1GHQA

Cr2-c3d complex structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
MLDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPSDHQELNLDVSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein receptor
molecule keywords COMPLEMENT C3
publication title Structure of complement receptor 2 in complex with its C3d ligand.
pubmed doi rcsb
total genus 116
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ghqA00
1LD8B 1N95B 1UMPA 2PN5A 3C72B 5FOBB 2H6IB 3DSVB 3HXEB 1NL4B 3E32B 1O6HA 4GTOB 1JCRB 4C1SA 3SQCA 2H6HB 5JPNB 4ZRPA 1D8DB 2IEJB 3Q73B 4D4BA 1O1SB 1H3CA 3PZ1B 4ZH1A 3HXFB 3OEDA 1S63B 4LNBB 1H3BA 2WINB 4D4DA 4GTVB 1KZPB 3KSQB 3DSWB 1O79A 1TNUB 2I07B 3Q78B 4LNGB 1O5MB 4M76A 1QBQB 1TN6B 2WY8A 4GTSB 3KSLB 2BEDB 4EHMB 1GXOA 4MU9A 3HXBB 1N4SB 1H37A 1GSZA 2V8KA 2G02A 3DSUB 1O6QA 4L9PB 2WIIB 1H39A 4KKJA 1HZFA 3OXUA 4ONTA 1X81B 1KZOB 1O1TB 2XWBB 3HXCB 3EU5B 3DSTB 1TN7B 1TNYB 1R76A 2BB5A 2NOJA 4GTTB 1SA4B 4LNVA 2V3PA 3PZ2B 4V1SA 1TNZB 2ZISB 3PZ3B 1C3DA 3CU7A 4BOJA 1DCEB 1TNOB 1SQCA 1S64B 4YDEB 1GXNA 2V8JA 5JPMB 3SFXB 1GXMA 2WY7A 1MZCB 3DRAB 3G6JB 2G0DA 2BBCA 1O1RB 1D8EB 1JCQB 1W6JA 1W6KA 3Q79B 3E37B 3D5SA 3DSSB 5FO8B 1QQFA 5AGDA 4D94A 1LD7B 2R2LB 3E30B 4BOKA 1NI1B 1N94B 3EUVB 3RJ3A 4FXGB 2XQWA 3HXDB 2H6GB 1SA5B 2GOXA 1O6RA 1FT2B 1N9AB 2F0YB 2PMVA 3PZ4B 1FT1B 4FXKB 4GTMB 1H36A 4D4CA 5FO9B 3Q7FB 4D4AA 3Q75B 1N4RB 2XWJB 2ZIRB 4ZRQA 2BB6A 3K7XA 3E33B 3D5RA 1N4QB 3KQ4A 4GTPB 1H35A 2A73B 4YDOB 4GTRB 2B39A 1TN8B 3DPYB 3E34B 3Q7AB 1LTXB 4V1RA 4MBGB 1N4PB 5FO7B 1QSJA 1H3AA 1GHQA 1FPPB 1TNBB 3SFYB 2V3NA 2SQCA 4KKIA 2V8IA 3DSXB 4GTQB 3KLSA 1JCSB 2H6FB
chains in the Genus database with same CATH superfamily
1LD8B 1KREA 2PN5A 3WKIA 3W7SA 3K11A 1WU6A 3DSVB 3QFYA 1G9GA 1CLCA 2QNOA 4DI5A 3ANJA 1O6HA 4GTOB 1IA7A 4C1SA 2DROA 1RQ5A 4FNVA 4TF4A 4ZRPA 1H3CA 1KS8A 5IK6A 3OEDA 3A0OA 4Q2BA 1H3BA 4D4DA 1CB8A 3DSWB 3Q78B 4AYOA 4M76A 1KKTA 1QBQB 3S4BA 3G4DA 1TN6B 2WY8A 4J5TA 4L6XA 5EATA 5M7YA 2V8KA 1O6QA 3OXUA 2ZZRA 3ACSA 1X81B 1O1TB 2XWBB 2D8LA 3W7XA 3W7UA 1IA6A 2BRWA 1TNYB 2RGKA 1R76A 2BB5A 2Z07A 4LNVA 1SA4B 2V3PA 1C82A 1HMWA 4F13A 3CU7A 4BOJA 1TNOB 3PYAA 1W3YA 1HM2A 2NVPA 1N21A 3WKHA 1HM3A 3SDTA 1CEMA 2X03A 5DHIA 1X1JA 1D8EB 1JCQB 3RX5A 5KKBA 3QWTA 3M76A 5CZLA 4F10A 3D5SA 3S4AA 3TF4A 5AGDA 3RX8A 3SDQA 3NNBA 4OZVA 2R2LB 4BOKA 2XFGA 3E7JA 5CA3A 3M73A 3QPFA 2H6GB 5DHKA 3ANKA 1N1ZA 1KRFA 2F0YB 1H36A 1OJPA 1KSDA 2P0VA 3M77A 2F6DA 4Z4LA 1N1BA 4ZRQA 2WDAA 1N4QB 2B4FA 2EADA 1UG9A 2AFAA 1GAHA 4GTPB 2A73B 3D3IA 5ILDA 1L1YA 1N7OA 1NXCA 5ILYA 2B39A 3DPYB 3M74A 2FUZA 1WZZA 1LTXB 3E80A 5FO7B 2GZ6A 1GHQA 1RWHA 3VXDA 1V7XA 4ZG8A 3WC3A 2FBAA 2FUTA 5IM1A 3M7EA 3M02A 1J0MA 1JCSB 3P5PA 3C72B 5FOBB 1GAIA 3X17A 3HXEB 3EQAA 2Q1FA 3SDRA 3PMMA 1FBOA 4OK2A 3GZKA 3SQCA 2ZBLA 5C05A 1O1SB 4ZH1A 1KWFA 3GT5A 3ANIA 3RSYA 2WINB 1XWTA 1N22A 1RWCA 3SAEA 2I07B 3AFJA 4LNGB 1V7WA 3M7CA 4EHMB 2BEDB 4WU0A 3HXBB 1GSZA 1N7QA 2G02A 1H39A 4KKJA 4L0GA 4OK4A 1EGUA 3PYBA 3S4DA 1KZOB 1N7NA 3EU5B 3QG0A 5EAUA 2RI9A 3VW5A 1HV6A 3PZ2B 4V1SA 1RWGA 1TNZB 2BRVX 2GH4A 2J5CA 2ZISB 5IKHA 3PZ3B 1C3DA 4JJJA 1DCEB 1F9DA 3M71A 1WU4A 1S64B 4YDEB 1GXNA 2V8JA 1HXAA 5JPMB 1FCEA 2AHGA 3SFXB 1GXMA 3WUXA 1MZCB 2OKXA 2FV0A 3WKGA 3S4CA 3P2CA 2E24A 3QT9A 1WU5A 2FUQA 2EAEA 4FJQA 5FO8B 2ONGA 1UT9A 2A8ZA 2WCOA 3RJ3A 1V5CA 1N24A 3HXDB 2VN4A 1LOHA 3G4FA 1FT2B 4OJZA 1N9AB 3M75A 3WKFA 3M00A 4D4CA 4Z4JA 3Q7FB 5CD2A 1FO3A 3W5NA 1L2AA 1H54A 2ZIRB 5MEHA 2BB6A 3ON6A 1X1IA 3E33B 1VD5A 1X1HA 2BRPA 1G87A 2JJBA 4CJ1A 1LXMA 3RENA 3WIQA 3EU8A 3A3VA 1N4PB 5GY3A 1QSJA 4OZWA 2JG0A 3QSPA 1HMUA 2V3NA 1JS4A 2DRQA 2RI8A 1FAEA 3VSNA 3NFVA 5ILHA 2AHFA 1N95B 1X9DA 1UMPA 4GL3A 4WVBA 4CJ0A 1NL4B 1JCRB 3WIWA 1IS9A 3H2WA 3QFZA 1FP3A 2H6HB 3EZ8A 1D8DB 3ACTA 3Q73B 4QT9A 5GZKA 4CE7A 1AGMA 4EL8A 3HXFB 1S63B 4LNBB 1KZPB 3KSQB 1TNUB 1O5MB 4RNQA 3KSLB 1GXOA 3M72A 4MU9A 1H37A 4L9PB 4WVCA 1HX9A 1HZFA 4ONTA 3S9VA 3HXCB 1QAZA 3CIHA 4GTTB 1NC5A 1N20A 2WY7A 3DRAB 3W7WA 3G6JB 1N7PA 1LF9A 1O1RB 1W6JA 1I8QA 3E37B 5DGQA 1GA2A 1V7VA 3DSSB 5IK9A 2EACA 1GLMA 4DODA 1LD7B 3N0FA 4KTRA 3E30B 1NI1B 5IL8A 4ZH5A 1N94B 3EUVB 3QRYA 3QXFA 4MMIA 1SA5B 1F9GA 1O6RA 2CQSA 2FV1A 1F1SA 1FT1B 1G6IA 3LZ9A 4D4AA 3Q75B 1OJOA 3QT3A 3M7BA 4GAXA 2WYNA 1F9OA 3K7XA 1H14A 1N23A 2E22A 1RW9A 3W5MA 5EASA 5M7IA 2VN7A 4V1RA 1XWQA 4MBGB 1HN0A 4MMHA 3P5RA 1G9JA 3SFYB 1V5DA 3RX7A 4KKIA 5ILKA 3DSXB 2DRSA 3M01A 1LXKA 3KLSA 2YIKA 2H6FB 1OJNA 5JMDA 3H7LA 5DGRA 2H6IB 2EABA 1TF4A 5GW7A 1HXCA 3E32B 5JPNB 5IK0A 3M78A 2IEJB 4D4BA 1FBWA 3PZ1B 1FO2A 1HXGA 3AFLA 4GTVB 1XW2A 4FUSA 1O79A 3GLYA 5ILZA 1H12A 1HCUA 4GTSB 1LF6A 1H13A 1N4SB 3DSUB 2ONHA 2WIIB 3VSMA 4TXTA 3E73A 3H3KA 2D5JA 3DSTB 3SDUA 1TN7B 2NOJA 4Q88A 4YCRA 1DOGA 5IKAA 1SQCA 1KSCA 5IL3A 4XUVA 2G0DA 2BBCA 4AYQA 1W6KA 3Q79B 3QXQA 3T33A 2JF4A 4LIXA 3RRSA 1QQFA 4D94A 3W7TA 4FXGB 5ILJA 2XQWA 2GOXA 5JMFA 1AYXA 4FXKB 2PMVA 3PZ4B 4GTMB 4KTPA 5E2JA 5FO9B 4AYPA 1KFGA 1N4RB 2XWJB 1OJMA 1FMIA 3D5RA 2DRRA 1RWAA 3KQ4A 1RWFA 1H35A 1N7RA 3M7LA 3QDEA 4YDOB 4GTRB 3E34B 1TN8B 3Q7AB 3WIRA 3SDVA 1K72A 4WVAA 1DL2A 1H3AA 1FPPB 1TNBB 3N0GA 1J0NA 4AYRA 2SQCA 2V8IA 5ILIA 2CQTA 1ULVA 4GTQB 4NEIA 4E1YA 3E6UA 4DOEA
chains in the Genus database with same CATH topology
1LD8B 1KREA 2PN5A 3WKIA 3W7SA 3K11A 1WU6A 3DSVB 3QFYA 1G9GA 1CLCA 2QNOA 3ANJA 1O6HA 4GTOB 1IA7A 4C1SA 2DROA 1RQ5A 4TF4A 4ZRPA 1H3CA 1KS8A 3OEDA 4Q2BA 1H3BA 4D4DA 3DSWB 3Q78B 4AYOA 4M76A 1KKTA 1QBQB 3S4BA 4J5TA 1TN6B 2WY8A 4L6XA 5M7YA 2V8KA 1O6QA 3OXUA 2ZZRA 3ACSA 1X81B 1O1TB 2XWBB 2D8LA 3W7XA 3W7UA 1IA6A 1TNYB 2RGKA 1R76A 2BB5A 2Z07A 4LNVA 1SA4B 2V3PA 3CU7A 4BOJA 1TNOB 3PYAA 2NVPA 3WKHA 3SDTA 1CEMA 1D8EB 1JCQB 3RX5A 5KKBA 3QWTA 3M76A 5CZLA 3D5SA 3S4AA 3TF4A 5AGDA 3RX8A 3SDQA 2R2LB 4BOKA 2XFGA 5CA3A 3M73A 3QPFA 2H6GB 3ANKA 1KRFA 2F0YB 1H36A 1KSDA 2P0VA 3M77A 2F6DA 4Z4LA 4ZRQA 1N4QB 2B4FA 2EADA 1UG9A 2AFAA 1GAHA 4GTPB 2A73B 3D3IA 1L1YA 1NXCA 2B39A 3DPYB 3M74A 2FUZA 1WZZA 1LTXB 5FO7B 2GZ6A 1GHQA 3VXDA 1V7XA 4ZG8A 3WC3A 2FBAA 3M7EA 1JCSB 3P5PA 3C72B 5FOBB 1GAIA 3X17A 3HXEB 3EQAA 3SDRA 3PMMA 1FBOA 3GZKA 3SQCA 2ZBLA 1O1SB 4ZH1A 1KWFA 3GT5A 3ANIA 3RSYA 2WINB 1XWTA 3SAEA 2I07B 3AFJA 4LNGB 1V7WA 3M7CA 4EHMB 2BEDB 4WU0A 3HXBB 1GSZA 2G02A 1H39A 4KKJA 4L0GA 3PYBA 3S4DA 1KZOB 3EU5B 3QG0A 2RI9A 3VW5A 3PZ2B 4V1SA 1TNZB 2GH4A 2ZISB 3PZ3B 1C3DA 4JJJA 1DCEB 1F9DA 3M71A 1WU4A 1S64B 4YDEB 1GXNA 2V8JA 5JPMB 1FCEA 2AHGA 3SFXB 1GXMA 3WUXA 1MZCB 2OKXA 2FV0A 3WKGA 3S4CA 3P2CA 3QT9A 1WU5A 2EAEA 5FO8B 1UT9A 2A8ZA 3RJ3A 1V5CA 3HXDB 2VN4A 1FT2B 1N9AB 3M75A 3WKFA 4D4CA 4Z4JA 3Q7FB 5CD2A 1FO3A 3W5NA 1L2AA 1H54A 2ZIRB 5MEHA 2BB6A 3ON6A 3E33B 1VD5A 1G87A 2JJBA 4CJ1A 3RENA 3WIQA 3EU8A 3A3VA 1N4PB 5GY3A 1QSJA 2JG0A 3QSPA 2V3NA 1JS4A 2DRQA 2RI8A 1FAEA 2AHFA 1N95B 1X9DA 1UMPA 4GL3A 4WVBA 4CJ0A 1NL4B 1JCRB 3WIWA 1IS9A 3H2WA 3QFZA 1FP3A 2H6HB 3EZ8A 1D8DB 3ACTA 3Q73B 4QT9A 5GZKA 4CE7A 1AGMA 4EL8A 3HXFB 1S63B 4LNBB 1KZPB 3KSQB 1TNUB 1O5MB 3KSLB 1GXOA 3M72A 4MU9A 1H37A 4L9PB 4WVCA 1HZFA 4ONTA 3S9VA 3HXCB 3CIHA 4GTTB 1NC5A 2WY7A 3DRAB 3W7WA 3G6JB 1LF9A 1O1RB 1W6JA 3E37B 5DGQA 1GA2A 1V7VA 3DSSB 2EACA 1GLMA 4DODA 1LD7B 4KTRA 3E30B 1NI1B 4ZH5A 1N94B 3EUVB 3QRYA 3QXFA 1SA5B 1O6RA 2CQSA 2FV1A 1FT1B 1G6IA 4D4AA 3Q75B 3QT3A 3M7BA 2WYNA 1F9OA 3K7XA 1H14A 3W5MA 5M7IA 2VN7A 4V1RA 1XWQA 4MBGB 3P5RA 1G9JA 3SFYB 1V5DA 3RX7A 4KKIA 3DSXB 2DRSA 3KLSA 2YIKA 2H6FB 3H7LA 5DGRA 2H6IB 2EABA 1TF4A 5GW7A 3E32B 5JPNB 3M78A 2IEJB 4D4BA 1FBWA 3PZ1B 1FO2A 4GTVB 1XW2A 4FUSA 1O79A 3GLYA 1H12A 1HCUA 4GTSB 1LF6A 1H13A 1N4SB 3DSUB 2WIIB 4TXTA 3E73A 3H3KA 2D5JA 3DSTB 3SDUA 1TN7B 2NOJA 4Q88A 4YCRA 1DOGA 1SQCA 1KSCA 4XUVA 2G0DA 2BBCA 4AYQA 1W6KA 3Q79B 3QXQA 3T33A 2JF4A 4LIXA 3RRSA 1QQFA 4D94A 3W7TA 4FXGB 2XQWA 2GOXA 1AYXA 4FXKB 2PMVA 3PZ4B 4GTMB 4KTPA 5E2JA 5FO9B 4AYPA 1KFGA 1N4RB 2XWJB 1FMIA 3D5RA 2DRRA 3KQ4A 1H35A 3M7LA 3QDEA 4YDOB 4GTRB 3E34B 1TN8B 3Q7AB 3WIRA 3SDVA 1K72A 4WVAA 1DL2A 1H3AA 1FPPB 1TNBB 4AYRA 2SQCA 2V8IA 2CQTA 1ULVA 4GTQB 3E6UA 4DOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LD8 B;  1N95 B;  1UMP A;  2PN5 A;  3C72 B;  5FOB B;  2H6I B;  3DSV B;  3HXE B;  1NL4 B;  3E32 B;  1O6H A;  4GTO B;  1JCR B;  4C1S A;  3SQC A;  2H6H B;  5JPN B;  4ZRP A;  1D8D B;  2IEJ B;  3Q73 B;  4D4B A;  1O1S B;  1H3C A;  3PZ1 B;  4ZH1 A;  3HXF B;  3OED A;  1S63 B;  4LNB B;  1H3B A;  2WIN B;  4D4D A;  4GTV B;  1KZP B;  3KSQ B;  3DSW B;  1O79 A;  1TNU B;  2I07 B;  3Q78 B;  4LNG B;  1O5M B;  4M76 A;  1QBQ B;  1TN6 B;  2WY8 A;  4GTS B;  3KSL B;  2BED B;  4EHM B;  1GXO A;  4MU9 A;  3HXB B;  1N4S B;  1H37 A;  1GSZ A;  2V8K A;  2G02 A;  3DSU B;  1O6Q A;  4L9P B;  2WII B;  1H39 A;  4KKJ A;  1HZF A;  3OXU A;  4ONT A;  1X81 B;  1KZO B;  1O1T B;  2XWB B;  3HXC B;  3EU5 B;  3DST B;  1TN7 B;  1TNY B;  1R76 A;  2BB5 A;  2NOJ A;  4GTT B;  1SA4 B;  4LNV A;  2V3P A;  3PZ2 B;  4V1S A;  1TNZ B;  2ZIS B;  3PZ3 B;  1C3D A;  3CU7 A;  4BOJ A;  1DCE B;  1TNO B;  1SQC A;  1S64 B;  4YDE B;  1GXN A;  2V8J A;  5JPM B;  3SFX B;  1GXM A;  2WY7 A;  1MZC B;  3DRA B;  3G6J B;  2G0D A;  2BBC A;  1O1R B;  1D8E B;  1JCQ B;  1W6J A;  1W6K A;  3Q79 B;  3E37 B;  3D5S A;  3DSS B;  5FO8 B;  1QQF A;  5AGD A;  4D94 A;  1LD7 B;  2R2L B;  3E30 B;  4BOK A;  1NI1 B;  1N94 B;  3EUV B;  3RJ3 A;  4FXG B;  2XQW A;  3HXD B;  2H6G B;  1SA5 B;  2GOX A;  1O6R A;  1FT2 B;  1N9A B;  2F0Y B;  2PMV A;  3PZ4 B;  1FT1 B;  4FXK B;  4GTM B;  1H36 A;  4D4C A;  5FO9 B;  3Q7F B;  4D4A A;  3Q75 B;  1N4R B;  2XWJ B;  2ZIR B;  4ZRQ A;  2BB6 A;  3K7X A;  3E33 B;  3D5R A;  1N4Q B;  3KQ4 A;  4GTP B;  1H35 A;  2A73 B;  4YDO B;  4GTR B;  2B39 A;  1TN8 B;  3DPY B;  3E34 B;  3Q7A B;  1LTX B;  4V1R A;  4MBG B;  1N4P B;  5FO7 B;  1QSJ A;  1H3A A;  1GHQ A;  1FPP B;  1TNB B;  3SFY B;  2V3N A;  2SQC A;  4KKI A;  2V8I A;  3DSX B;  4GTQ B;  3KLS A;  1JCS B;  2H6F B; 
#chains in the Genus database with same CATH topology
 1LD8 B;  1KRE A;  2PN5 A;  3WKI A;  3W7S A;  3K11 A;  1WU6 A;  3DSV B;  3QFY A;  1G9G A;  1CLC A;  2QNO A;  4DI5 A;  3ANJ A;  1O6H A;  4GTO B;  1IA7 A;  4C1S A;  2DRO A;  1RQ5 A;  4FNV A;  4TF4 A;  4ZRP A;  1H3C A;  1KS8 A;  5IK6 A;  3OED A;  3A0O A;  4Q2B A;  1H3B A;  4D4D A;  1CB8 A;  3DSW B;  3Q78 B;  4AYO A;  4M76 A;  1KKT A;  1QBQ B;  3S4B A;  3G4D A;  1TN6 B;  2WY8 A;  4J5T A;  4L6X A;  5EAT A;  5M7Y A;  2V8K A;  1O6Q A;  3OXU A;  2ZZR A;  3ACS A;  1X81 B;  1O1T B;  2XWB B;  2D8L A;  3W7X A;  3W7U A;  1IA6 A;  2BRW A;  1TNY B;  2RGK A;  1R76 A;  2BB5 A;  2Z07 A;  4LNV A;  1SA4 B;  2V3P A;  1C82 A;  1HMW A;  4F13 A;  3CU7 A;  4BOJ A;  1TNO B;  3PYA A;  1W3Y A;  1HM2 A;  2NVP A;  1N21 A;  3WKH A;  1HM3 A;  3SDT A;  1CEM A;  2X03 A;  5DHI A;  1X1J A;  1D8E B;  1JCQ B;  3RX5 A;  5KKB A;  3QWT A;  3M76 A;  5CZL A;  4F10 A;  3D5S A;  3S4A A;  3TF4 A;  5AGD A;  3RX8 A;  3SDQ A;  3NNB A;  4OZV A;  2R2L B;  4BOK A;  2XFG A;  3E7J A;  5CA3 A;  3M73 A;  3QPF A;  2H6G B;  5DHK A;  3ANK A;  1N1Z A;  1KRF A;  2F0Y B;  1H36 A;  1OJP A;  1KSD A;  2P0V A;  3M77 A;  2F6D A;  4Z4L A;  1N1B A;  4ZRQ A;  2WDA A;  1N4Q B;  2B4F A;  2EAD A;  1UG9 A;  2AFA A;  1GAH A;  4GTP B;  2A73 B;  3D3I A;  5ILD A;  1L1Y A;  1N7O A;  1NXC A;  5ILY A;  2B39 A;  3DPY B;  3M74 A;  2FUZ A;  1WZZ A;  1LTX B;  3E80 A;  5FO7 B;  2GZ6 A;  1GHQ A;  1RWH A;  3VXD A;  1V7X A;  4ZG8 A;  3WC3 A;  2FBA A;  2FUT A;  5IM1 A;  3M7E A;  3M02 A;  1J0M A;  1JCS B;  3P5P A;  3C72 B;  5FOB B;  1GAI A;  3X17 A;  3HXE B;  3EQA A;  2Q1F A;  3SDR A;  3PMM A;  1FBO A;  4OK2 A;  3GZK A;  3SQC A;  2ZBL A;  5C05 A;  1O1S B;  4ZH1 A;  1KWF A;  3GT5 A;  3ANI A;  3RSY A;  2WIN B;  1XWT A;  1N22 A;  1RWC A;  3SAE A;  2I07 B;  3AFJ A;  4LNG B;  1V7W A;  3M7C A;  4EHM B;  2BED B;  4WU0 A;  3HXB B;  1GSZ A;  1N7Q A;  2G02 A;  1H39 A;  4KKJ A;  4L0G A;  4OK4 A;  1EGU A;  3PYB A;  3S4D A;  1KZO B;  1N7N A;  3EU5 B;  3QG0 A;  5EAU A;  2RI9 A;  3VW5 A;  1HV6 A;  3PZ2 B;  4V1S A;  1RWG A;  1TNZ B;  2BRV X;  2GH4 A;  2J5C A;  2ZIS B;  5IKH A;  3PZ3 B;  1C3D A;  4JJJ A;  1DCE B;  1F9D A;  3M71 A;  1WU4 A;  1S64 B;  4YDE B;  1GXN A;  2V8J A;  1HXA A;  5JPM B;  1FCE A;  2AHG A;  3SFX B;  1GXM A;  3WUX A;  1MZC B;  2OKX A;  2FV0 A;  3WKG A;  3S4C A;  3P2C A;  2E24 A;  3QT9 A;  1WU5 A;  2FUQ A;  2EAE A;  4FJQ A;  5FO8 B;  2ONG A;  1UT9 A;  2A8Z A;  2WCO A;  3RJ3 A;  1V5C A;  1N24 A;  3HXD B;  2VN4 A;  1LOH A;  3G4F A;  1FT2 B;  4OJZ A;  1N9A B;  3M75 A;  3WKF A;  3M00 A;  4D4C A;  4Z4J A;  3Q7F B;  5CD2 A;  1FO3 A;  3W5N A;  1L2A A;  1H54 A;  2ZIR B;  5MEH A;  2BB6 A;  3ON6 A;  1X1I A;  3E33 B;  1VD5 A;  1X1H A;  2BRP A;  1G87 A;  2JJB A;  4CJ1 A;  1LXM A;  3REN A;  3WIQ A;  3EU8 A;  3A3V A;  1N4P B;  5GY3 A;  1QSJ A;  4OZW A;  2JG0 A;  3QSP A;  1HMU A;  2V3N A;  1JS4 A;  2DRQ A;  2RI8 A;  1FAE A;  3VSN A;  3NFV A;  5ILH A;  2AHF A;  1N95 B;  1X9D A;  1UMP A;  4GL3 A;  4WVB A;  4CJ0 A;  1NL4 B;  1JCR B;  3WIW A;  1IS9 A;  3H2W A;  3QFZ A;  1FP3 A;  2H6H B;  3EZ8 A;  1D8D B;  3ACT A;  3Q73 B;  4QT9 A;  5GZK A;  4CE7 A;  1AGM A;  4EL8 A;  3HXF B;  1S63 B;  4LNB B;  1KZP B;  3KSQ B;  1TNU B;  1O5M B;  4RNQ A;  3KSL B;  1GXO A;  3M72 A;  4MU9 A;  1H37 A;  4L9P B;  4WVC A;  1HX9 A;  1HZF A;  4ONT A;  3S9V A;  3HXC B;  1QAZ A;  3CIH A;  4GTT B;  1NC5 A;  1N20 A;  2WY7 A;  3DRA B;  3W7W A;  3G6J B;  1N7P A;  1LF9 A;  1O1R B;  1W6J A;  1I8Q A;  3E37 B;  5DGQ A;  1GA2 A;  1V7V A;  3DSS B;  5IK9 A;  2EAC A;  1GLM A;  4DOD A;  1LD7 B;  3N0F A;  4KTR A;  3E30 B;  1NI1 B;  5IL8 A;  4ZH5 A;  1N94 B;  3EUV B;  3QRY A;  3QXF A;  4MMI A;  1SA5 B;  1F9G A;  1O6R A;  2CQS A;  2FV1 A;  1F1S A;  1FT1 B;  1G6I A;  3LZ9 A;  4D4A A;  3Q75 B;  1OJO A;  3QT3 A;  3M7B A;  4GAX A;  2WYN A;  1F9O A;  3K7X A;  1H14 A;  1N23 A;  2E22 A;  1RW9 A;  3W5M A;  5EAS A;  5M7I A;  2VN7 A;  4V1R A;  1XWQ A;  4MBG B;  1HN0 A;  4MMH A;  3P5R A;  1G9J A;  3SFY B;  1V5D A;  3RX7 A;  4KKI A;  5ILK A;  3DSX B;  2DRS A;  3M01 A;  1LXK A;  3KLS A;  2YIK A;  2H6F B;  1OJN A;  5JMD A;  3H7L A;  5DGR A;  2H6I B;  2EAB A;  1TF4 A;  5GW7 A;  1HXC A;  3E32 B;  5JPN B;  5IK0 A;  3M78 A;  2IEJ B;  4D4B A;  1FBW A;  3PZ1 B;  1FO2 A;  1HXG A;  3AFL A;  4GTV B;  1XW2 A;  4FUS A;  1O79 A;  3GLY A;  5ILZ A;  1H12 A;  1HCU A;  4GTS B;  1LF6 A;  1H13 A;  1N4S B;  3DSU B;  2ONH A;  2WII B;  3VSM A;  4TXT A;  3E73 A;  3H3K A;  2D5J A;  3DST B;  3SDU A;  1TN7 B;  2NOJ A;  4Q88 A;  4YCR A;  1DOG A;  5IKA A;  1SQC A;  1KSC A;  5IL3 A;  4XUV A;  2G0D A;  2BBC A;  4AYQ A;  1W6K A;  3Q79 B;  3QXQ A;  3T33 A;  2JF4 A;  4LIX A;  3RRS A;  1QQF A;  4D94 A;  3W7T A;  4FXG B;  5ILJ A;  2XQW A;  2GOX A;  5JMF A;  1AYX A;  4FXK B;  2PMV A;  3PZ4 B;  4GTM B;  4KTP A;  5E2J A;  5FO9 B;  4AYP A;  1KFG A;  1N4R B;  2XWJ B;  1OJM A;  1FMI A;  3D5R A;  2DRR A;  1RWA A;  3KQ4 A;  1RWF A;  1H35 A;  1N7R A;  3M7L A;  3QDE A;  4YDO B;  4GTR B;  3E34 B;  1TN8 B;  3Q7A B;  3WIR A;  3SDV A;  1K72 A;  4WVA A;  1DL2 A;  1H3A A;  1FPP B;  1TNB B;  3N0G A;  1J0N A;  4AYR A;  2SQC A;  2V8I A;  5ILI A;  2CQT A;  1ULV A;  4GTQ B;  4NEI A;  4E1Y A;  3E6U A;  4DOE A; 
#chains in the Genus database with same CATH homology
 1LD8 B;  1KRE A;  2PN5 A;  3WKI A;  3W7S A;  3K11 A;  1WU6 A;  3DSV B;  3QFY A;  1G9G A;  1CLC A;  2QNO A;  3ANJ A;  1O6H A;  4GTO B;  1IA7 A;  4C1S A;  2DRO A;  1RQ5 A;  4TF4 A;  4ZRP A;  1H3C A;  1KS8 A;  3OED A;  4Q2B A;  1H3B A;  4D4D A;  3DSW B;  3Q78 B;  4AYO A;  4M76 A;  1KKT A;  1QBQ B;  3S4B A;  4J5T A;  1TN6 B;  2WY8 A;  4L6X A;  5M7Y A;  2V8K A;  1O6Q A;  3OXU A;  2ZZR A;  3ACS A;  1X81 B;  1O1T B;  2XWB B;  2D8L A;  3W7X A;  3W7U A;  1IA6 A;  1TNY B;  2RGK A;  1R76 A;  2BB5 A;  2Z07 A;  4LNV A;  1SA4 B;  2V3P A;  3CU7 A;  4BOJ A;  1TNO B;  3PYA A;  2NVP A;  3WKH A;  3SDT A;  1CEM A;  1D8E B;  1JCQ B;  3RX5 A;  5KKB A;  3QWT A;  3M76 A;  5CZL A;  3D5S A;  3S4A A;  3TF4 A;  5AGD A;  3RX8 A;  3SDQ A;  2R2L B;  4BOK A;  2XFG A;  5CA3 A;  3M73 A;  3QPF A;  2H6G B;  3ANK A;  1KRF A;  2F0Y B;  1H36 A;  1KSD A;  2P0V A;  3M77 A;  2F6D A;  4Z4L A;  4ZRQ A;  1N4Q B;  2B4F A;  2EAD A;  1UG9 A;  2AFA A;  1GAH A;  4GTP B;  2A73 B;  3D3I A;  1L1Y A;  1NXC A;  2B39 A;  3DPY B;  3M74 A;  2FUZ A;  1WZZ A;  1LTX B;  5FO7 B;  2GZ6 A;  1GHQ A;  3VXD A;  1V7X A;  4ZG8 A;  3WC3 A;  2FBA A;  3M7E A;  1JCS B;  3P5P A;  3C72 B;  5FOB B;  1GAI A;  3X17 A;  3HXE B;  3EQA A;  3SDR A;  3PMM A;  1FBO A;  3GZK A;  3SQC A;  2ZBL A;  1O1S B;  4ZH1 A;  1KWF A;  3GT5 A;  3ANI A;  3RSY A;  2WIN B;  1XWT A;  3SAE A;  2I07 B;  3AFJ A;  4LNG B;  1V7W A;  3M7C A;  4EHM B;  2BED B;  4WU0 A;  3HXB B;  1GSZ A;  2G02 A;  1H39 A;  4KKJ A;  4L0G A;  3PYB A;  3S4D A;  1KZO B;  3EU5 B;  3QG0 A;  2RI9 A;  3VW5 A;  3PZ2 B;  4V1S A;  1TNZ B;  2GH4 A;  2ZIS B;  3PZ3 B;  1C3D A;  4JJJ A;  1DCE B;  1F9D A;  3M71 A;  1WU4 A;  1S64 B;  4YDE B;  1GXN A;  2V8J A;  5JPM B;  1FCE A;  2AHG A;  3SFX B;  1GXM A;  3WUX A;  1MZC B;  2OKX A;  2FV0 A;  3WKG A;  3S4C A;  3P2C A;  3QT9 A;  1WU5 A;  2EAE A;  5FO8 B;  1UT9 A;  2A8Z A;  3RJ3 A;  1V5C A;  3HXD B;  2VN4 A;  1FT2 B;  1N9A B;  3M75 A;  3WKF A;  4D4C A;  4Z4J A;  3Q7F B;  5CD2 A;  1FO3 A;  3W5N A;  1L2A A;  1H54 A;  2ZIR B;  5MEH A;  2BB6 A;  3ON6 A;  3E33 B;  1VD5 A;  1G87 A;  2JJB A;  4CJ1 A;  3REN A;  3WIQ A;  3EU8 A;  3A3V A;  1N4P B;  5GY3 A;  1QSJ A;  2JG0 A;  3QSP A;  2V3N A;  1JS4 A;  2DRQ A;  2RI8 A;  1FAE A;  2AHF A;  1N95 B;  1X9D A;  1UMP A;  4GL3 A;  4WVB A;  4CJ0 A;  1NL4 B;  1JCR B;  3WIW A;  1IS9 A;  3H2W A;  3QFZ A;  1FP3 A;  2H6H B;  3EZ8 A;  1D8D B;  3ACT A;  3Q73 B;  4QT9 A;  5GZK A;  4CE7 A;  1AGM A;  4EL8 A;  3HXF B;  1S63 B;  4LNB B;  1KZP B;  3KSQ B;  1TNU B;  1O5M B;  3KSL B;  1GXO A;  3M72 A;  4MU9 A;  1H37 A;  4L9P B;  4WVC A;  1HZF A;  4ONT A;  3S9V A;  3HXC B;  3CIH A;  4GTT B;  1NC5 A;  2WY7 A;  3DRA B;  3W7W A;  3G6J B;  1LF9 A;  1O1R B;  1W6J A;  3E37 B;  5DGQ A;  1GA2 A;  1V7V A;  3DSS B;  2EAC A;  1GLM A;  4DOD A;  1LD7 B;  4KTR A;  3E30 B;  1NI1 B;  4ZH5 A;  1N94 B;  3EUV B;  3QRY A;  3QXF A;  1SA5 B;  1O6R A;  2CQS A;  2FV1 A;  1FT1 B;  1G6I A;  4D4A A;  3Q75 B;  3QT3 A;  3M7B A;  2WYN A;  1F9O A;  3K7X A;  1H14 A;  3W5M A;  5M7I A;  2VN7 A;  4V1R A;  1XWQ A;  4MBG B;  3P5R A;  1G9J A;  3SFY B;  1V5D A;  3RX7 A;  4KKI A;  3DSX B;  2DRS A;  3KLS A;  2YIK A;  2H6F B;  3H7L A;  5DGR A;  2H6I B;  2EAB A;  1TF4 A;  5GW7 A;  3E32 B;  5JPN B;  3M78 A;  2IEJ B;  4D4B A;  1FBW A;  3PZ1 B;  1FO2 A;  4GTV B;  1XW2 A;  4FUS A;  1O79 A;  3GLY A;  1H12 A;  1HCU A;  4GTS B;  1LF6 A;  1H13 A;  1N4S B;  3DSU B;  2WII B;  4TXT A;  3E73 A;  3H3K A;  2D5J A;  3DST B;  3SDU A;  1TN7 B;  2NOJ A;  4Q88 A;  4YCR A;  1DOG A;  1SQC A;  1KSC A;  4XUV A;  2G0D A;  2BBC A;  4AYQ A;  1W6K A;  3Q79 B;  3QXQ A;  3T33 A;  2JF4 A;  4LIX A;  3RRS A;  1QQF A;  4D94 A;  3W7T A;  4FXG B;  2XQW A;  2GOX A;  1AYX A;  4FXK B;  2PMV A;  3PZ4 B;  4GTM B;  4KTP A;  5E2J A;  5FO9 B;  4AYP A;  1KFG A;  1N4R B;  2XWJ B;  1FMI A;  3D5R A;  2DRR A;  3KQ4 A;  1H35 A;  3M7L A;  3QDE A;  4YDO B;  4GTR B;  3E34 B;  1TN8 B;  3Q7A B;  3WIR A;  3SDV A;  1K72 A;  4WVA A;  1DL2 A;  1H3A A;  1FPP B;  1TNB B;  4AYR A;  2SQC A;  2V8I A;  2CQT A;  1ULV A;  4GTQ B;  3E6U A;  4DOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...