3WKGA 3K11A 2D5JA 2FUZA 3QRYA 1DL2A 4AYQA 2GZ6A 1X9DA 3WC3A 3QSPA 3S4CA 2CQSA 2Z07A 2RGKA 3H7LA 3QDEA 1V5DA 2VN7A 4WVCA 4CJ1A 3A3VA 1CLCA 3VW5A 3QFZA 2F6DA 1LF9A 3ANKA 2FV0A 3S4AA 2CQTA 2NVPA 2DROA 5CZLA 1AYXA 3W7TA 3GZKA 3W7SA 3W5NA 3ACSA 4FUSA 2DRRA 1KREA 4J5TA 5CA3A 1FCEA 1GAHA 3QXQA 2EABA 3W7XA 1F9OA 1H14A 1KRFA 1G87A 2VN4A 1FBWA 1KSCA 1XWQA 4TXTA 1XW2A 1KFGA 3RSYA 4CE7A 2A8ZA 1K72A 4L0GA 3WIRA 1G9JA 4CJ0A 4ZH5A 2JF4A 4WU0A 3D3IA 4KTPA 1H12A 3H3KA 1F9DA 3QT9A 1UT9A 3WKHA 4Z4LA 3WKFA 1V5CA 2ZZRA 1L2AA 2OKXA 1VD5A 2D8LA 2GH4A 1ULVA 5M7YA 3ANIA 2JG0A 4AYRA 5MEHA 2DRQA 3CIHA 4WVAA 3QG0A 3QXFA 4AYPA 1G6IA 2AHFA 2P0VA 5CD2A 3VXDA 3WIWA 3GT5A 3WUXA 1WZZA 3AFJA 1V7XA 3ANJA 3QWTA 2EADA 1IS9A 2QNOA 4JJJA 3RX5A 5DGQA 1H13A 3T33A 4AYOA
chains in the Genus database with same CATH superfamily
3RX8A 4GTTB 1UMPA 5E2JA 1HCUA 3D5SA 3PMMA 1IA7A 2B4FA 3RENA 3PZ1B 1HMWA 3DSUB 1X81B 1O1TB 3PZ4B 4LNVA 1N24A 1JCQB 1UG9A 2V3PA 1CB8A 1N4PB 1N9AB 4V1SA 3Q79B 4WVBA 4MMHA 2XQWA 5JPMB 3PYAA 3NFVA 4OZWA 3RX7A 2ZISB 3E32B 5GY3A 4M76A 3ON6A 1GSZA 1D8DB 3EU5B 4Q2BA 5DGRA 4EL8A 4D4AA 4Q88A 5IL3A 3ACTA 4L6XA 1NL4B 4KKJA 1IA6A 4V1RA 1HXAA 5FO7B 3EZ8A 2JJBA 4MMIA 1GLMA 5GW7A 3WKIA 3G4DA 1KS8A 5FOBB 4TF4A 1FO2A 1FAEA 1RQ5A 3QFYA 1KZPB 1G9GA 1QQFA 2FUZA 4BOJA 1DL2A 5AGDA 4AYQA 2R2LB 3S4CA 2CQSA 2Z07A 3QDEA 1W6JA 4WVCA 4GTQB 3SDQA 1CLCA 3M73A 1N7RA 1F1SA 2WIIB 1RWFA 3KSQB 3ACSA 4FUSA 3DRAB 1GAHA 5CA3A 1HXCA 4F13A 2BB6A 3Q73B 1TN8B 1TNUB 1H37A 2H6GB 1FBWA 1KSCA 1XWQA 4TXTA 2A8ZA 1FT2B 1K72A 1TN7B 3HXCB 1G9JA 4ZRPA 1S63B 5GZKA 2JF4A 4BOKA 1HZFA 1JCSB 2ONHA 1UT9A 4GAXA 1N7NA 1V5CA 1L2AA 2OKXA 1C3DA 1OJMA 3ANIA 2JG0A 2ONGA 4OK4A 4AYRA 3A0OA 1SA5B 4GL3A 2P0VA 3WUXA 3OEDA 1LD8B 1O1RB 1O1SB 4FXKB 3OXUA 3SQCA 2QNOA 1O79A 3M75A 1TNOB 4GTPB 1OJPA 3Q7AB 2NOJA 1OJNA 3W5MA 1QBQB 3E6UA 1N21A 1N7OA 3Q78B 1DOGA 2FV1A 3W7UA 1GHQA 4DOEA 3Q7FB 1RWCA 3QT3A 2V3NA 2XFGA 5IK0A 1N4SB 2G02A 3HXBB 3E34B 3SDUA 4OK2A 2AHGA 3Q75B 1HM2A 4ZG8A 2V8IA 3PZ3B 2BEDB 5ILJA 1N22A 3RRSA 1H39A 4XUVA 1KKTA 4OJZA 3M7LA 2EACA 1V7WA 2BB5A 4FXGB 5ILIA 5IL8A 2WYNA 3LZ9A 5IK6A 3X17A 3DSTB 2A73B 1WU6A 1NI1B 2H6IB 2WDAA 1WU4A 1HXGA 1FBOA 3E73A 1F9GA 3N0FA 1KWFA 3S4DA 5KKBA 2AFAA 3WKGA 3K11A 1H3BA 2GZ6A 1RWAA 1SQCA 3CU7A 3QSPA 1V5DA 2BRPA 2GOXA 2VN7A 4CJ1A 3E33B 3A3VA 3G4FA 3VW5A 3S4AA 1O6QA 1N7PA 4ZRQA 3SAEA 1MZCB 3W7TA 3M00A 3W5NA 5EASA 1O5MB 2X03A 1H14A 2H6FB 1XW2A 1KFGA 5EATA 4LNGB 3RSYA 5IKAA 4CE7A 3M7BA 1QAZA 1H3AA 2XWBB 4L0GA 3WIRA 2V8JA 4CJ0A 4NEIA 3E30B 3QT9A 1F9DA 3P5PA 3WKFA 4RNQA 2ZZRA 1N4RB 3G6JB 2D8LA 2GH4A 4C1SA 3M77A 4WVAA 5EAUA 1TNZB 3QXFA 1HM3A 4GTOB 1G6IA 3VXDA 3AFJA 5ILDA 1GXOA 4YDEB 5JMFA 2G0DA 3HXFB 5JPNB 1XWTA 1LTXB 1QSJA 1TNYB 4GTSB 2RI9A 4GTRB 1N1BA 3P2CA 1O6HA 2I07B 1J0NA 1TN6B 1GAIA 1NXCA 4DI5A 4D4CA 1W3YA 2SQCA 1KSDA 1X1IA 1FMIA 1HV6A 1FT1B 1N95B 1AGMA 1HN0A 5DHKA 3SFYB 1WU5A 1R76A 2DRSA 1SA4B 2RI8A 1FPPB 3S4BA 1H3CA 1N4QB 2V8KA 3AFLA 1N7QA 3EQAA 3S9VA 3M76A 1RW9A 1W6KA 1LF6A 1GA2A 1CEMA 2F0YB 4OZVA 3DSSB 4KKIA 3DPYB 1EGUA 2F6DA 1LF9A 3ANKA 2WY7A 2NVPA 5ILHA 2PN5A 3E80A 5CZLA 1KZOB 5C05A 1AYXA 3SDTA 1LOHA 1FCEA 3QXQA 3RJ3A 2EABA 1H36A 1N1ZA 1F9OA 3PYBA 2VN4A 1I8QA 3VSNA 1HX9A 1N94B 1OJOA 2H6HB 4QT9A 4FJQA 1J0MA 2IEJB 4ZH5A 3D3IA 1H12A 4D4BA 2WY8A 3WKHA 1RWHA 4Z4LA 5FO9B 4YCRA 1VD5A 3M7CA 5IKHA 2J5CA 2DRQA 3QG0A 3K7XA 2FUQA 4AYPA 2AHFA 1GXMA 1V7XA 3QWTA 3HXEB 1IS9A 4YDOB 1HMUA 1LXMA 4JJJA 3RX5A 1X1JA 5JMDA 3M71A 1JCRB 3T33A 4AYOA 3N0GA 5ILZA 3EUVB 1FO3A 1H54A 3QPFA 3D5RA 3H2WA 3DSVB 5IK9A 2EAEA 3P5RA 3C72B 2YIKA 1V7VA 5FO8B 1TNBB 2Q1FA 3W7WA 5M7IA 3PZ2B 4DODA 4GTMB 2PMVA 4KTRA 3TF4A 1NC5A 2ZIRB 3WIQA 3M02A 2ZBLA 2FBAA 1L1YA 3DSXB 1LD7B 3M72A 1O6RA 3DSWB 2E24A 1JS4A 1TF4A 1FP3A 4Z4JA 1GXNA 1RWGA 1C82A 1H35A 3VSMA 3GLYA 2D5JA 3QRYA 4D94A 4MBGB 1X9DA 3SDVA 1X1HA 1S64B 3WC3A 3SDRA 2RGKA 3H7LA 2XWJB 1LXKA 3QFZA 2FV0A 4D4DA 2CQTA 2FUTA 5DHIA 4E1YA 2DROA 3HXDB 2B39A 3GZKA 3W7SA 2DRRA 1KREA 4J5TA 2BBCA 4LIXA 3NNBA 3W7XA 3KLSA 1KRFA 1G87A 3M01A 3M7EA 3E37B 3E7JA 2BRWA 1N23A 1DCEB 4ZH1A 5IM1A 4F10A 2WINB 4EHMB 4WU0A 4GTVB 4KTPA 3H3KA 1D8EB 3EU8A 3M74A 1ULVA 4FNVA 5M7YA 5ILYA 4MU9A 1N20A 5MEHA 3CIHA 3SFXB 3KQ4A 2BRVX 4LNBB 4ONTA 2WCOA 5CD2A 3WIWA 3GT5A 1WZZA 4L9PB 3ANJA 2EADA 3M78A 5ILKA 2E22A 5DGQA 3KSLB 1H13A
chains in the Genus database with same CATH topology
3RX8A 4GTTB 1UMPA 5E2JA 1HCUA 3D5SA 3PMMA 1IA7A 2B4FA 3RENA 3PZ1B 3DSUB 1X81B 1O1TB 3PZ4B 4LNVA 1JCQB 1UG9A 2V3PA 1N4PB 1N9AB 4V1SA 3Q79B 4WVBA 2XQWA 5JPMB 3PYAA 3RX7A 2ZISB 3E32B 5GY3A 4M76A 3ON6A 1GSZA 1D8DB 3EU5B 4Q2BA 5DGRA 4EL8A 4D4AA 4Q88A 3ACTA 4L6XA 1NL4B 4KKJA 1IA6A 4V1RA 5FO7B 3EZ8A 2JJBA 1GLMA 5GW7A 3WKIA 1KS8A 5FOBB 4TF4A 1FO2A 1FAEA 1RQ5A 3QFYA 1KZPB 1G9GA 1QQFA 2FUZA 4BOJA 1DL2A 5AGDA 4AYQA 2R2LB 3S4CA 2CQSA 2Z07A 3QDEA 1W6JA 4WVCA 4GTQB 3SDQA 1CLCA 3M73A 2WIIB 3KSQB 3ACSA 4FUSA 3DRAB 1GAHA 5CA3A 2BB6A 3Q73B 1TN8B 1TNUB 1H37A 2H6GB 1FBWA 1KSCA 1XWQA 4TXTA 2A8ZA 1FT2B 1K72A 1TN7B 3HXCB 1G9JA 4ZRPA 1S63B 5GZKA 2JF4A 4BOKA 1HZFA 1JCSB 1UT9A 1V5CA 1L2AA 2OKXA 1C3DA 3ANIA 2JG0A 4AYRA 1SA5B 4GL3A 2P0VA 3WUXA 3OEDA 1LD8B 1O1RB 1O1SB 4FXKB 3OXUA 3SQCA 2QNOA 1O79A 3M75A 1TNOB 4GTPB 3Q7AB 2NOJA 3W5MA 1QBQB 3E6UA 3Q78B 1DOGA 2FV1A 3W7UA 1GHQA 4DOEA 3Q7FB 3QT3A 2V3NA 2XFGA 1N4SB 2G02A 3HXBB 3E34B 3SDUA 2AHGA 3Q75B 4ZG8A 2V8IA 3PZ3B 2BEDB 3RRSA 1H39A 4XUVA 1KKTA 3M7LA 2EACA 1V7WA 2BB5A 4FXGB 2WYNA 3X17A 3DSTB 2A73B 1WU6A 1NI1B 2H6IB 1WU4A 1FBOA 3E73A 1KWFA 3S4DA 5KKBA 2AFAA 3WKGA 3K11A 1H3BA 2GZ6A 1SQCA 3CU7A 3QSPA 1V5DA 2GOXA 2VN7A 4CJ1A 3E33B 3A3VA 3VW5A 3S4AA 1O6QA 4ZRQA 3SAEA 1MZCB 3W7TA 3W5NA 1O5MB 1H14A 2H6FB 1XW2A 1KFGA 4LNGB 3RSYA 4CE7A 3M7BA 1H3AA 2XWBB 4L0GA 3WIRA 2V8JA 4CJ0A 3E30B 3QT9A 1F9DA 3P5PA 3WKFA 2ZZRA 1N4RB 3G6JB 2D8LA 2GH4A 4C1SA 3M77A 4WVAA 1TNZB 3QXFA 4GTOB 1G6IA 3VXDA 3AFJA 1GXOA 4YDEB 2G0DA 3HXFB 5JPNB 1XWTA 1LTXB 1QSJA 1TNYB 4GTSB 2RI9A 4GTRB 3P2CA 1O6HA 2I07B 1TN6B 1GAIA 1NXCA 4D4CA 2SQCA 1KSDA 1FMIA 1FT1B 1N95B 1AGMA 3SFYB 1WU5A 1R76A 2DRSA 1SA4B 2RI8A 1FPPB 3S4BA 1H3CA 1N4QB 2V8KA 3EQAA 3S9VA 3M76A 1W6KA 1LF6A 1GA2A 1CEMA 2F0YB 3DSSB 4KKIA 3DPYB 2F6DA 1LF9A 3ANKA 2WY7A 2NVPA 2PN5A 5CZLA 1KZOB 1AYXA 3SDTA 1FCEA 3QXQA 3RJ3A 2EABA 1H36A 1F9OA 3PYBA 2VN4A 1N94B 2H6HB 4QT9A 2IEJB 4ZH5A 3D3IA 1H12A 4D4BA 2WY8A 3WKHA 4Z4LA 5FO9B 4YCRA 1VD5A 3M7CA 2DRQA 3QG0A 3K7XA 4AYPA 2AHFA 1GXMA 1V7XA 3QWTA 3HXEB 1IS9A 4YDOB 4JJJA 3RX5A 3M71A 1JCRB 3T33A 4AYOA 3EUVB 1FO3A 1H54A 3QPFA 3D5RA 3H2WA 3DSVB 2EAEA 3P5RA 3C72B 2YIKA 1V7VA 5FO8B 1TNBB 3W7WA 5M7IA 3PZ2B 4DODA 4GTMB 2PMVA 4KTRA 3TF4A 1NC5A 2ZIRB 3WIQA 2ZBLA 2FBAA 1L1YA 3DSXB 1LD7B 3M72A 1O6RA 3DSWB 1JS4A 1TF4A 1FP3A 4Z4JA 1GXNA 1H35A 3GLYA 2D5JA 3QRYA 4D94A 4MBGB 1X9DA 3SDVA 3WC3A 1S64B 3SDRA 2RGKA 3H7LA 2XWJB 3QFZA 2FV0A 4D4DA 2CQTA 2DROA 3HXDB 2B39A 3GZKA 3W7SA 2DRRA 1KREA 4J5TA 2BBCA 4LIXA 3W7XA 3KLSA 1KRFA 1G87A 3M7EA 3E37B 1DCEB 4ZH1A 2WINB 4EHMB 4WU0A 4GTVB 4KTPA 3H3KA 1D8EB 3EU8A 3M74A 1ULVA 5M7YA 4MU9A 5MEHA 3CIHA 3SFXB 3KQ4A 4LNBB 4ONTA 5CD2A 3WIWA 3GT5A 1WZZA 4L9PB 3ANJA 2EADA 3M78A 5DGQA 3KSLB 1H13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RX8 A;  3W5M A;  3E6U A;  1XWT A;  5E2J A;  1HCU A;  1DOG A;  1FO3 A;  1H54 A;  2FV1 A;  3QPF A;  3H2W A;  3PMM A;  2RI9 A;  3W7U A;  1IA7 A;  2B4F A;  3REN A;  4DOE A;  2EAE A;  3P2C A;  3QT3 A;  2XFG A;  1GAI A;  1NXC A;  2YIK A;  1V7V A;  3W7W A;  5M7I A;  1UG9 A;  1KSD A;  4DOD A;  2AHG A;  1FMI A;  4WVB A;  4ZG8 A;  1AGM A;  4KTR A;  3TF4 A;  1NC5 A;  3RX7 A;  1WU5 A;  3WIQ A;  2DRS A;  5GY3 A;  3ON6 A;  3RRS A;  2RI8 A;  4XUV A;  2ZBL A;  2FBA A;  1L1Y A;  3S4B A;  1KKT A;  4Q2B A;  5DGR A;  4EL8 A;  2EAC A;  1V7W A;  3EQA A;  4Q88 A;  2WYN A;  3ACT A;  4L6X A;  1IA6 A;  3X17 A;  1LF6 A;  1JS4 A;  1GA2 A;  3EZ8 A;  1WU6 A;  2JJB A;  1CEM A;  1GLM A;  1WU4 A;  5GW7 A;  1TF4 A;  3WKI A;  1KS8 A;  1FBO A;  1FP3 A;  3E73 A;  4TF4 A;  1FO2 A;  4Z4J A;  1FAE A;  1KWF A;  1RQ5 A;  3QFY A;  2AFA A;  3S4D A;  5KKB A;  3GLY A;  1G9G A;  3WKG A;  3K11 A;  2D5J A;  2FUZ A;  3QRY A;  1DL2 A;  4AYQ A;  2GZ6 A;  1X9D A;  3WC3 A;  3QSP A;  3S4C A;  2CQS A;  2Z07 A;  2RGK A;  3H7L A;  3QDE A;  1V5D A;  2VN7 A;  4WVC A;  4CJ1 A;  3A3V A;  1CLC A;  3VW5 A;  3QFZ A;  2F6D A;  1LF9 A;  3ANK A;  2FV0 A;  3S4A A;  2CQT A;  2NVP A;  2DRO A;  5CZL A;  1AYX A;  3W7T A;  3GZK A;  3W7S A;  3W5N A;  3ACS A;  4FUS A;  2DRR A;  1KRE A;  4J5T A;  5CA3 A;  1FCE A;  1GAH A;  3QXQ A;  2EAB A;  3W7X A;  1F9O A;  1H14 A;  1KRF A;  1G87 A;  2VN4 A;  1FBW A;  1KSC A;  1XWQ A;  4TXT A;  1XW2 A;  1KFG A;  3RSY A;  4CE7 A;  2A8Z A;  1K72 A;  4L0G A;  3WIR A;  1G9J A;  4CJ0 A;  4ZH5 A;  2JF4 A;  4WU0 A;  3D3I A;  4KTP A;  1H12 A;  3H3K A;  1F9D A;  3QT9 A;  1UT9 A;  3WKH A;  4Z4L A;  3WKF A;  1V5C A;  2ZZR A;  1L2A A;  2OKX A;  1VD5 A;  2D8L A;  2GH4 A;  1ULV A;  5M7Y A;  3ANI A;  2JG0 A;  4AYR A;  5MEH A;  2DRQ A;  3CIH A;  4WVA A;  3QG0 A;  3QXF A;  4AYP A;  1G6I A;  2AHF A;  2P0V A;  5CD2 A;  3VXD A;  3WIW A;  3GT5 A;  3WUX A;  1WZZ A;  3AFJ A;  1V7X A;  3ANJ A;  3QWT A;  2EAD A;  1IS9 A;  2QNO A;  4JJJ A;  3RX5 A;  5DGQ A;  1H13 A;  3T33 A;  4AYO A; 
#chains in the Genus database with same CATH topology
 3RX8 A;  4GTT B;  1UMP A;  5E2J A;  1HCU A;  3D5S A;  3PMM A;  1IA7 A;  2B4F A;  3REN A;  3PZ1 B;  1HMW A;  3DSU B;  1X81 B;  1O1T B;  3PZ4 B;  4LNV A;  1N24 A;  1JCQ B;  1UG9 A;  2V3P A;  1CB8 A;  1N4P B;  1N9A B;  4V1S A;  3Q79 B;  4WVB A;  4MMH A;  2XQW A;  5JPM B;  3PYA A;  3NFV A;  4OZW A;  3RX7 A;  2ZIS B;  3E32 B;  5GY3 A;  4M76 A;  3ON6 A;  1GSZ A;  1D8D B;  3EU5 B;  4Q2B A;  5DGR A;  4EL8 A;  4D4A A;  4Q88 A;  5IL3 A;  3ACT A;  4L6X A;  1NL4 B;  4KKJ A;  1IA6 A;  4V1R A;  1HXA A;  5FO7 B;  3EZ8 A;  2JJB A;  4MMI A;  1GLM A;  5GW7 A;  3WKI A;  3G4D A;  1KS8 A;  5FOB B;  4TF4 A;  1FO2 A;  1FAE A;  1RQ5 A;  3QFY A;  1KZP B;  1G9G A;  1QQF A;  2FUZ A;  4BOJ A;  1DL2 A;  5AGD A;  4AYQ A;  2R2L B;  3S4C A;  2CQS A;  2Z07 A;  3QDE A;  1W6J A;  4WVC A;  4GTQ B;  3SDQ A;  1CLC A;  3M73 A;  1N7R A;  1F1S A;  2WII B;  1RWF A;  3KSQ B;  3ACS A;  4FUS A;  3DRA B;  1GAH A;  5CA3 A;  1HXC A;  4F13 A;  2BB6 A;  3Q73 B;  1TN8 B;  1TNU B;  1H37 A;  2H6G B;  1FBW A;  1KSC A;  1XWQ A;  4TXT A;  2A8Z A;  1FT2 B;  1K72 A;  1TN7 B;  3HXC B;  1G9J A;  4ZRP A;  1S63 B;  5GZK A;  2JF4 A;  4BOK A;  1HZF A;  1JCS B;  2ONH A;  1UT9 A;  4GAX A;  1N7N A;  1V5C A;  1L2A A;  2OKX A;  1C3D A;  1OJM A;  3ANI A;  2JG0 A;  2ONG A;  4OK4 A;  4AYR A;  3A0O A;  1SA5 B;  4GL3 A;  2P0V A;  3WUX A;  3OED A;  1LD8 B;  1O1R B;  1O1S B;  4FXK B;  3OXU A;  3SQC A;  2QNO A;  1O79 A;  3M75 A;  1TNO B;  4GTP B;  1OJP A;  3Q7A B;  2NOJ A;  1OJN A;  3W5M A;  1QBQ B;  3E6U A;  1N21 A;  1N7O A;  3Q78 B;  1DOG A;  2FV1 A;  3W7U A;  1GHQ A;  4DOE A;  3Q7F B;  1RWC A;  3QT3 A;  2V3N A;  2XFG A;  5IK0 A;  1N4S B;  2G02 A;  3HXB B;  3E34 B;  3SDU A;  4OK2 A;  2AHG A;  3Q75 B;  1HM2 A;  4ZG8 A;  2V8I A;  3PZ3 B;  2BED B;  5ILJ A;  1N22 A;  3RRS A;  1H39 A;  4XUV A;  1KKT A;  4OJZ A;  3M7L A;  2EAC A;  1V7W A;  2BB5 A;  4FXG B;  5ILI A;  5IL8 A;  2WYN A;  3LZ9 A;  5IK6 A;  3X17 A;  3DST B;  2A73 B;  1WU6 A;  1NI1 B;  2H6I B;  2WDA A;  1WU4 A;  1HXG A;  1FBO A;  3E73 A;  1F9G A;  3N0F A;  1KWF A;  3S4D A;  5KKB A;  2AFA A;  3WKG A;  3K11 A;  1H3B A;  2GZ6 A;  1RWA A;  1SQC A;  3CU7 A;  3QSP A;  1V5D A;  2BRP A;  2GOX A;  2VN7 A;  4CJ1 A;  3E33 B;  3A3V A;  3G4F A;  3VW5 A;  3S4A A;  1O6Q A;  1N7P A;  4ZRQ A;  3SAE A;  1MZC B;  3W7T A;  3M00 A;  3W5N A;  5EAS A;  1O5M B;  2X03 A;  1H14 A;  2H6F B;  1XW2 A;  1KFG A;  5EAT A;  4LNG B;  3RSY A;  5IKA A;  4CE7 A;  3M7B A;  1QAZ A;  1H3A A;  2XWB B;  4L0G A;  3WIR A;  2V8J A;  4CJ0 A;  4NEI A;  3E30 B;  3QT9 A;  1F9D A;  3P5P A;  3WKF A;  4RNQ A;  2ZZR A;  1N4R B;  3G6J B;  2D8L A;  2GH4 A;  4C1S A;  3M77 A;  4WVA A;  5EAU A;  1TNZ B;  3QXF A;  1HM3 A;  4GTO B;  1G6I A;  3VXD A;  3AFJ A;  5ILD A;  1GXO A;  4YDE B;  5JMF A;  2G0D A;  3HXF B;  5JPN B;  1XWT A;  1LTX B;  1QSJ A;  1TNY B;  4GTS B;  2RI9 A;  4GTR B;  1N1B A;  3P2C A;  1O6H A;  2I07 B;  1J0N A;  1TN6 B;  1GAI A;  1NXC A;  4DI5 A;  4D4C A;  1W3Y A;  2SQC A;  1KSD A;  1X1I A;  1FMI A;  1HV6 A;  1FT1 B;  1N95 B;  1AGM A;  1HN0 A;  5DHK A;  3SFY B;  1WU5 A;  1R76 A;  2DRS A;  1SA4 B;  2RI8 A;  1FPP B;  3S4B A;  1H3C A;  1N4Q B;  2V8K A;  3AFL A;  1N7Q A;  3EQA A;  3S9V A;  3M76 A;  1RW9 A;  1W6K A;  1LF6 A;  1GA2 A;  1CEM A;  2F0Y B;  4OZV A;  3DSS B;  4KKI A;  3DPY B;  1EGU A;  2F6D A;  1LF9 A;  3ANK A;  2WY7 A;  2NVP A;  5ILH A;  2PN5 A;  3E80 A;  5CZL A;  1KZO B;  5C05 A;  1AYX A;  3SDT A;  1LOH A;  1FCE A;  3QXQ A;  3RJ3 A;  2EAB A;  1H36 A;  1N1Z A;  1F9O A;  3PYB A;  2VN4 A;  1I8Q A;  3VSN A;  1HX9 A;  1N94 B;  1OJO A;  2H6H B;  4QT9 A;  4FJQ A;  1J0M A;  2IEJ B;  4ZH5 A;  3D3I A;  1H12 A;  4D4B A;  2WY8 A;  3WKH A;  1RWH A;  4Z4L A;  5FO9 B;  4YCR A;  1VD5 A;  3M7C A;  5IKH A;  2J5C A;  2DRQ A;  3QG0 A;  3K7X A;  2FUQ A;  4AYP A;  2AHF A;  1GXM A;  1V7X A;  3QWT A;  3HXE B;  1IS9 A;  4YDO B;  1HMU A;  1LXM A;  4JJJ A;  3RX5 A;  1X1J A;  5JMD A;  3M71 A;  1JCR B;  3T33 A;  4AYO A;  3N0G A;  5ILZ A;  3EUV B;  1FO3 A;  1H54 A;  3QPF A;  3D5R A;  3H2W A;  3DSV B;  5IK9 A;  2EAE A;  3P5R A;  3C72 B;  2YIK A;  1V7V A;  5FO8 B;  1TNB B;  2Q1F A;  3W7W A;  5M7I A;  3PZ2 B;  4DOD A;  4GTM B;  2PMV A;  4KTR A;  3TF4 A;  1NC5 A;  2ZIR B;  3WIQ A;  3M02 A;  2ZBL A;  2FBA A;  1L1Y A;  3DSX B;  1LD7 B;  3M72 A;  1O6R A;  3DSW B;  2E24 A;  1JS4 A;  1TF4 A;  1FP3 A;  4Z4J A;  1GXN A;  1RWG A;  1C82 A;  1H35 A;  3VSM A;  3GLY A;  2D5J A;  3QRY A;  4D94 A;  4MBG B;  1X9D A;  3SDV A;  1X1H A;  1S64 B;  3WC3 A;  3SDR A;  2RGK A;  3H7L A;  2XWJ B;  1LXK A;  3QFZ A;  2FV0 A;  4D4D A;  2CQT A;  2FUT A;  5DHI A;  4E1Y A;  2DRO A;  3HXD B;  2B39 A;  3GZK A;  3W7S A;  2DRR A;  1KRE A;  4J5T A;  2BBC A;  4LIX A;  3NNB A;  3W7X A;  3KLS A;  1KRF A;  1G87 A;  3M01 A;  3M7E A;  3E37 B;  3E7J A;  2BRW A;  1N23 A;  1DCE B;  4ZH1 A;  5IM1 A;  4F10 A;  2WIN B;  4EHM B;  4WU0 A;  4GTV B;  4KTP A;  3H3K A;  1D8E B;  3EU8 A;  3M74 A;  1ULV A;  4FNV A;  5M7Y A;  5ILY A;  4MU9 A;  1N20 A;  5MEH A;  3CIH A;  3SFX B;  3KQ4 A;  2BRV X;  4LNB B;  4ONT A;  2WCO A;  5CD2 A;  3WIW A;  3GT5 A;  1WZZ A;  4L9P B;  3ANJ A;  2EAD A;  3M78 A;  5ILK A;  2E22 A;  5DGQ A;  3KSL B;  1H13 A; 
#chains in the Genus database with same CATH homology
 3RX8 A;  4GTT B;  1UMP A;  5E2J A;  1HCU A;  3D5S A;  3PMM A;  1IA7 A;  2B4F A;  3REN A;  3PZ1 B;  3DSU B;  1X81 B;  1O1T B;  3PZ4 B;  4LNV A;  1JCQ B;  1UG9 A;  2V3P A;  1N4P B;  1N9A B;  4V1S A;  3Q79 B;  4WVB A;  2XQW A;  5JPM B;  3PYA A;  3RX7 A;  2ZIS B;  3E32 B;  5GY3 A;  4M76 A;  3ON6 A;  1GSZ A;  1D8D B;  3EU5 B;  4Q2B A;  5DGR A;  4EL8 A;  4D4A A;  4Q88 A;  3ACT A;  4L6X A;  1NL4 B;  4KKJ A;  1IA6 A;  4V1R A;  5FO7 B;  3EZ8 A;  2JJB A;  1GLM A;  5GW7 A;  3WKI A;  1KS8 A;  5FOB B;  4TF4 A;  1FO2 A;  1FAE A;  1RQ5 A;  3QFY A;  1KZP B;  1G9G A;  1QQF A;  2FUZ A;  4BOJ A;  1DL2 A;  5AGD A;  4AYQ A;  2R2L B;  3S4C A;  2CQS A;  2Z07 A;  3QDE A;  1W6J A;  4WVC A;  4GTQ B;  3SDQ A;  1CLC A;  3M73 A;  2WII B;  3KSQ B;  3ACS A;  4FUS A;  3DRA B;  1GAH A;  5CA3 A;  2BB6 A;  3Q73 B;  1TN8 B;  1TNU B;  1H37 A;  2H6G B;  1FBW A;  1KSC A;  1XWQ A;  4TXT A;  2A8Z A;  1FT2 B;  1K72 A;  1TN7 B;  3HXC B;  1G9J A;  4ZRP A;  1S63 B;  5GZK A;  2JF4 A;  4BOK A;  1HZF A;  1JCS B;  1UT9 A;  1V5C A;  1L2A A;  2OKX A;  1C3D A;  3ANI A;  2JG0 A;  4AYR A;  1SA5 B;  4GL3 A;  2P0V A;  3WUX A;  3OED A;  1LD8 B;  1O1R B;  1O1S B;  4FXK B;  3OXU A;  3SQC A;  2QNO A;  1O79 A;  3M75 A;  1TNO B;  4GTP B;  3Q7A B;  2NOJ A;  3W5M A;  1QBQ B;  3E6U A;  3Q78 B;  1DOG A;  2FV1 A;  3W7U A;  1GHQ A;  4DOE A;  3Q7F B;  3QT3 A;  2V3N A;  2XFG A;  1N4S B;  2G02 A;  3HXB B;  3E34 B;  3SDU A;  2AHG A;  3Q75 B;  4ZG8 A;  2V8I A;  3PZ3 B;  2BED B;  3RRS A;  1H39 A;  4XUV A;  1KKT A;  3M7L A;  2EAC A;  1V7W A;  2BB5 A;  4FXG B;  2WYN A;  3X17 A;  3DST B;  2A73 B;  1WU6 A;  1NI1 B;  2H6I B;  1WU4 A;  1FBO A;  3E73 A;  1KWF A;  3S4D A;  5KKB A;  2AFA A;  3WKG A;  3K11 A;  1H3B A;  2GZ6 A;  1SQC A;  3CU7 A;  3QSP A;  1V5D A;  2GOX A;  2VN7 A;  4CJ1 A;  3E33 B;  3A3V A;  3VW5 A;  3S4A A;  1O6Q A;  4ZRQ A;  3SAE A;  1MZC B;  3W7T A;  3W5N A;  1O5M B;  1H14 A;  2H6F B;  1XW2 A;  1KFG A;  4LNG B;  3RSY A;  4CE7 A;  3M7B A;  1H3A A;  2XWB B;  4L0G A;  3WIR A;  2V8J A;  4CJ0 A;  3E30 B;  3QT9 A;  1F9D A;  3P5P A;  3WKF A;  2ZZR A;  1N4R B;  3G6J B;  2D8L A;  2GH4 A;  4C1S A;  3M77 A;  4WVA A;  1TNZ B;  3QXF A;  4GTO B;  1G6I A;  3VXD A;  3AFJ A;  1GXO A;  4YDE B;  2G0D A;  3HXF B;  5JPN B;  1XWT A;  1LTX B;  1QSJ A;  1TNY B;  4GTS B;  2RI9 A;  4GTR B;  3P2C A;  1O6H A;  2I07 B;  1TN6 B;  1GAI A;  1NXC A;  4D4C A;  2SQC A;  1KSD A;  1FMI A;  1FT1 B;  1N95 B;  1AGM A;  3SFY B;  1WU5 A;  1R76 A;  2DRS A;  1SA4 B;  2RI8 A;  1FPP B;  3S4B A;  1H3C A;  1N4Q B;  2V8K A;  3EQA A;  3S9V A;  3M76 A;  1W6K A;  1LF6 A;  1GA2 A;  1CEM A;  2F0Y B;  3DSS B;  4KKI A;  3DPY B;  2F6D A;  1LF9 A;  3ANK A;  2WY7 A;  2NVP A;  2PN5 A;  5CZL A;  1KZO B;  1AYX A;  3SDT A;  1FCE A;  3QXQ A;  3RJ3 A;  2EAB A;  1H36 A;  1F9O A;  3PYB A;  2VN4 A;  1N94 B;  2H6H B;  4QT9 A;  2IEJ B;  4ZH5 A;  3D3I A;  1H12 A;  4D4B A;  2WY8 A;  3WKH A;  4Z4L A;  5FO9 B;  4YCR A;  1VD5 A;  3M7C A;  2DRQ A;  3QG0 A;  3K7X A;  4AYP A;  2AHF A;  1GXM A;  1V7X A;  3QWT A;  3HXE B;  1IS9 A;  4YDO B;  4JJJ A;  3RX5 A;  3M71 A;  1JCR B;  3T33 A;  4AYO A;  3EUV B;  1FO3 A;  1H54 A;  3QPF A;  3D5R A;  3H2W A;  3DSV B;  2EAE A;  3P5R A;  3C72 B;  2YIK A;  1V7V A;  5FO8 B;  1TNB B;  3W7W A;  5M7I A;  3PZ2 B;  4DOD A;  4GTM B;  2PMV A;  4KTR A;  3TF4 A;  1NC5 A;  2ZIR B;  3WIQ A;  2ZBL A;  2FBA A;  1L1Y A;  3DSX B;  1LD7 B;  3M72 A;  1O6R A;  3DSW B;  1JS4 A;  1TF4 A;  1FP3 A;  4Z4J A;  1GXN A;  1H35 A;  3GLY A;  2D5J A;  3QRY A;  4D94 A;  4MBG B;  1X9D A;  3SDV A;  3WC3 A;  1S64 B;  3SDR A;  2RGK A;  3H7L A;  2XWJ B;  3QFZ A;  2FV0 A;  4D4D A;  2CQT A;  2DRO A;  3HXD B;  2B39 A;  3GZK A;  3W7S A;  2DRR A;  1KRE A;  4J5T A;  2BBC A;  4LIX A;  3W7X A;  3KLS A;  1KRF A;  1G87 A;  3M7E A;  3E37 B;  1DCE B;  4ZH1 A;  2WIN B;  4EHM B;  4WU0 A;  4GTV B;  4KTP A;  3H3K A;  1D8E B;  3EU8 A;  3M74 A;  1ULV A;  5M7Y A;  4MU9 A;  5MEH A;  3CIH A;  3SFX B;  3KQ4 A;  4LNB B;  4ONT A;  5CD2 A;  3WIW A;  3GT5 A;  1WZZ A;  4L9P B;  3ANJ A;  2EAD A;  3M78 A;  5DGQ A;  3KSL B;  1H13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...