3QT3A

Analysis of a new family of widely distributed metal-independent alpha-mannosidases provides unique insight into the processing of n-linked glycans, clostridium perfringens cpe0426 apo-structure
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
425
structure length
425
Chain Sequence
b'SLSTNELKEIVRKIGKDLSGKIEDKKLQELFYNCFINTMDTTVEVSEGDAFVITGDIPAMWLRDSTSQVEHYLPFVKEYPELKAIFTGLINRQVKCIFIDPYANAFNKEPNGQKWDNDITKDSPWVWERKYEIDSLCYPVRLIHKYWKESGDETFFNYDIKKAFNMIIDLWRVEQYHREKSDYSFQRLNCSVTDTLSHEGLGTPVTYTGMTWSGFRPSDDACEYGYLIPANMFAVVALRYISEIAEKVYKDEELKEKADSLREEIDNAIEKHGKVYKEGFGEVYAYETDGMGNYNFMDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIALSMQGLTTNNQEEIDQLIKLLKETDAGTGYMHEGFHVDDPTKFTRDWFAWSNSLFSHFIYEKVINK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein CPE0426
publication title Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 157
structure length 425
sequence length 425
ec nomenclature
pdb deposition date 2011-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06824 Glyco_hydro_125 Metal-independent alpha-mannosidase (GH125)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3qt3A01
2QNOA 1KWFA 3H7LA 3ACSA 1JS4A 4Z4LA 2ZBLA 3H2WA 1X9DA 3QXQA 3RX7A 1ULVA 4AYRA 4L6XA 3X17A 4TF4A 2P0VA 1VD5A 3GT5A 4EL8A 1FMIA 2B4FA 2FBAA 2XFGA 1LF9A 1FO3A 3E6UA 1IS9A 3RSYA 1H14A 5CD2A 4KTPA 2RI8A 3WIWA 1CEMA 2NVPA 2CQSA 2JF4A 3RX8A 3WIRA 5DGRA 1CLCA 3WKFA 2D8LA 3W7XA 2FV1A 4WVBA 3ANIA 3K11A 3QT3A 3QRYA 3QDEA 3ANKA 3W7TA 3ON6A 1WU6A 1KKTA 3H3KA 1G9GA 1GLMA 1V7VA 1IA6A 3QG0A 2DRRA 1RQ5A 1H13A 3QXFA 1AYXA 3W5NA 2YIKA 3WKGA 4DOEA 1V7WA 2Z07A 3EQAA 3T33A 1F9DA 3WC3A 1G9JA 2AHGA 3RX5A 4AYQA 4ZH5A 4Q2BA 2ZZRA 2A8ZA 1KRFA 4L0GA 4AYPA 1H54A 2DRQA 3E73A 1NXCA 3QWTA 2EACA 5DGQA 1DOGA 3QFYA 3QSPA 4AYOA 2VN4A 1KREA 4Q88A 1KFGA 2AFAA 4CJ0A 1WU4A 3RENA 3WKHA 1L2AA 3W5MA 1L1YA 3W7UA 1FBWA 3D3IA 1G87A 5M7YA 1FO2A 1IA7A 5MEHA 3AFJA 2CQTA 3PMMA 3GLYA 1UT9A 1WU5A 4FUSA 1G6IA 3QT9A 2EAEA 3S4CA 3ACTA 3P2CA 1KSCA 3QFZA 1XW2A 1K72A 2RI9A 2JJBA 2DRSA 4CJ1A 3WKIA 4J5TA 3TF4A 2VN7A 5CZLA 1GAHA 4TXTA 3EZ8A 1H12A 4WVCA 3S4AA 4DODA 1GAIA 3RRSA 1V7XA 1FCEA 4Z4JA 2GH4A 1LF6A 1NC5A 5M7IA 3W7SA 4WU0A 1FAEA 3WUXA 4WVAA 1GA2A 3W7WA 1V5CA 4JJJA 2FV0A 2EABA 5GW7A 1DL2A 2F6DA 1KS8A 2FUZA 2JG0A 4XUVA 2AHFA 2D5JA 3A3VA 3QPFA 1FBOA 2OKXA 3CIHA 5KKBA 1KSDA 2EADA 1F9OA 1XWTA 1AGMA 2GZ6A 4ZG8A 1HCUA 5E2JA 3S4DA 3ANJA 2WYNA 1TF4A 1UG9A 1WZZA 3S4BA 3VXDA 3WIQA 2DROA 5GY3A 3GZKA 1FP3A 4KTRA 3VW5A 1XWQA 5CA3A 4CE7A 2RGKA 1V5DA
chains in the Genus database with same CATH superfamily
2SQCA 1KWFA 3H7LA 4Z4LA 1RWFA 2ZBLA 3H2WA 3Q78B 3E34B 4YDOB 3RX7A 3X17A 4TF4A 1GSZA 1QSJA 4OJZA 1VD5A 1X1HA 3E6UA 2XWJB 1IS9A 1TNUB 1HX9A 5CD2A 3SFXB 4D4BA 3EUVB 1N9AB 3M02A 2RI8A 1N22A 2NVPA 3RX8A 2ONGA 1FT1B 4MBGB 4WVBA 3G4FA 1H3AA 3K11A 2E24A 3ANKA 3W7TA 3CU7A 1O6HA 1TN6B 1OJOA 1RWGA 3QXFA 1H13A 4DOEA 1LTXB 1V7WA 2Z07A 3T33A 1F9DA 1SA4B 3KQ4A 1LD8B 1LXKA 2ZZRA 4L0GA 1H54A 2BEDB 3KLSA 3G4DA 2DRQA 1W6KA 3QWTA 4GL3A 3QFYA 3QSPA 2VN4A 1KFGA 1FPPB 3Q75B 1WU4A 4MMHA 3RENA 3WKHA 3W5MA 1O5MB 5MEHA 1UT9A 1C3DA 4FUSA 2B39A 5ILKA 3QT9A 5JMDA 3N0GA 4ZH1A 3G6JB 1XW2A 1GXNA 4F13A 2DRSA 3SDVA 2VN7A 3HXBB 4E1YA 3EZ8A 1GHQA 1H12A 4KKJA 1N1ZA 3DSTB 5IL3A 3W7SA 2ZIRB 4GTSB 4WVAA 1GA2A 1F9GA 2FUTA 4JJJA 1R76A 1TN7B 2FV0A 5ILYA 1RW9A 1RWHA 2AHFA 1HXCA 3M77A 1KSDA 2EADA 1JCQB 1AGMA 2GZ6A 2H6HB 4ZG8A 4GTRB 3VSMA 3GZKA 1FP3A 4KTRA 3SQCA 4FXKB 4CE7A 1W3YA 2RGKA 3M7LA 1UMPA 2QNOA 2G02A 4FJQA 1FT2B 3E33B 2WY8A 3HXEB 1TNYB 2BB5A 2F0YB 4EL8A 1N7QA 3P5RA 1D8DB 4F10A 4V1RA 3RSYA 1H14A 3PZ4B 2V8IA 3PZ2B 1CEMA 3SDTA 2JF4A 5JMFA 3ANIA 3QT3A 3QRYA 1KKTA 1GLMA 3DSVB 2Q1FA 2DRRA 3OXUA 5IKAA 2BRWA 3E7JA 2YIKA 3WKGA 2V3PA 1G9JA 1CB8A 4AYQA 3M7BA 1HZFA 4GTTB 2H6IB 3E73A 2J5CA 2EACA 5DGQA 1DOGA 5FO8B 3M76A 4AYOA 1N7OA 1L2AA 2PMVA 1SA5B 3E80A 5ILDA 3K7XA 1FBWA 1IA7A 3AFJA 3PMMA 3GLYA 3SDUA 1WU5A 1MZCB 3E32B 1C82A 3SFYB 3Q73B 3P2CA 3QFZA 2XWBB 2RI9A 2JJBA 1TNBB 4KKIA 4CJ1A 1F1SA 5ILIA 3D5SA 4LNBB 4GAXA 4LNGB 5IK6A 1V7XA 1LF6A 4LIXA 3DSUB 2WY7A 3SDRA 3NNBA 3WUXA 5M7IA 3W7WA 1H37A 5FO9B 4QT9A 3DPYB 5DHIA 1DCEB 5IM1A 2JG0A 4XUVA 1I8QA 4MU9A 2D5JA 4NEIA 1FBOA 1RWCA 2V8KA 1H3CA 3E30B 1NL4B 2BRPA 2G0DA 1N4RB 3P5PA 4GTVB 5IK0A 3Q7AB 1HCUA 4OK4A 1TF4A 1LXMA 1WZZA 3NFVA 1RWAA 3C72B 2H6FB 1V5DA 3OEDA 4BOKA 1LOHA 1JS4A 1KZPB 5EASA 2V3NA 3QXQA 1ULVA 4AYRA 1HXAA 4L6XA 2P0VA 1O79A 1H39A 1O1SB 2GOXA 1FMIA 2B4FA 1HN0A 1TN8B 4MMIA 1LF9A 2V8JA 1FO3A 2WIIB 5GZKA 2H6GB 4L9PB 3DSWB 1O6RA 3A0OA 1CLCA 3WKFA 3W7XA 1N20A 2XQWA 3ON6A 1HXGA 3H3KA 3AFLA 2PN5A 5IKHA 1GXMA 3QG0A 1RQ5A 1AYXA 3W5NA 3PZ1B 3EQAA 3WC3A 4OZVA 3M7EA 2BB6A 4AYPA 2A8ZA 1J0MA 1KRFA 5C05A 3M00A 3M75A 4GTMB 1N4SB 4V1SA 5JPMB 3HXFB 2AFAA 4CJ0A 5AGDA 3W7UA 3D3IA 1KZOB 2NOJA 1G87A 3N0FA 3DRAB 4YCRA 5EAUA 3M01A 1G6IA 4FXGB 1N94B 2WDAA 1TNOB 5IK9A 1GXOA 3WKIA 1D8EB 4D4DA 4TXTA 3DSXB 1J0NA 3M7CA 4DODA 4ZRPA 1GAIA 3RRSA 1FCEA 4M76A 4Z4JA 5FOBB 1NC5A 2I07B 4DI5A 4WU0A 1FAEA 3Q7FB 4YDEB 1O1RB 1DL2A 1N95B 4RNQA 2F6DA 1KS8A 3DSSB 2FUQA 4FNVA 3QPFA 4GTOB 1N4QB 5DHKA 5KKBA 5EATA 2WINB 1F9OA 1XWTA 2ZISB 1QQFA 4ZRQA 2X03A 5E2JA 4OZWA 3S4DA 1HM3A 2WYNA 3M72A 3VXDA 3WIQA 3SDQA 5GY3A 3VW5A 1XWQA 5CA3A 1NI1B 3HXDB 3ACSA 5FO7B 1N21A 1N7PA 3M73A 1X9DA 1X81B 1EGUA 3M78A 1H3BA 1N4PB 3GT5A 1LD7B 2FBAA 2XFGA 3KSLB 4C1SA 4BOJA 1H36A 4KTPA 3WIWA 1HM2A 2CQSA 3WIRA 5DGRA 2D8LA 2FV1A 2R2LB 2E22A 5ILJA 1QAZA 3LZ9A 1OJMA 2A73B 3QDEA 1TNZB 1WU6A 5ILHA 5ILZA 2BBCA 1G9GA 3Q79B 1V7VA 3S9VA 1HMUA 1IA6A 3KSQB 4D4CA 1X1IA 4D4AA 2AHGA 3EU8A 3RX5A 4ZH5A 3EU5B 4Q2BA 1N7NA 1S63B 1NXCA 3PYAA 1HV6A 3M71A 3PYBA 1KREA 4Q88A 5JPNB 1L1YA 5M7YA 1FO2A 1SQCA 2CQTA 2WCOA 4GTQB 3VSNA 3E37B 1S64B 4LNVA 1N7RA 3RJ3A 1JCRB 2EAEA 3S4CA 3ACTA 1OJPA 1KSCA 1N24A 1K72A 4J5TA 3TF4A 5CZLA 1GAHA 4WVCA 3S4AA 1HMWA 1JCSB 2GH4A 5IL8A 4ONTA 1V5CA 2EABA 1QBQB 2IEJB 1N23A 5GW7A 3M74A 3D5RA 2FUZA 4EHMB 1OJNA 3A3VA 1H35A 2OKXA 3CIHA 4D94A 3HXCB 1O1TB 2BRVX 1O6QA 1X1JA 3SAEA 4GTPB 3PZ3B 4OK2A 3ANJA 1N1BA 2ONHA 1UG9A 3S4BA 2DROA 1W6JA
chains in the Genus database with same CATH topology
2SQCA 1KWFA 3H7LA 4Z4LA 2ZBLA 3H2WA 3Q78B 3E34B 4YDOB 3RX7A 3X17A 4TF4A 1GSZA 1QSJA 1VD5A 3E6UA 2XWJB 1IS9A 1TNUB 5CD2A 3SFXB 4D4BA 3EUVB 1N9AB 2RI8A 2NVPA 3RX8A 1FT1B 4MBGB 4WVBA 1H3AA 3K11A 3ANKA 3W7TA 3CU7A 1O6HA 1TN6B 3QXFA 1H13A 4DOEA 1LTXB 1V7WA 2Z07A 3T33A 1F9DA 1SA4B 3KQ4A 1LD8B 2ZZRA 4L0GA 1H54A 2BEDB 3KLSA 2DRQA 1W6KA 3QWTA 4GL3A 3QFYA 3QSPA 2VN4A 1KFGA 1FPPB 3Q75B 1WU4A 3RENA 3WKHA 3W5MA 1O5MB 5MEHA 1UT9A 1C3DA 4FUSA 2B39A 3QT9A 4ZH1A 3G6JB 1XW2A 1GXNA 2DRSA 3SDVA 2VN7A 3HXBB 3EZ8A 1GHQA 1H12A 4KKJA 3DSTB 3W7SA 2ZIRB 4GTSB 4WVAA 1GA2A 4JJJA 1R76A 1TN7B 2FV0A 2AHFA 3M77A 1KSDA 2EADA 1JCQB 1AGMA 2GZ6A 2H6HB 4ZG8A 4GTRB 3GZKA 1FP3A 4KTRA 3SQCA 4FXKB 4CE7A 2RGKA 3M7LA 1UMPA 2QNOA 2G02A 1FT2B 3E33B 2WY8A 3HXEB 1TNYB 2BB5A 2F0YB 4EL8A 3P5RA 1D8DB 4V1RA 3RSYA 1H14A 3PZ4B 2V8IA 3PZ2B 1CEMA 3SDTA 2JF4A 3ANIA 3QT3A 3QRYA 1KKTA 1GLMA 3DSVB 2DRRA 3OXUA 2YIKA 3WKGA 2V3PA 1G9JA 4AYQA 3M7BA 1HZFA 4GTTB 2H6IB 3E73A 2EACA 5DGQA 1DOGA 5FO8B 3M76A 4AYOA 1L2AA 2PMVA 1SA5B 3K7XA 1FBWA 1IA7A 3AFJA 3PMMA 3GLYA 3SDUA 1WU5A 1MZCB 3E32B 3SFYB 3Q73B 3P2CA 3QFZA 2XWBB 2RI9A 2JJBA 1TNBB 4KKIA 4CJ1A 3D5SA 4LNBB 4LNGB 1V7XA 1LF6A 4LIXA 3DSUB 2WY7A 3SDRA 3WUXA 5M7IA 3W7WA 1H37A 5FO9B 4QT9A 3DPYB 1DCEB 2JG0A 4XUVA 4MU9A 2D5JA 1FBOA 2V8KA 1H3CA 3E30B 1NL4B 2G0DA 3P5PA 1N4RB 4GTVB 3Q7AB 1HCUA 1TF4A 1WZZA 3C72B 2H6FB 1V5DA 3OEDA 4BOKA 1JS4A 1KZPB 2V3NA 3QXQA 1ULVA 4AYRA 4L6XA 2P0VA 1O79A 1H39A 1O1SB 2GOXA 1FMIA 2B4FA 1TN8B 1LF9A 2V8JA 1FO3A 2WIIB 5GZKA 2H6GB 4L9PB 3DSWB 1O6RA 1CLCA 3WKFA 3W7XA 2XQWA 3ON6A 3H3KA 2PN5A 1GXMA 3QG0A 1RQ5A 1AYXA 3W5NA 3PZ1B 3EQAA 3WC3A 3M7EA 2BB6A 4AYPA 2A8ZA 1KRFA 3M75A 4GTMB 1N4SB 4V1SA 5JPMB 3HXFB 2AFAA 4CJ0A 5AGDA 3W7UA 3D3IA 1KZOB 2NOJA 1G87A 3DRAB 4YCRA 1G6IA 4FXGB 1N94B 1TNOB 1GXOA 3WKIA 1D8EB 4D4DA 4TXTA 3DSXB 3M7CA 4DODA 4ZRPA 1GAIA 3RRSA 1FCEA 4M76A 4Z4JA 5FOBB 1NC5A 2I07B 4WU0A 1FAEA 3Q7FB 4YDEB 1O1RB 1DL2A 1N95B 2F6DA 1KS8A 3DSSB 3QPFA 4GTOB 1N4QB 5KKBA 2WINB 1F9OA 1XWTA 2ZISB 1QQFA 4ZRQA 5E2JA 3S4DA 2WYNA 3M72A 3VXDA 3WIQA 3SDQA 5GY3A 3VW5A 1XWQA 5CA3A 1NI1B 3HXDB 3ACSA 5FO7B 3M73A 1X9DA 1X81B 3M78A 1H3BA 1N4PB 3GT5A 1LD7B 2FBAA 2XFGA 3KSLB 4C1SA 4BOJA 1H36A 4KTPA 3WIWA 2CQSA 3WIRA 5DGRA 2D8LA 2FV1A 2R2LB 2A73B 3QDEA 1TNZB 1WU6A 2BBCA 1G9GA 3Q79B 1V7VA 3S9VA 1IA6A 3KSQB 4D4CA 4D4AA 2AHGA 3EU8A 3RX5A 4ZH5A 3EU5B 4Q2BA 1S63B 1NXCA 3PYAA 3M71A 3PYBA 1KREA 4Q88A 5JPNB 1L1YA 5M7YA 1FO2A 1SQCA 2CQTA 4GTQB 3E37B 1S64B 4LNVA 3RJ3A 1JCRB 2EAEA 3S4CA 3ACTA 1KSCA 1K72A 4J5TA 3TF4A 5CZLA 1GAHA 4WVCA 3S4AA 1JCSB 2GH4A 4ONTA 1V5CA 2EABA 1QBQB 2IEJB 5GW7A 3M74A 3D5RA 2FUZA 4EHMB 3A3VA 1H35A 2OKXA 3CIHA 4D94A 3HXCB 1O1TB 1O6QA 3SAEA 4GTPB 3PZ3B 3ANJA 1UG9A 3S4BA 2DROA 1W6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QNO A;  1KWF A;  3H7L A;  3ACS A;  1JS4 A;  4Z4L A;  2ZBL A;  3H2W A;  1X9D A;  3QXQ A;  3RX7 A;  1ULV A;  4AYR A;  4L6X A;  3X17 A;  4TF4 A;  2P0V A;  1VD5 A;  3GT5 A;  4EL8 A;  1FMI A;  2B4F A;  2FBA A;  2XFG A;  1LF9 A;  1FO3 A;  3E6U A;  1IS9 A;  3RSY A;  1H14 A;  5CD2 A;  4KTP A;  2RI8 A;  3WIW A;  1CEM A;  2NVP A;  2CQS A;  2JF4 A;  3RX8 A;  3WIR A;  5DGR A;  1CLC A;  3WKF A;  2D8L A;  3W7X A;  2FV1 A;  4WVB A;  3ANI A;  3K11 A;  3QT3 A;  3QRY A;  3QDE A;  3ANK A;  3W7T A;  3ON6 A;  1WU6 A;  1KKT A;  3H3K A;  1G9G A;  1GLM A;  1V7V A;  1IA6 A;  3QG0 A;  2DRR A;  1RQ5 A;  1H13 A;  3QXF A;  1AYX A;  3W5N A;  2YIK A;  3WKG A;  4DOE A;  1V7W A;  2Z07 A;  3EQA A;  3T33 A;  1F9D A;  3WC3 A;  1G9J A;  2AHG A;  3RX5 A;  4AYQ A;  4ZH5 A;  4Q2B A;  2ZZR A;  2A8Z A;  1KRF A;  4L0G A;  4AYP A;  1H54 A;  2DRQ A;  3E73 A;  1NXC A;  3QWT A;  2EAC A;  5DGQ A;  1DOG A;  3QFY A;  3QSP A;  4AYO A;  2VN4 A;  1KRE A;  4Q88 A;  1KFG A;  2AFA A;  4CJ0 A;  1WU4 A;  3REN A;  3WKH A;  1L2A A;  3W5M A;  1L1Y A;  3W7U A;  1FBW A;  3D3I A;  1G87 A;  5M7Y A;  1FO2 A;  1IA7 A;  5MEH A;  3AFJ A;  2CQT A;  3PMM A;  3GLY A;  1UT9 A;  1WU5 A;  4FUS A;  1G6I A;  3QT9 A;  2EAE A;  3S4C A;  3ACT A;  3P2C A;  1KSC A;  3QFZ A;  1XW2 A;  1K72 A;  2RI9 A;  2JJB A;  2DRS A;  4CJ1 A;  3WKI A;  4J5T A;  3TF4 A;  2VN7 A;  5CZL A;  1GAH A;  4TXT A;  3EZ8 A;  1H12 A;  4WVC A;  3S4A A;  4DOD A;  1GAI A;  3RRS A;  1V7X A;  1FCE A;  4Z4J A;  2GH4 A;  1LF6 A;  1NC5 A;  5M7I A;  3W7S A;  4WU0 A;  1FAE A;  3WUX A;  4WVA A;  1GA2 A;  3W7W A;  1V5C A;  4JJJ A;  2FV0 A;  2EAB A;  5GW7 A;  1DL2 A;  2F6D A;  1KS8 A;  2FUZ A;  2JG0 A;  4XUV A;  2AHF A;  2D5J A;  3A3V A;  3QPF A;  1FBO A;  2OKX A;  3CIH A;  5KKB A;  1KSD A;  2EAD A;  1F9O A;  1XWT A;  1AGM A;  2GZ6 A;  4ZG8 A;  1HCU A;  5E2J A;  3S4D A;  3ANJ A;  2WYN A;  1TF4 A;  1UG9 A;  1WZZ A;  3S4B A;  3VXD A;  3WIQ A;  2DRO A;  5GY3 A;  3GZK A;  1FP3 A;  4KTR A;  3VW5 A;  1XWQ A;  5CA3 A;  4CE7 A;  2RGK A;  1V5D A; 
#chains in the Genus database with same CATH topology
 2SQC A;  1KWF A;  3H7L A;  4Z4L A;  1RWF A;  2ZBL A;  3H2W A;  3Q78 B;  3E34 B;  4YDO B;  3RX7 A;  3X17 A;  4TF4 A;  1GSZ A;  1QSJ A;  4OJZ A;  1VD5 A;  1X1H A;  3E6U A;  2XWJ B;  1IS9 A;  1TNU B;  1HX9 A;  5CD2 A;  3SFX B;  4D4B A;  3EUV B;  1N9A B;  3M02 A;  2RI8 A;  1N22 A;  2NVP A;  3RX8 A;  2ONG A;  1FT1 B;  4MBG B;  4WVB A;  3G4F A;  1H3A A;  3K11 A;  2E24 A;  3ANK A;  3W7T A;  3CU7 A;  1O6H A;  1TN6 B;  1OJO A;  1RWG A;  3QXF A;  1H13 A;  4DOE A;  1LTX B;  1V7W A;  2Z07 A;  3T33 A;  1F9D A;  1SA4 B;  3KQ4 A;  1LD8 B;  1LXK A;  2ZZR A;  4L0G A;  1H54 A;  2BED B;  3KLS A;  3G4D A;  2DRQ A;  1W6K A;  3QWT A;  4GL3 A;  3QFY A;  3QSP A;  2VN4 A;  1KFG A;  1FPP B;  3Q75 B;  1WU4 A;  4MMH A;  3REN A;  3WKH A;  3W5M A;  1O5M B;  5MEH A;  1UT9 A;  1C3D A;  4FUS A;  2B39 A;  5ILK A;  3QT9 A;  5JMD A;  3N0G A;  4ZH1 A;  3G6J B;  1XW2 A;  1GXN A;  4F13 A;  2DRS A;  3SDV A;  2VN7 A;  3HXB B;  4E1Y A;  3EZ8 A;  1GHQ A;  1H12 A;  4KKJ A;  1N1Z A;  3DST B;  5IL3 A;  3W7S A;  2ZIR B;  4GTS B;  4WVA A;  1GA2 A;  1F9G A;  2FUT A;  4JJJ A;  1R76 A;  1TN7 B;  2FV0 A;  5ILY A;  1RW9 A;  1RWH A;  2AHF A;  1HXC A;  3M77 A;  1KSD A;  2EAD A;  1JCQ B;  1AGM A;  2GZ6 A;  2H6H B;  4ZG8 A;  4GTR B;  3VSM A;  3GZK A;  1FP3 A;  4KTR A;  3SQC A;  4FXK B;  4CE7 A;  1W3Y A;  2RGK A;  3M7L A;  1UMP A;  2QNO A;  2G02 A;  4FJQ A;  1FT2 B;  3E33 B;  2WY8 A;  3HXE B;  1TNY B;  2BB5 A;  2F0Y B;  4EL8 A;  1N7Q A;  3P5R A;  1D8D B;  4F10 A;  4V1R A;  3RSY A;  1H14 A;  3PZ4 B;  2V8I A;  3PZ2 B;  1CEM A;  3SDT A;  2JF4 A;  5JMF A;  3ANI A;  3QT3 A;  3QRY A;  1KKT A;  1GLM A;  3DSV B;  2Q1F A;  2DRR A;  3OXU A;  5IKA A;  2BRW A;  3E7J A;  2YIK A;  3WKG A;  2V3P A;  1G9J A;  1CB8 A;  4AYQ A;  3M7B A;  1HZF A;  4GTT B;  2H6I B;  3E73 A;  2J5C A;  2EAC A;  5DGQ A;  1DOG A;  5FO8 B;  3M76 A;  4AYO A;  1N7O A;  1L2A A;  2PMV A;  1SA5 B;  3E80 A;  5ILD A;  3K7X A;  1FBW A;  1IA7 A;  3AFJ A;  3PMM A;  3GLY A;  3SDU A;  1WU5 A;  1MZC B;  3E32 B;  1C82 A;  3SFY B;  3Q73 B;  3P2C A;  3QFZ A;  2XWB B;  2RI9 A;  2JJB A;  1TNB B;  4KKI A;  4CJ1 A;  1F1S A;  5ILI A;  3D5S A;  4LNB B;  4GAX A;  4LNG B;  5IK6 A;  1V7X A;  1LF6 A;  4LIX A;  3DSU B;  2WY7 A;  3SDR A;  3NNB A;  3WUX A;  5M7I A;  3W7W A;  1H37 A;  5FO9 B;  4QT9 A;  3DPY B;  5DHI A;  1DCE B;  5IM1 A;  2JG0 A;  4XUV A;  1I8Q A;  4MU9 A;  2D5J A;  4NEI A;  1FBO A;  1RWC A;  2V8K A;  1H3C A;  3E30 B;  1NL4 B;  2BRP A;  2G0D A;  1N4R B;  3P5P A;  4GTV B;  5IK0 A;  3Q7A B;  1HCU A;  4OK4 A;  1TF4 A;  1LXM A;  1WZZ A;  3NFV A;  1RWA A;  3C72 B;  2H6F B;  1V5D A;  3OED A;  4BOK A;  1LOH A;  1JS4 A;  1KZP B;  5EAS A;  2V3N A;  3QXQ A;  1ULV A;  4AYR A;  1HXA A;  4L6X A;  2P0V A;  1O79 A;  1H39 A;  1O1S B;  2GOX A;  1FMI A;  2B4F A;  1HN0 A;  1TN8 B;  4MMI A;  1LF9 A;  2V8J A;  1FO3 A;  2WII B;  5GZK A;  2H6G B;  4L9P B;  3DSW B;  1O6R A;  3A0O A;  1CLC A;  3WKF A;  3W7X A;  1N20 A;  2XQW A;  3ON6 A;  1HXG A;  3H3K A;  3AFL A;  2PN5 A;  5IKH A;  1GXM A;  3QG0 A;  1RQ5 A;  1AYX A;  3W5N A;  3PZ1 B;  3EQA A;  3WC3 A;  4OZV A;  3M7E A;  2BB6 A;  4AYP A;  2A8Z A;  1J0M A;  1KRF A;  5C05 A;  3M00 A;  3M75 A;  4GTM B;  1N4S B;  4V1S A;  5JPM B;  3HXF B;  2AFA A;  4CJ0 A;  5AGD A;  3W7U A;  3D3I A;  1KZO B;  2NOJ A;  1G87 A;  3N0F A;  3DRA B;  4YCR A;  5EAU A;  3M01 A;  1G6I A;  4FXG B;  1N94 B;  2WDA A;  1TNO B;  5IK9 A;  1GXO A;  3WKI A;  1D8E B;  4D4D A;  4TXT A;  3DSX B;  1J0N A;  3M7C A;  4DOD A;  4ZRP A;  1GAI A;  3RRS A;  1FCE A;  4M76 A;  4Z4J A;  5FOB B;  1NC5 A;  2I07 B;  4DI5 A;  4WU0 A;  1FAE A;  3Q7F B;  4YDE B;  1O1R B;  1DL2 A;  1N95 B;  4RNQ A;  2F6D A;  1KS8 A;  3DSS B;  2FUQ A;  4FNV A;  3QPF A;  4GTO B;  1N4Q B;  5DHK A;  5KKB A;  5EAT A;  2WIN B;  1F9O A;  1XWT A;  2ZIS B;  1QQF A;  4ZRQ A;  2X03 A;  5E2J A;  4OZW A;  3S4D A;  1HM3 A;  2WYN A;  3M72 A;  3VXD A;  3WIQ A;  3SDQ A;  5GY3 A;  3VW5 A;  1XWQ A;  5CA3 A;  1NI1 B;  3HXD B;  3ACS A;  5FO7 B;  1N21 A;  1N7P A;  3M73 A;  1X9D A;  1X81 B;  1EGU A;  3M78 A;  1H3B A;  1N4P B;  3GT5 A;  1LD7 B;  2FBA A;  2XFG A;  3KSL B;  4C1S A;  4BOJ A;  1H36 A;  4KTP A;  3WIW A;  1HM2 A;  2CQS A;  3WIR A;  5DGR A;  2D8L A;  2FV1 A;  2R2L B;  2E22 A;  5ILJ A;  1QAZ A;  3LZ9 A;  1OJM A;  2A73 B;  3QDE A;  1TNZ B;  1WU6 A;  5ILH A;  5ILZ A;  2BBC A;  1G9G A;  3Q79 B;  1V7V A;  3S9V A;  1HMU A;  1IA6 A;  3KSQ B;  4D4C A;  1X1I A;  4D4A A;  2AHG A;  3EU8 A;  3RX5 A;  4ZH5 A;  3EU5 B;  4Q2B A;  1N7N A;  1S63 B;  1NXC A;  3PYA A;  1HV6 A;  3M71 A;  3PYB A;  1KRE A;  4Q88 A;  5JPN B;  1L1Y A;  5M7Y A;  1FO2 A;  1SQC A;  2CQT A;  2WCO A;  4GTQ B;  3VSN A;  3E37 B;  1S64 B;  4LNV A;  1N7R A;  3RJ3 A;  1JCR B;  2EAE A;  3S4C A;  3ACT A;  1OJP A;  1KSC A;  1N24 A;  1K72 A;  4J5T A;  3TF4 A;  5CZL A;  1GAH A;  4WVC A;  3S4A A;  1HMW A;  1JCS B;  2GH4 A;  5IL8 A;  4ONT A;  1V5C A;  2EAB A;  1QBQ B;  2IEJ B;  1N23 A;  5GW7 A;  3M74 A;  3D5R A;  2FUZ A;  4EHM B;  1OJN A;  3A3V A;  1H35 A;  2OKX A;  3CIH A;  4D94 A;  3HXC B;  1O1T B;  2BRV X;  1O6Q A;  1X1J A;  3SAE A;  4GTP B;  3PZ3 B;  4OK2 A;  3ANJ A;  1N1B A;  2ONH A;  1UG9 A;  3S4B A;  2DRO A;  1W6J A; 
#chains in the Genus database with same CATH homology
 2SQC A;  1KWF A;  3H7L A;  4Z4L A;  2ZBL A;  3H2W A;  3Q78 B;  3E34 B;  4YDO B;  3RX7 A;  3X17 A;  4TF4 A;  1GSZ A;  1QSJ A;  1VD5 A;  3E6U A;  2XWJ B;  1IS9 A;  1TNU B;  5CD2 A;  3SFX B;  4D4B A;  3EUV B;  1N9A B;  2RI8 A;  2NVP A;  3RX8 A;  1FT1 B;  4MBG B;  4WVB A;  1H3A A;  3K11 A;  3ANK A;  3W7T A;  3CU7 A;  1O6H A;  1TN6 B;  3QXF A;  1H13 A;  4DOE A;  1LTX B;  1V7W A;  2Z07 A;  3T33 A;  1F9D A;  1SA4 B;  3KQ4 A;  1LD8 B;  2ZZR A;  4L0G A;  1H54 A;  2BED B;  3KLS A;  2DRQ A;  1W6K A;  3QWT A;  4GL3 A;  3QFY A;  3QSP A;  2VN4 A;  1KFG A;  1FPP B;  3Q75 B;  1WU4 A;  3REN A;  3WKH A;  3W5M A;  1O5M B;  5MEH A;  1UT9 A;  1C3D A;  4FUS A;  2B39 A;  3QT9 A;  4ZH1 A;  3G6J B;  1XW2 A;  1GXN A;  2DRS A;  3SDV A;  2VN7 A;  3HXB B;  3EZ8 A;  1GHQ A;  1H12 A;  4KKJ A;  3DST B;  3W7S A;  2ZIR B;  4GTS B;  4WVA A;  1GA2 A;  4JJJ A;  1R76 A;  1TN7 B;  2FV0 A;  2AHF A;  3M77 A;  1KSD A;  2EAD A;  1JCQ B;  1AGM A;  2GZ6 A;  2H6H B;  4ZG8 A;  4GTR B;  3GZK A;  1FP3 A;  4KTR A;  3SQC A;  4FXK B;  4CE7 A;  2RGK A;  3M7L A;  1UMP A;  2QNO A;  2G02 A;  1FT2 B;  3E33 B;  2WY8 A;  3HXE B;  1TNY B;  2BB5 A;  2F0Y B;  4EL8 A;  3P5R A;  1D8D B;  4V1R A;  3RSY A;  1H14 A;  3PZ4 B;  2V8I A;  3PZ2 B;  1CEM A;  3SDT A;  2JF4 A;  3ANI A;  3QT3 A;  3QRY A;  1KKT A;  1GLM A;  3DSV B;  2DRR A;  3OXU A;  2YIK A;  3WKG A;  2V3P A;  1G9J A;  4AYQ A;  3M7B A;  1HZF A;  4GTT B;  2H6I B;  3E73 A;  2EAC A;  5DGQ A;  1DOG A;  5FO8 B;  3M76 A;  4AYO A;  1L2A A;  2PMV A;  1SA5 B;  3K7X A;  1FBW A;  1IA7 A;  3AFJ A;  3PMM A;  3GLY A;  3SDU A;  1WU5 A;  1MZC B;  3E32 B;  3SFY B;  3Q73 B;  3P2C A;  3QFZ A;  2XWB B;  2RI9 A;  2JJB A;  1TNB B;  4KKI A;  4CJ1 A;  3D5S A;  4LNB B;  4LNG B;  1V7X A;  1LF6 A;  4LIX A;  3DSU B;  2WY7 A;  3SDR A;  3WUX A;  5M7I A;  3W7W A;  1H37 A;  5FO9 B;  4QT9 A;  3DPY B;  1DCE B;  2JG0 A;  4XUV A;  4MU9 A;  2D5J A;  1FBO A;  2V8K A;  1H3C A;  3E30 B;  1NL4 B;  2G0D A;  3P5P A;  1N4R B;  4GTV B;  3Q7A B;  1HCU A;  1TF4 A;  1WZZ A;  3C72 B;  2H6F B;  1V5D A;  3OED A;  4BOK A;  1JS4 A;  1KZP B;  2V3N A;  3QXQ A;  1ULV A;  4AYR A;  4L6X A;  2P0V A;  1O79 A;  1H39 A;  1O1S B;  2GOX A;  1FMI A;  2B4F A;  1TN8 B;  1LF9 A;  2V8J A;  1FO3 A;  2WII B;  5GZK A;  2H6G B;  4L9P B;  3DSW B;  1O6R A;  1CLC A;  3WKF A;  3W7X A;  2XQW A;  3ON6 A;  3H3K A;  2PN5 A;  1GXM A;  3QG0 A;  1RQ5 A;  1AYX A;  3W5N A;  3PZ1 B;  3EQA A;  3WC3 A;  3M7E A;  2BB6 A;  4AYP A;  2A8Z A;  1KRF A;  3M75 A;  4GTM B;  1N4S B;  4V1S A;  5JPM B;  3HXF B;  2AFA A;  4CJ0 A;  5AGD A;  3W7U A;  3D3I A;  1KZO B;  2NOJ A;  1G87 A;  3DRA B;  4YCR A;  1G6I A;  4FXG B;  1N94 B;  1TNO B;  1GXO A;  3WKI A;  1D8E B;  4D4D A;  4TXT A;  3DSX B;  3M7C A;  4DOD A;  4ZRP A;  1GAI A;  3RRS A;  1FCE A;  4M76 A;  4Z4J A;  5FOB B;  1NC5 A;  2I07 B;  4WU0 A;  1FAE A;  3Q7F B;  4YDE B;  1O1R B;  1DL2 A;  1N95 B;  2F6D A;  1KS8 A;  3DSS B;  3QPF A;  4GTO B;  1N4Q B;  5KKB A;  2WIN B;  1F9O A;  1XWT A;  2ZIS B;  1QQF A;  4ZRQ A;  5E2J A;  3S4D A;  2WYN A;  3M72 A;  3VXD A;  3WIQ A;  3SDQ A;  5GY3 A;  3VW5 A;  1XWQ A;  5CA3 A;  1NI1 B;  3HXD B;  3ACS A;  5FO7 B;  3M73 A;  1X9D A;  1X81 B;  3M78 A;  1H3B A;  1N4P B;  3GT5 A;  1LD7 B;  2FBA A;  2XFG A;  3KSL B;  4C1S A;  4BOJ A;  1H36 A;  4KTP A;  3WIW A;  2CQS A;  3WIR A;  5DGR A;  2D8L A;  2FV1 A;  2R2L B;  2A73 B;  3QDE A;  1TNZ B;  1WU6 A;  2BBC A;  1G9G A;  3Q79 B;  1V7V A;  3S9V A;  1IA6 A;  3KSQ B;  4D4C A;  4D4A A;  2AHG A;  3EU8 A;  3RX5 A;  4ZH5 A;  3EU5 B;  4Q2B A;  1S63 B;  1NXC A;  3PYA A;  3M71 A;  3PYB A;  1KRE A;  4Q88 A;  5JPN B;  1L1Y A;  5M7Y A;  1FO2 A;  1SQC A;  2CQT A;  4GTQ B;  3E37 B;  1S64 B;  4LNV A;  3RJ3 A;  1JCR B;  2EAE A;  3S4C A;  3ACT A;  1KSC A;  1K72 A;  4J5T A;  3TF4 A;  5CZL A;  1GAH A;  4WVC A;  3S4A A;  1JCS B;  2GH4 A;  4ONT A;  1V5C A;  2EAB A;  1QBQ B;  2IEJ B;  5GW7 A;  3M74 A;  3D5R A;  2FUZ A;  4EHM B;  3A3V A;  1H35 A;  2OKX A;  3CIH A;  4D94 A;  3HXC B;  1O1T B;  1O6Q A;  3SAE A;  4GTP B;  3PZ3 B;  3ANJ A;  1UG9 A;  3S4B A;  2DRO A;  1W6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...