1GHQA

Cr2-c3d complex structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
MLDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPSDHQELNLDVSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C3
publication title Structure of complement receptor 2 in complex with its C3d ligand.
pubmed doi rcsb
molecule tags Immune system/viral protein receptor
total genus 116
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ghqA00
2H6GB 3EUVB 4GTOB 2A73B 3DSVB 4LNGB 4LNBB 4V1SA 2BB6A 1S64B 4GTRB 1N4RB 1QQFA 1NI1B 3KSQB 2BEDB 3DSWB 1GXNA 2G02A 4D4DA 3KSLB 1N94B 3Q75B 2WINB 3RJ3A 1C3DA 1TN7B 2ZIRB 5AGDA 2BBCA 4KKJA 1W6JA 1GXOA 3HXEB 1SA4B 3E34B 3HXDB 3D5RA 1KZOB 5JPMB 1TNUB 3SQCA 2PN5A 2WY8A 4GTMB 5FOBB 1X81B 4D94A 2WIIB 4LNVA 4D4AA 1TNOB 1KZPB 1JCQB 2V3PA 2V8JA 4V1RA 2I07B 4YDOB 2F0YB 3CU7A 1N4PB 1W6KA 3DSSB 1H3BA 1SQCA 1GHQA 4ZRQA 1N9AB 2ZISB 3K7XA 1TNYB 4GTTB 4MBGB 3DSXB 1FPPB 2R2LB 2B39A 4MU9A 1D8DB 1JCSB 1TNZB 5FO8B 2BB5A 3G6JB 4C1SA 1DCEB 4ZRPA 4FXKB 1FT2B 3KLSA 1QBQB 3EU5B 3E37B 3HXBB 2XWBB 1LTXB 3Q7FB 4FXGB 4KKIA 4D4CA 1N95B 4GTSB 1O1SB 3KQ4A 4M76A 1NL4B 1HZFA 1LD8B 4D4BA 3PZ4B 3DPYB 3PZ3B 2G0DA 1O6QA 3DSUB 4GTPB 4ZH1A 3Q78B 2V3NA 1H3CA 1O79A 2H6FB 3E32B 3Q79B 1UMPA 4ONTA 3Q73B 3DRAB 1H36A 3Q7AB 4GTQB 4GTVB 1R76A 3DSTB 4EHMB 1QSJA 2WY7A 2H6IB 1O5MB 3C72B 1GXMA 3PZ1B 1SA5B 4BOJA 1H35A 1MZCB 1S63B 1LD7B 3HXCB 1GSZA 3SFYB 1H3AA 1O1RB 1JCRB 3OEDA 3HXFB 4YDEB 2V8KA 5FO7B 4L9PB 1TNBB 4BOKA 1H39A 2IEJB 2V8IA 1TN6B 3D5SA 1D8EB 1O6HA 1FT1B 3E30B 2XWJB 2SQCA 3OXUA 3PZ2B 2PMVA 3E33B 1N4QB 2GOXA 1O6RA 5FO9B 1N4SB 1O1TB 2H6HB 2XQWA 1H37A 3SFXB 5JPNB 1TN8B 2NOJA
chains in the Genus database with same CATH superfamily
3EUVB 2FUTA 3M77A 1V7XA 1HXGA 2BB6A 1S64B 3EZ8A 3W7SA 2E24A 3WKIA 2BEDB 2G02A 1C3DA 3RX5A 2BBCA 3AFJA 4KKJA 5IK9A 3D5RA 1LXKA 3SQCA 5FOBB 5GY3A 5GZKA 1GAHA 4LNVA 1TNOB 3QFYA 2BRVX 3P2CA 1V5CA 3DSSB 1SQCA 4ZRQA 1N9AB 2WYNA 1RW9A 2ZISB 2RGKA 1V5DA 5ILKA 3K7XA 2OKXA 1IA6A 4OJZA 4E1YA 1WU5A 4AYQA 1FPPB 4F13A 2EAEA 3W7WA 3GLYA 4FNVA 1N21A 1W3YA 3W5MA 3M02A 3G6JB 3PMMA 3A3VA 3A0OA 1X1JA 5KKBA 1QBQB 4NEIA 4WU0A 1JS4A 3AFLA 3G4FA 4FXGB 4AYOA 1O1SB 1XW2A 3P5PA 2DRQA 4M76A 4KTPA 2RI8A 1CB8A 4AYPA 3H2WA 2WDAA 1O6QA 5IM1A 1N7RA 3DSUB 2J5CA 3Q78B 1H3CA 1N24A 3M01A 3ACSA 3Q79B 1CLCA 3E7JA 2P0VA 3M7CA 3QXQA 2RI9A 3DRAB 3Q7AB 4XUVA 4GTVB 3DSTB 1GXMA 1SA5B 1H35A 1S63B 3M75A 1KSDA 2D5JA 1V7WA 2E22A 2V8KA 1UG9A 1TNBB 2IEJB 3M72A 1J0NA 2SQCA 4ZH5A 1DOGA 3PZ2B 3E33B 4OK2A 5IKAA 2GOXA 4OZVA 1KRFA 1N4SB 2F6DA 2CQTA 3NNBA 1H12A 5JMDA 5IK0A 5DHKA 3VW5A 1RQ5A 1FP3A 2NOJA 1GA2A 4GTOB 2A73B 3DSVB 1LF6A 3VXDA 1V7VA 3QG0A 4D4DA 4WVAA 1TN7B 3RJ3A 1GXOA 3E34B 4EL8A 1KZOB 5JPMB 1HMWA 1TNUB 2WY8A 1X81B 4D94A 2WIIB 1JCQB 4V1RA 3QRYA 3WKFA 1G6IA 3E73A 3M76A 1W6KA 1GHQA 1HM3A 3G4DA 3RSYA 5DGQA 1HM2A 1N7OA 2JJBA 3EQAA 2B39A 3SDTA 3WKGA 1D8DB 1TNZB 1IS9A 3S4DA 4C1SA 4ZRPA 3K11A 5EAUA 1WZZA 2AHGA 5CD2A 1QAZA 3ACTA 3KLSA 3E37B 2FV0A 4CE7A 2XWBB 3Q7FB 2NVPA 4KKIA 1H54A 1N95B 3ANJA 4GTSB 3M74A 3W7TA 1HZFA 2EADA 1OJOA 4AYRA 3DPYB 3N0GA 4YCRA 5EATA 1N7PA 5GW7A 1N1BA 1O79A 1AGMA 3VSMA 1FBWA 3Q73B 4MMHA 1QSJA 3RENA 2WY7A 2H6IB 3C72B 1RWFA 2DRSA 5ILJA 3HXCB 1G87A 1GSZA 1F1SA 1LOHA 1H3AA 1JCRB 4MMIA 3HXFB 4YDEB 3D3IA 2CQSA 4BOKA 1H39A 5ILZA 3D5SA 5DGRA 1O6HA 1FT1B 3W7UA 3OXUA 5C05A 1N22A 3ON6A 2ZZRA 2JF4A 1KSCA 1F9GA 1J0MA 1O1TB 2XQWA 5JPNB 1H13A 1TN8B 3M7LA 3SDUA 3GZKA 4FXKB 1CEMA 4KTRA 1NXCA 4LNBB 4V1SA 4Q2BA 1N4RB 1QQFA 4GL3A 2DROA 1GXNA 1X1IA 3LZ9A 3KSLB 3M73A 3Q75B 4OK4A 3QSPA 5AGDA 1W6JA 3N0FA 2BRWA 5E2JA 1DL2A 2PN5A 4GTMB 4CJ0A 4DOEA 1KFGA 3RX7A 2V3PA 2V8JA 2Q1FA 3ANIA 4JJJA 1WU6A 2I07B 4YDOB 2F0YB 3CU7A 3QT9A 3M7BA 2VN7A 3EU8A 1LXMA 5M7YA 4GAXA 4GTTB 4MBGB 1FCEA 2FUQA 1OJPA 3WIQA 5JMFA 1JCSB 1RWHA 2Z07A 2BB5A 5FO8B 3PYAA 1DCEB 1KREA 1FBOA 1G9JA 1FT2B 3EU5B 3HXBB 1HMUA 5IKHA 1NC5A 1NL4B 1LD8B 3PZ4B 3PZ3B 2G0DA 5CZLA 4F10A 5CA3A 3S4CA 1TF4A 3QDEA 3E80A 2H6FB 2XFGA 3E32B 3M78A 1RWGA 1UMPA 3WIRA 2BRPA 1L1YA 1R76A 4EHMB 3M71A 3PZ1B 5ILYA 2DRRA 5IL8A 3SDVA 4BOJA 3SDQA 1N1ZA 3SFYB 3X17A 4DODA 1GAIA 1HXAA 2AHFA 3SAEA 4WVBA 5FO7B 4Z4JA 2FV1A 4L9PB 1FAEA 1FO2A 3M7EA 3WUXA 1TN6B 1D8EB 3E30B 5ILIA 1FO3A 2XWJB 3CIHA 4Z4LA 1O6RA 3P5RA 3WC3A 1OJMA 2GH4A 4OZWA 3E6UA 2H6HB 3H3KA 1H37A 1FMIA 3VSNA 5MEHA 3SFXB 1ULVA 4QT9A 1H14A 4FUSA 2H6GB 4LNGB 1OJNA 1UT9A 1F9OA 4ZG8A 4GTRB 1X9DA 1NI1B 3KSQB 3DSWB 1N94B 2WINB 2B4FA 3TF4A 1RWAA 1RWCA 2ZIRB 4Q88A 3HXEB 1SA4B 3HXDB 2ONHA 4TF4A 3S4AA 1N7QA 4D4AA 1KZPB 1C82A 1I8QA 1N4PB 2FUZA 4RNQA 2WCOA 1H3BA 3T33A 1N7NA 3S4BA 1TNYB 3DSXB 2QNOA 3QFZA 3S9VA 1KWFA 2R2LB 3GT5A 1HN0A 4MU9A 2A8ZA 2D8LA 4TXTA 5IL3A 2EABA 3QXFA 2GZ6A 1LTXB 4D4CA 3QT3A 3KQ4A 4D4BA 1WU4A 1LF9A 4GTPB 4ZH1A 4CJ1A 2V3NA 1HXCA 2X03A 5ILDA 4L6XA 5IK6A 4J5TA 4ONTA 1IA7A 1H36A 4GTQB 3WIWA 3RRSA 3ANKA 4LIXA 1O5MB 2YIKA 1GLMA 1XWTA 1MZCB 1LD7B 3QPFA 2EACA 5M7IA 3W7XA 1O1RB 3OEDA 1HCUA 1EGUA 5ILHA 3WKHA 1KKTA 2ZBLA 3W5NA 2ONGA 1XWQA 3NFVA 4FJQA 2V8IA 4L0GA 1L2AA 1VD5A 1AYXA 1F9DA 2PMVA 5DHIA 1N4QB 5EASA 3M00A 5FO9B 3QWTA 1K72A 2FBAA 4WVCA 1N20A 3H7LA 1G9GA 1N23A 4DI5A 3SDRA 3PYBA 1KS8A 1HX9A 2AFAA 2VN4A 3RX8A 2JG0A 1X1HA 1HV6A
chains in the Genus database with same CATH topology
3EUVB 3M77A 1V7XA 2BB6A 1S64B 3EZ8A 3W7SA 3WKIA 2BEDB 2G02A 1C3DA 3RX5A 2BBCA 3AFJA 4KKJA 3D5RA 3SQCA 5FOBB 5GY3A 5GZKA 1GAHA 4LNVA 1TNOB 3QFYA 3P2CA 1V5CA 3DSSB 1SQCA 4ZRQA 1N9AB 2WYNA 2ZISB 2RGKA 1V5DA 3K7XA 2OKXA 1IA6A 1WU5A 4AYQA 1FPPB 2EAEA 3W7WA 3GLYA 3W5MA 3PMMA 3G6JB 3A3VA 5KKBA 1QBQB 4WU0A 1JS4A 4FXGB 4AYOA 1O1SB 1XW2A 3P5PA 2DRQA 4M76A 4KTPA 2RI8A 4AYPA 3H2WA 1O6QA 3DSUB 3Q78B 1H3CA 3ACSA 3Q79B 1CLCA 2P0VA 3M7CA 3QXQA 2RI9A 3DRAB 3Q7AB 4XUVA 4GTVB 3DSTB 1GXMA 1SA5B 1H35A 1S63B 3M75A 1KSDA 2D5JA 1V7WA 2V8KA 1UG9A 1TNBB 2IEJB 3M72A 2SQCA 4ZH5A 1DOGA 3PZ2B 3E33B 2GOXA 1KRFA 1N4SB 2F6DA 2CQTA 1H12A 3VW5A 1RQ5A 1FP3A 2NOJA 1GA2A 4GTOB 2A73B 3DSVB 1LF6A 3VXDA 1V7VA 3QG0A 4D4DA 4WVAA 1TN7B 3RJ3A 1GXOA 3E34B 4EL8A 1KZOB 5JPMB 1TNUB 2WY8A 1X81B 4D94A 2WIIB 1JCQB 4V1RA 3QRYA 3WKFA 1G6IA 3E73A 3M76A 1W6KA 1GHQA 3RSYA 5DGQA 2JJBA 3EQAA 2B39A 3SDTA 3WKGA 1D8DB 1TNZB 1IS9A 3S4DA 4C1SA 4ZRPA 3K11A 1WZZA 2AHGA 5CD2A 3ACTA 3KLSA 3E37B 2FV0A 4CE7A 2XWBB 3Q7FB 2NVPA 4KKIA 1H54A 1N95B 3ANJA 4GTSB 3M74A 3W7TA 1HZFA 2EADA 4AYRA 3DPYB 4YCRA 5GW7A 1O79A 1AGMA 1FBWA 3Q73B 1QSJA 3RENA 2WY7A 2H6IB 3C72B 2DRSA 3HXCB 1G87A 1GSZA 1H3AA 1JCRB 3HXFB 4YDEB 3D3IA 2CQSA 4BOKA 1H39A 3D5SA 5DGRA 1O6HA 1FT1B 3W7UA 3OXUA 3ON6A 2ZZRA 2JF4A 1KSCA 1O1TB 2XQWA 5JPNB 1H13A 1TN8B 3M7LA 3SDUA 3GZKA 4FXKB 1CEMA 4KTRA 1NXCA 4LNBB 4V1SA 4Q2BA 1N4RB 1QQFA 4GL3A 2DROA 1GXNA 3KSLB 3M73A 3Q75B 3QSPA 5AGDA 1W6JA 5E2JA 1DL2A 2PN5A 4GTMB 4CJ0A 4DOEA 1KFGA 3RX7A 2V3PA 2V8JA 3ANIA 4JJJA 1WU6A 2I07B 4YDOB 2F0YB 3CU7A 3QT9A 3M7BA 2VN7A 3EU8A 5M7YA 4GTTB 4MBGB 1FCEA 3WIQA 1JCSB 2Z07A 2BB5A 5FO8B 3PYAA 1DCEB 1KREA 1FBOA 1G9JA 1FT2B 3EU5B 3HXBB 1NC5A 1NL4B 1LD8B 3PZ4B 3PZ3B 2G0DA 5CZLA 5CA3A 3S4CA 1TF4A 3QDEA 2H6FB 2XFGA 3E32B 3M78A 1UMPA 3WIRA 1L1YA 1R76A 4EHMB 3M71A 3PZ1B 2DRRA 3SDVA 4BOJA 3SDQA 3SFYB 3X17A 4DODA 1GAIA 2AHFA 3SAEA 4WVBA 5FO7B 4Z4JA 2FV1A 4L9PB 1FAEA 1FO2A 3M7EA 3WUXA 1TN6B 1D8EB 3E30B 1FO3A 2XWJB 3CIHA 4Z4LA 1O6RA 3P5RA 3WC3A 2GH4A 3E6UA 2H6HB 3H3KA 1H37A 1FMIA 5MEHA 3SFXB 1ULVA 4QT9A 1H14A 4FUSA 2H6GB 4LNGB 1UT9A 1F9OA 4ZG8A 4GTRB 1X9DA 1NI1B 3KSQB 3DSWB 1N94B 2WINB 2B4FA 3TF4A 2ZIRB 4Q88A 3HXEB 1SA4B 3HXDB 4TF4A 3S4AA 4D4AA 1KZPB 1N4PB 2FUZA 1H3BA 3T33A 3S4BA 1TNYB 3DSXB 2QNOA 3QFZA 3S9VA 1KWFA 2R2LB 3GT5A 4MU9A 2A8ZA 2D8LA 4TXTA 2EABA 3QXFA 2GZ6A 1LTXB 4D4CA 3QT3A 3KQ4A 4D4BA 1WU4A 1LF9A 4GTPB 4ZH1A 4CJ1A 2V3NA 4L6XA 4J5TA 4ONTA 1IA7A 1H36A 4GTQB 3WIWA 3RRSA 3ANKA 4LIXA 1O5MB 2YIKA 1GLMA 1XWTA 1MZCB 1LD7B 3QPFA 2EACA 5M7IA 3W7XA 1O1RB 3OEDA 1HCUA 3WKHA 1KKTA 2ZBLA 3W5NA 1XWQA 2V8IA 4L0GA 1L2AA 1VD5A 1AYXA 1F9DA 2PMVA 1N4QB 5FO9B 3QWTA 1K72A 2FBAA 4WVCA 3H7LA 1G9GA 3SDRA 3PYBA 1KS8A 2AFAA 2VN4A 3RX8A 2JG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6G B;  3EUV B;  4GTO B;  2A73 B;  3DSV B;  4LNG B;  4LNB B;  4V1S A;  2BB6 A;  1S64 B;  4GTR B;  1N4R B;  1QQF A;  1NI1 B;  3KSQ B;  2BED B;  3DSW B;  1GXN A;  2G02 A;  4D4D A;  3KSL B;  1N94 B;  3Q75 B;  2WIN B;  3RJ3 A;  1C3D A;  1TN7 B;  2ZIR B;  5AGD A;  2BBC A;  4KKJ A;  1W6J A;  1GXO A;  3HXE B;  1SA4 B;  3E34 B;  3HXD B;  3D5R A;  1KZO B;  5JPM B;  1TNU B;  3SQC A;  2PN5 A;  2WY8 A;  4GTM B;  5FOB B;  1X81 B;  4D94 A;  2WII B;  4LNV A;  4D4A A;  1TNO B;  1KZP B;  1JCQ B;  2V3P A;  2V8J A;  4V1R A;  2I07 B;  4YDO B;  2F0Y B;  3CU7 A;  1N4P B;  1W6K A;  3DSS B;  1H3B A;  1SQC A;  1GHQ A;  4ZRQ A;  1N9A B;  2ZIS B;  3K7X A;  1TNY B;  4GTT B;  4MBG B;  3DSX B;  1FPP B;  2R2L B;  2B39 A;  4MU9 A;  1D8D B;  1JCS B;  1TNZ B;  5FO8 B;  2BB5 A;  3G6J B;  4C1S A;  1DCE B;  4ZRP A;  4FXK B;  1FT2 B;  3KLS A;  1QBQ B;  3EU5 B;  3E37 B;  3HXB B;  2XWB B;  1LTX B;  3Q7F B;  4FXG B;  4KKI A;  4D4C A;  1N95 B;  4GTS B;  1O1S B;  3KQ4 A;  4M76 A;  1NL4 B;  1HZF A;  1LD8 B;  4D4B A;  3PZ4 B;  3DPY B;  3PZ3 B;  2G0D A;  1O6Q A;  3DSU B;  4GTP B;  4ZH1 A;  3Q78 B;  2V3N A;  1H3C A;  1O79 A;  2H6F B;  3E32 B;  3Q79 B;  1UMP A;  4ONT A;  3Q73 B;  3DRA B;  1H36 A;  3Q7A B;  4GTQ B;  4GTV B;  1R76 A;  3DST B;  4EHM B;  1QSJ A;  2WY7 A;  2H6I B;  1O5M B;  3C72 B;  1GXM A;  3PZ1 B;  1SA5 B;  4BOJ A;  1H35 A;  1MZC B;  1S63 B;  1LD7 B;  3HXC B;  1GSZ A;  3SFY B;  1H3A A;  1O1R B;  1JCR B;  3OED A;  3HXF B;  4YDE B;  2V8K A;  5FO7 B;  4L9P B;  1TNB B;  4BOK A;  1H39 A;  2IEJ B;  2V8I A;  1TN6 B;  3D5S A;  1D8E B;  1O6H A;  1FT1 B;  3E30 B;  2XWJ B;  2SQC A;  3OXU A;  3PZ2 B;  2PMV A;  3E33 B;  1N4Q B;  2GOX A;  1O6R A;  5FO9 B;  1N4S B;  1O1T B;  2H6H B;  2XQW A;  1H37 A;  3SFX B;  5JPN B;  1TN8 B;  2NOJ A; 
#chains in the Genus database with same CATH topology
 3EUV B;  2FUT A;  3M77 A;  1V7X A;  1HXG A;  2BB6 A;  1S64 B;  3EZ8 A;  3W7S A;  2E24 A;  3WKI A;  2BED B;  2G02 A;  1C3D A;  3RX5 A;  2BBC A;  3AFJ A;  4KKJ A;  5IK9 A;  3D5R A;  1LXK A;  3SQC A;  5FOB B;  5GY3 A;  5GZK A;  1GAH A;  4LNV A;  1TNO B;  3QFY A;  2BRV X;  3P2C A;  1V5C A;  3DSS B;  1SQC A;  4ZRQ A;  1N9A B;  2WYN A;  1RW9 A;  2ZIS B;  2RGK A;  1V5D A;  5ILK A;  3K7X A;  2OKX A;  1IA6 A;  4OJZ A;  4E1Y A;  1WU5 A;  4AYQ A;  1FPP B;  4F13 A;  2EAE A;  3W7W A;  3GLY A;  4FNV A;  1N21 A;  1W3Y A;  3W5M A;  3M02 A;  3G6J B;  3PMM A;  3A3V A;  3A0O A;  1X1J A;  5KKB A;  1QBQ B;  4NEI A;  4WU0 A;  1JS4 A;  3AFL A;  3G4F A;  4FXG B;  4AYO A;  1O1S B;  1XW2 A;  3P5P A;  2DRQ A;  4M76 A;  4KTP A;  2RI8 A;  1CB8 A;  4AYP A;  3H2W A;  2WDA A;  1O6Q A;  5IM1 A;  1N7R A;  3DSU B;  2J5C A;  3Q78 B;  1H3C A;  1N24 A;  3M01 A;  3ACS A;  3Q79 B;  1CLC A;  3E7J A;  2P0V A;  3M7C A;  3QXQ A;  2RI9 A;  3DRA B;  3Q7A B;  4XUV A;  4GTV B;  3DST B;  1GXM A;  1SA5 B;  1H35 A;  1S63 B;  3M75 A;  1KSD A;  2D5J A;  1V7W A;  2E22 A;  2V8K A;  1UG9 A;  1TNB B;  2IEJ B;  3M72 A;  1J0N A;  2SQC A;  4ZH5 A;  1DOG A;  3PZ2 B;  3E33 B;  4OK2 A;  5IKA A;  2GOX A;  4OZV A;  1KRF A;  1N4S B;  2F6D A;  2CQT A;  3NNB A;  1H12 A;  5JMD A;  5IK0 A;  5DHK A;  3VW5 A;  1RQ5 A;  1FP3 A;  2NOJ A;  1GA2 A;  4GTO B;  2A73 B;  3DSV B;  1LF6 A;  3VXD A;  1V7V A;  3QG0 A;  4D4D A;  4WVA A;  1TN7 B;  3RJ3 A;  1GXO A;  3E34 B;  4EL8 A;  1KZO B;  5JPM B;  1HMW A;  1TNU B;  2WY8 A;  1X81 B;  4D94 A;  2WII B;  1JCQ B;  4V1R A;  3QRY A;  3WKF A;  1G6I A;  3E73 A;  3M76 A;  1W6K A;  1GHQ A;  1HM3 A;  3G4D A;  3RSY A;  5DGQ A;  1HM2 A;  1N7O A;  2JJB A;  3EQA A;  2B39 A;  3SDT A;  3WKG A;  1D8D B;  1TNZ B;  1IS9 A;  3S4D A;  4C1S A;  4ZRP A;  3K11 A;  5EAU A;  1WZZ A;  2AHG A;  5CD2 A;  1QAZ A;  3ACT A;  3KLS A;  3E37 B;  2FV0 A;  4CE7 A;  2XWB B;  3Q7F B;  2NVP A;  4KKI A;  1H54 A;  1N95 B;  3ANJ A;  4GTS B;  3M74 A;  3W7T A;  1HZF A;  2EAD A;  1OJO A;  4AYR A;  3DPY B;  3N0G A;  4YCR A;  5EAT A;  1N7P A;  5GW7 A;  1N1B A;  1O79 A;  1AGM A;  3VSM A;  1FBW A;  3Q73 B;  4MMH A;  1QSJ A;  3REN A;  2WY7 A;  2H6I B;  3C72 B;  1RWF A;  2DRS A;  5ILJ A;  3HXC B;  1G87 A;  1GSZ A;  1F1S A;  1LOH A;  1H3A A;  1JCR B;  4MMI A;  3HXF B;  4YDE B;  3D3I A;  2CQS A;  4BOK A;  1H39 A;  5ILZ A;  3D5S A;  5DGR A;  1O6H A;  1FT1 B;  3W7U A;  3OXU A;  5C05 A;  1N22 A;  3ON6 A;  2ZZR A;  2JF4 A;  1KSC A;  1F9G A;  1J0M A;  1O1T B;  2XQW A;  5JPN B;  1H13 A;  1TN8 B;  3M7L A;  3SDU A;  3GZK A;  4FXK B;  1CEM A;  4KTR A;  1NXC A;  4LNB B;  4V1S A;  4Q2B A;  1N4R B;  1QQF A;  4GL3 A;  2DRO A;  1GXN A;  1X1I A;  3LZ9 A;  3KSL B;  3M73 A;  3Q75 B;  4OK4 A;  3QSP A;  5AGD A;  1W6J A;  3N0F A;  2BRW A;  5E2J A;  1DL2 A;  2PN5 A;  4GTM B;  4CJ0 A;  4DOE A;  1KFG A;  3RX7 A;  2V3P A;  2V8J A;  2Q1F A;  3ANI A;  4JJJ A;  1WU6 A;  2I07 B;  4YDO B;  2F0Y B;  3CU7 A;  3QT9 A;  3M7B A;  2VN7 A;  3EU8 A;  1LXM A;  5M7Y A;  4GAX A;  4GTT B;  4MBG B;  1FCE A;  2FUQ A;  1OJP A;  3WIQ A;  5JMF A;  1JCS B;  1RWH A;  2Z07 A;  2BB5 A;  5FO8 B;  3PYA A;  1DCE B;  1KRE A;  1FBO A;  1G9J A;  1FT2 B;  3EU5 B;  3HXB B;  1HMU A;  5IKH A;  1NC5 A;  1NL4 B;  1LD8 B;  3PZ4 B;  3PZ3 B;  2G0D A;  5CZL A;  4F10 A;  5CA3 A;  3S4C A;  1TF4 A;  3QDE A;  3E80 A;  2H6F B;  2XFG A;  3E32 B;  3M78 A;  1RWG A;  1UMP A;  3WIR A;  2BRP A;  1L1Y A;  1R76 A;  4EHM B;  3M71 A;  3PZ1 B;  5ILY A;  2DRR A;  5IL8 A;  3SDV A;  4BOJ A;  3SDQ A;  1N1Z A;  3SFY B;  3X17 A;  4DOD A;  1GAI A;  1HXA A;  2AHF A;  3SAE A;  4WVB A;  5FO7 B;  4Z4J A;  2FV1 A;  4L9P B;  1FAE A;  1FO2 A;  3M7E A;  3WUX A;  1TN6 B;  1D8E B;  3E30 B;  5ILI A;  1FO3 A;  2XWJ B;  3CIH A;  4Z4L A;  1O6R A;  3P5R A;  3WC3 A;  1OJM A;  2GH4 A;  4OZW A;  3E6U A;  2H6H B;  3H3K A;  1H37 A;  1FMI A;  3VSN A;  5MEH A;  3SFX B;  1ULV A;  4QT9 A;  1H14 A;  4FUS A;  2H6G B;  4LNG B;  1OJN A;  1UT9 A;  1F9O A;  4ZG8 A;  4GTR B;  1X9D A;  1NI1 B;  3KSQ B;  3DSW B;  1N94 B;  2WIN B;  2B4F A;  3TF4 A;  1RWA A;  1RWC A;  2ZIR B;  4Q88 A;  3HXE B;  1SA4 B;  3HXD B;  2ONH A;  4TF4 A;  3S4A A;  1N7Q A;  4D4A A;  1KZP B;  1C82 A;  1I8Q A;  1N4P B;  2FUZ A;  4RNQ A;  2WCO A;  1H3B A;  3T33 A;  1N7N A;  3S4B A;  1TNY B;  3DSX B;  2QNO A;  3QFZ A;  3S9V A;  1KWF A;  2R2L B;  3GT5 A;  1HN0 A;  4MU9 A;  2A8Z A;  2D8L A;  4TXT A;  5IL3 A;  2EAB A;  3QXF A;  2GZ6 A;  1LTX B;  4D4C A;  3QT3 A;  3KQ4 A;  4D4B A;  1WU4 A;  1LF9 A;  4GTP B;  4ZH1 A;  4CJ1 A;  2V3N A;  1HXC A;  2X03 A;  5ILD A;  4L6X A;  5IK6 A;  4J5T A;  4ONT A;  1IA7 A;  1H36 A;  4GTQ B;  3WIW A;  3RRS A;  3ANK A;  4LIX A;  1O5M B;  2YIK A;  1GLM A;  1XWT A;  1MZC B;  1LD7 B;  3QPF A;  2EAC A;  5M7I A;  3W7X A;  1O1R B;  3OED A;  1HCU A;  1EGU A;  5ILH A;  3WKH A;  1KKT A;  2ZBL A;  3W5N A;  2ONG A;  1XWQ A;  3NFV A;  4FJQ A;  2V8I A;  4L0G A;  1L2A A;  1VD5 A;  1AYX A;  1F9D A;  2PMV A;  5DHI A;  1N4Q B;  5EAS A;  3M00 A;  5FO9 B;  3QWT A;  1K72 A;  2FBA A;  4WVC A;  1N20 A;  3H7L A;  1G9G A;  1N23 A;  4DI5 A;  3SDR A;  3PYB A;  1KS8 A;  1HX9 A;  2AFA A;  2VN4 A;  3RX8 A;  2JG0 A;  1X1H A;  1HV6 A; 
#chains in the Genus database with same CATH homology
 3EUV B;  3M77 A;  1V7X A;  2BB6 A;  1S64 B;  3EZ8 A;  3W7S A;  3WKI A;  2BED B;  2G02 A;  1C3D A;  3RX5 A;  2BBC A;  3AFJ A;  4KKJ A;  3D5R A;  3SQC A;  5FOB B;  5GY3 A;  5GZK A;  1GAH A;  4LNV A;  1TNO B;  3QFY A;  3P2C A;  1V5C A;  3DSS B;  1SQC A;  4ZRQ A;  1N9A B;  2WYN A;  2ZIS B;  2RGK A;  1V5D A;  3K7X A;  2OKX A;  1IA6 A;  1WU5 A;  4AYQ A;  1FPP B;  2EAE A;  3W7W A;  3GLY A;  3W5M A;  3PMM A;  3G6J B;  3A3V A;  5KKB A;  1QBQ B;  4WU0 A;  1JS4 A;  4FXG B;  4AYO A;  1O1S B;  1XW2 A;  3P5P A;  2DRQ A;  4M76 A;  4KTP A;  2RI8 A;  4AYP A;  3H2W A;  1O6Q A;  3DSU B;  3Q78 B;  1H3C A;  3ACS A;  3Q79 B;  1CLC A;  2P0V A;  3M7C A;  3QXQ A;  2RI9 A;  3DRA B;  3Q7A B;  4XUV A;  4GTV B;  3DST B;  1GXM A;  1SA5 B;  1H35 A;  1S63 B;  3M75 A;  1KSD A;  2D5J A;  1V7W A;  2V8K A;  1UG9 A;  1TNB B;  2IEJ B;  3M72 A;  2SQC A;  4ZH5 A;  1DOG A;  3PZ2 B;  3E33 B;  2GOX A;  1KRF A;  1N4S B;  2F6D A;  2CQT A;  1H12 A;  3VW5 A;  1RQ5 A;  1FP3 A;  2NOJ A;  1GA2 A;  4GTO B;  2A73 B;  3DSV B;  1LF6 A;  3VXD A;  1V7V A;  3QG0 A;  4D4D A;  4WVA A;  1TN7 B;  3RJ3 A;  1GXO A;  3E34 B;  4EL8 A;  1KZO B;  5JPM B;  1TNU B;  2WY8 A;  1X81 B;  4D94 A;  2WII B;  1JCQ B;  4V1R A;  3QRY A;  3WKF A;  1G6I A;  3E73 A;  3M76 A;  1W6K A;  1GHQ A;  3RSY A;  5DGQ A;  2JJB A;  3EQA A;  2B39 A;  3SDT A;  3WKG A;  1D8D B;  1TNZ B;  1IS9 A;  3S4D A;  4C1S A;  4ZRP A;  3K11 A;  1WZZ A;  2AHG A;  5CD2 A;  3ACT A;  3KLS A;  3E37 B;  2FV0 A;  4CE7 A;  2XWB B;  3Q7F B;  2NVP A;  4KKI A;  1H54 A;  1N95 B;  3ANJ A;  4GTS B;  3M74 A;  3W7T A;  1HZF A;  2EAD A;  4AYR A;  3DPY B;  4YCR A;  5GW7 A;  1O79 A;  1AGM A;  1FBW A;  3Q73 B;  1QSJ A;  3REN A;  2WY7 A;  2H6I B;  3C72 B;  2DRS A;  3HXC B;  1G87 A;  1GSZ A;  1H3A A;  1JCR B;  3HXF B;  4YDE B;  3D3I A;  2CQS A;  4BOK A;  1H39 A;  3D5S A;  5DGR A;  1O6H A;  1FT1 B;  3W7U A;  3OXU A;  3ON6 A;  2ZZR A;  2JF4 A;  1KSC A;  1O1T B;  2XQW A;  5JPN B;  1H13 A;  1TN8 B;  3M7L A;  3SDU A;  3GZK A;  4FXK B;  1CEM A;  4KTR A;  1NXC A;  4LNB B;  4V1S A;  4Q2B A;  1N4R B;  1QQF A;  4GL3 A;  2DRO A;  1GXN A;  3KSL B;  3M73 A;  3Q75 B;  3QSP A;  5AGD A;  1W6J A;  5E2J A;  1DL2 A;  2PN5 A;  4GTM B;  4CJ0 A;  4DOE A;  1KFG A;  3RX7 A;  2V3P A;  2V8J A;  3ANI A;  4JJJ A;  1WU6 A;  2I07 B;  4YDO B;  2F0Y B;  3CU7 A;  3QT9 A;  3M7B A;  2VN7 A;  3EU8 A;  5M7Y A;  4GTT B;  4MBG B;  1FCE A;  3WIQ A;  1JCS B;  2Z07 A;  2BB5 A;  5FO8 B;  3PYA A;  1DCE B;  1KRE A;  1FBO A;  1G9J A;  1FT2 B;  3EU5 B;  3HXB B;  1NC5 A;  1NL4 B;  1LD8 B;  3PZ4 B;  3PZ3 B;  2G0D A;  5CZL A;  5CA3 A;  3S4C A;  1TF4 A;  3QDE A;  2H6F B;  2XFG A;  3E32 B;  3M78 A;  1UMP A;  3WIR A;  1L1Y A;  1R76 A;  4EHM B;  3M71 A;  3PZ1 B;  2DRR A;  3SDV A;  4BOJ A;  3SDQ A;  3SFY B;  3X17 A;  4DOD A;  1GAI A;  2AHF A;  3SAE A;  4WVB A;  5FO7 B;  4Z4J A;  2FV1 A;  4L9P B;  1FAE A;  1FO2 A;  3M7E A;  3WUX A;  1TN6 B;  1D8E B;  3E30 B;  1FO3 A;  2XWJ B;  3CIH A;  4Z4L A;  1O6R A;  3P5R A;  3WC3 A;  2GH4 A;  3E6U A;  2H6H B;  3H3K A;  1H37 A;  1FMI A;  5MEH A;  3SFX B;  1ULV A;  4QT9 A;  1H14 A;  4FUS A;  2H6G B;  4LNG B;  1UT9 A;  1F9O A;  4ZG8 A;  4GTR B;  1X9D A;  1NI1 B;  3KSQ B;  3DSW B;  1N94 B;  2WIN B;  2B4F A;  3TF4 A;  2ZIR B;  4Q88 A;  3HXE B;  1SA4 B;  3HXD B;  4TF4 A;  3S4A A;  4D4A A;  1KZP B;  1N4P B;  2FUZ A;  1H3B A;  3T33 A;  3S4B A;  1TNY B;  3DSX B;  2QNO A;  3QFZ A;  3S9V A;  1KWF A;  2R2L B;  3GT5 A;  4MU9 A;  2A8Z A;  2D8L A;  4TXT A;  2EAB A;  3QXF A;  2GZ6 A;  1LTX B;  4D4C A;  3QT3 A;  3KQ4 A;  4D4B A;  1WU4 A;  1LF9 A;  4GTP B;  4ZH1 A;  4CJ1 A;  2V3N A;  4L6X A;  4J5T A;  4ONT A;  1IA7 A;  1H36 A;  4GTQ B;  3WIW A;  3RRS A;  3ANK A;  4LIX A;  1O5M B;  2YIK A;  1GLM A;  1XWT A;  1MZC B;  1LD7 B;  3QPF A;  2EAC A;  5M7I A;  3W7X A;  1O1R B;  3OED A;  1HCU A;  3WKH A;  1KKT A;  2ZBL A;  3W5N A;  1XWQ A;  2V8I A;  4L0G A;  1L2A A;  1VD5 A;  1AYX A;  1F9D A;  2PMV A;  1N4Q B;  5FO9 B;  3QWT A;  1K72 A;  2FBA A;  4WVC A;  3H7L A;  1G9G A;  3SDR A;  3PYB A;  1KS8 A;  2AFA A;  2VN4 A;  3RX8 A;  2JG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...