1GHQA

Cr2-c3d complex structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
307
structure length
307
Chain Sequence
b'MLDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPSDHQELNLDVSLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C3
publication title Structure of complement receptor 2 in complex with its C3d ligand.
pubmed doi rcsb
molecule tags Immune system/viral protein receptor
total genus 116
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1ghqA00
2BBCA 1N95B 1TNZB 4MU9A 2F0YB 3DSVB 2V3NA 3DPYB 5AGDA 1JCQB 3E33B 3CU7A 4GTTB 1TNYB 1GXMA 3EUVB 3DRAB 4YDOB 4GTQB 4ONTA 1LTXB 2I07B 4FXKB 1FT2B 2WY8A 4L9PB 4V1RA 3DSSB 1LD8B 4D4BA 4EHMB 2A73B 4KKJA 2XQWA 2V8JA 4ZRPA 4GTPB 4BOKA 3G6JB 3DSUB 1NL4B 1TNOB 5FO8B 1C3DA 2BB6A 3E30B 1N4QB 4ZRQA 1D8DB 3PZ4B 1D8EB 4C1SA 3E34B 4KKIA 2H6GB 4MBGB 1GXNA 4GTVB 3KSLB 2XWJB 3OEDA 1FT1B 1TN7B 3HXCB 1O79A 2BB5A 1HZFA 1TNUB 1O1TB 2ZISB 3KQ4A 1DCEB 3HXFB 2XWBB 1H35A 3EU5B 4GTRB 1LD7B 4LNVA 3Q79B 3OXUA 2BEDB 1H3CA 1QSJA 3E37B 1O6HA 1H3BA 3DSTB 1O1RB 3Q7AB 1GHQA 4D94A 3SFYB 2SQCA 4D4CA 1MZCB 2G0DA 4V1SA 4ZH1A 3Q75B 1SA5B 1O1SB 2PN5A 3KSQB 3D5SA 4YDEB 1SA4B 4GTSB 1O5MB 1X81B 1NI1B 1GXOA 2V8KA 2H6HB 1TN8B 2H6FB 3Q7FB 2H6IB 3PZ1B 4D4DA 4GTMB 1H36A 1FPPB 1TNBB 2WINB 1H3AA 2ZIRB 3HXEB 1O6RA 5JPMB 2NOJA 3C72B 3E32B 1JCSB 3SFXB 5FO9B 5FO7B 2B39A 3D5RA 1N94B 4D4AA 1S63B 1N4RB 5JPNB 3HXBB 3DSWB 1JCRB 1UMPA 2IEJB 2WIIB 3PZ3B 3PZ2B 5FOBB 4LNGB 1H39A 3HXDB 1GSZA 2WY7A 1KZOB 4LNBB 2V8IA 1R76A 1S64B 1N4PB 3KLSA 4M76A 1TN6B 1W6KA 4FXGB 3RJ3A 2PMVA 3DSXB 1O6QA 4BOJA 3Q73B 3Q78B 2GOXA 4GTOB 2V3PA 3K7XA 1N9AB 1QBQB 2G02A 1QQFA 3SQCA 1KZPB 2R2LB 1N4SB 1SQCA 1W6JA 1H37A
chains in the Genus database with same CATH superfamily
1N7PA 4AYRA 2F0YB 2XFGA 3RX7A 5DHKA 1JCQB 1FBWA 2F6DA 1G6IA 4FXKB 1FT2B 1UG9A 2X03A 3M7LA 3SAEA 3M7EA 1LD8B 2E24A 4AYPA 5M7IA 4KKJA 2XQWA 2V8JA 4F10A 1RWAA 3P5RA 4GTPB 4AYQA 4YCRA 1G9JA 3DSUB 5IK6A 4OK4A 3TF4A 3S4CA 2BRVX 1N22A 1X1JA 1GXNA 4CJ1A 1KREA 2XWJB 5GZKA 2VN7A 2RGKA 1LF6A 3KQ4A 4E1YA 1H13A 3M72A 3WIQA 1X1IA 4AYOA 3E37B 1O6HA 1O1RB 2RI9A 4D94A 3SFYB 1MZCB 3X17A 3PYAA 5IK0A 5CD2A 3KSQB 4YDEB 4OJZA 1J0NA 1NI1B 3WIWA 2JJBA 4KTRA 5CZLA 3SDRA 2WCOA 3WKFA 4D4DA 1FPPB 3RENA 2BRPA 5JPMB 2NOJA 3C72B 3EQAA 5FO7B 4RNQA 4EL8A 1HN0A 3QFYA 1JCRB 1HM2A 2WIIB 3PZ2B 5JMFA 2JG0A 5FOBB 1LXKA 1H39A 2WY7A 1R76A 4NEIA 1S64B 1KRFA 1TN6B 1W6KA 3ACTA 1IS9A 1DOGA 3QXQA 2B4FA 2PMVA 4FNVA 2V3PA 4DI5A 1HV6A 1QBQB 4OZVA 3RRSA 1OJNA 3QXFA 1SQCA 1W6JA 1H37A 5ILYA 2BBCA 4MU9A 2V3NA 3DPYB 1KWFA 1N1ZA 3CU7A 2ONHA 5EAUA 1TNYB 3G4DA 3EUVB 1H14A 1G9GA 3QG0A 1RWGA 1V7WA 4V1RA 3DSSB 1GA2A 2RI8A 4D4BA 5C05A 4ZRPA 3WUXA 3G6JB 1NL4B 1TNOB 2FUQA 2WYNA 3QSPA 1C3DA 3E30B 1D8DB 3W7SA 1RW9A 3PZ4B 1D8EB 1N1BA 3E34B 2YIKA 4C1SA 2QNOA 4TXTA 1XWTA 4WVAA 3N0FA 5EASA 3ACSA 2FUZA 4Q88A 1TN7B 1O79A 3SDTA 1N7OA 3WC3A 4OZWA 3HXFB 2XWBB 3WKGA 3OXUA 2BEDB 1H3CA 1QSJA 1ULVA 1RWHA 1HXCA 1GHQA 3QT3A 2SQCA 3QPFA 4OK2A 1L2AA 2DRQA 2G0DA 4V1SA 2D5JA 1NC5A 3D5SA 3A0OA 4GTSB 2NVPA 4WVBA 3M7BA 2FUTA 1TN8B 3M00A 3PYBA 3PZ1B 2BRWA 2EACA 2WINB 2ZIRB 5E2JA 2DRSA 3E32B 1OJMA 5DGRA 3SFXB 5FO9B 5KKBA 1WU4A 4D4AA 2AHGA 2IEJB 1TF4A 2ZBLA 1RWCA 5IL8A 1GSZA 4TF4A 1KZOB 4FJQA 1IA6A 5M7YA 1X9DA 5ILDA 1OJOA 1V5DA 1FP3A 1K72A 4BOJA 3Q78B 2GOXA 1N20A 4KTPA 3K7XA 2FV1A 3E6UA 3NFVA 3W7WA 2G02A 1J0MA 3ANIA 2EAEA 2CQSA 2J5CA 1QQFA 1KZPB 1GAIA 1N95B 1TNZB 4GAXA 3E73A 3DSVB 1CEMA 3E33B 3ON6A 3M76A 3WKHA 4ONTA 1LTXB 2I07B 3AFLA 2WY8A 4CE7A 4L9PB 1C82A 1LOHA 3VXDA 4EHMB 2A73B 1HXAA 4BOKA 3VSNA 1FO3A 3T33A 3M71A 1FMIA 1N4QB 1N7QA 4QT9A 4ZRQA 3S9VA 1UT9A 1GAHA 4KKIA 1N7RA 1H54A 3KSLB 3W5MA 3OEDA 3K11A 1N7NA 1RQ5A 3A3VA 3HXCB 2BB5A 1HZFA 1TNUB 1V5CA 5JMDA 2Q1FA 2ZISB 1DCEB 5ILZA 4GTRB 1WU6A 3EU5B 4LNVA 1KKTA 3Q79B 1I8QA 3SDVA 3CIHA 3DSTB 1H3BA 1CB8A 3W7TA 3Q7AB 1AYXA 3WKIA 2GH4A 1F1SA 4ZH1A 5DHIA 1SA5B 2PN5A 3GZKA 3E80A 2A8ZA 1SA4B 3NNBA 1X81B 1HMWA 2WDAA 5IKHA 1GXOA 2V8KA 3Q7FB 4MMIA 5DGQA 1TNBB 3HXEB 1O6RA 3EU8A 3M77A 1F9GA 3S4DA 3W7UA 3ANKA 3M02A 3SDUA 1WU5A 1N4RB 1W3YA 3PZ3B 1WZZA 1UMPA 1RWFA 5EATA 3P2CA 5ILIA 3N0GA 1VD5A 3H7LA 4LNGB 5MEHA 3HXDB 1KSDA 2V8IA 3VW5A 1N4PB 4M76A 2OKXA 1N24A 5GW7A 3LZ9A 4FXGB 1CLCA 1V7VA 1N21A 3RX8A 3DSXB 4XUVA 4Q2BA 1EGUA 1F9OA 3H2WA 3SQCA 2CQTA 1O5MB 3M73A 2Z07A 2DRRA 4ZG8A 2GZ6A 3ANJA 5AGDA 4MMHA 2FBAA 4GTTB 2EADA 1GXMA 3DRAB 4YDOB 3QWTA 4GTQB 1LXMA 4Z4LA 4LIXA 1NXCA 1F9DA 1DL2A 3P5PA 4L6XA 3QT9A 1HXGA 2D8LA 5FO8B 1KS8A 2BB6A 4WU0A 4GL3A 1V7XA 1N23A 2H6GB 4MBGB 5IM1A 4GTVB 3M01A 1FCEA 2FV0A 1FT1B 3W7XA 2ONGA 3PMMA 4FUSA 1O1TB 4JJJA 3W5NA 3M7CA 4L0GA 3M74A 3M78A 1H35A 1H12A 5IL3A 1LD7B 2P0VA 1GLMA 2EABA 5ILKA 1L1YA 1KFGA 3AFJA 2DROA 3RSYA 4D4CA 3QDEA 3M75A 3Q75B 3VSMA 3S4AA 1O1SB 2AFAA 2JF4A 1HMUA 1FO2A 5ILHA 3H3KA 5CA3A 1LF9A 1FBOA 2H6HB 2H6FB 1HX9A 2VN4A 3GT5A 2H6IB 4GTMB 1H36A 1H3AA 2AHFA 1AGMA 2E22A 3EZ8A 3D3IA 4DODA 5IKAA 1JCSB 5GY3A 1IA7A 3RX5A 4ZH5A 3QRYA 2B39A 3D5RA 1N94B 1XW2A 1S63B 5JPNB 4DOEA 3HXBB 3GLYA 3DSWB 1HCUA 4F13A 5ILJA 1FAEA 3QFZA 4LNBB 4J5TA 3SDQA 1HM3A 1QAZA 1OJPA 3RJ3A 4WVCA 1G87A 4Z4JA 1O6QA 3Q73B 4CJ0A 4GTOB 3WIRA 1KSCA 1JS4A 1N9AB 3S4BA 1X1HA 2R2LB 1N4SB 3G4FA 5IK9A 3KLSA 2ZZRA 3E7JA 1XWQA
chains in the Genus database with same CATH topology
4AYRA 2F0YB 2XFGA 3RX7A 1JCQB 1FBWA 2F6DA 1G6IA 4FXKB 1FT2B 1UG9A 3M7LA 3SAEA 3M7EA 1LD8B 5M7IA 4AYPA 4KKJA 2XQWA 2V8JA 3P5RA 4GTPB 4AYQA 4YCRA 1G9JA 3DSUB 3TF4A 3S4CA 1GXNA 4CJ1A 1KREA 2XWJB 5GZKA 2VN7A 2RGKA 1LF6A 3KQ4A 1H13A 3M72A 3WIQA 4AYOA 3E37B 1O6HA 1O1RB 2RI9A 4D94A 3SFYB 1MZCB 3X17A 3PYAA 5CD2A 3KSQB 4YDEB 1NI1B 3WIWA 2JJBA 4KTRA 5CZLA 3SDRA 3WKFA 4D4DA 1FPPB 3RENA 5JPMB 2NOJA 3C72B 3EQAA 5FO7B 4EL8A 3QFYA 1JCRB 3PZ2B 2WIIB 2JG0A 5FOBB 1H39A 2WY7A 1R76A 1S64B 1KRFA 1TN6B 1W6KA 3ACTA 1IS9A 1DOGA 3QXQA 2B4FA 2PMVA 2V3PA 1QBQB 3RRSA 3QXFA 1SQCA 1W6JA 1H37A 2BBCA 4MU9A 2V3NA 3DPYB 1KWFA 3CU7A 1TNYB 3EUVB 1H14A 1G9GA 3QG0A 1V7WA 4V1RA 3DSSB 1GA2A 2RI8A 4D4BA 4ZRPA 3WUXA 3G6JB 1NL4B 1TNOB 2WYNA 3QSPA 1C3DA 3E30B 1D8DB 3W7SA 3PZ4B 1D8EB 4C1SA 3E34B 2YIKA 2QNOA 4TXTA 1XWTA 4WVAA 3ACSA 2FUZA 4Q88A 1TN7B 1O79A 3SDTA 3WC3A 3HXFB 2XWBB 3WKGA 3OXUA 2BEDB 1H3CA 1QSJA 1ULVA 1GHQA 3QT3A 2SQCA 3QPFA 1L2AA 2DRQA 2G0DA 4V1SA 2D5JA 1NC5A 3D5SA 2NVPA 4GTSB 4WVBA 3M7BA 1TN8B 3PYBA 3PZ1B 2EACA 2WINB 2ZIRB 5E2JA 2DRSA 3E32B 5DGRA 3SFXB 5FO9B 5KKBA 1WU4A 4D4AA 2AHGA 2IEJB 1TF4A 2ZBLA 1GSZA 4TF4A 1KZOB 1IA6A 5M7YA 1X9DA 1V5DA 1FP3A 1K72A 4BOJA 3Q78B 2GOXA 4KTPA 3K7XA 2FV1A 3E6UA 3W7WA 2G02A 3ANIA 2EAEA 2CQSA 1QQFA 1KZPB 1GAIA 1N95B 1TNZB 3E73A 3DSVB 1CEMA 3E33B 3ON6A 3M76A 3WKHA 4ONTA 1LTXB 2I07B 2WY8A 4CE7A 4L9PB 3VXDA 4EHMB 2A73B 4BOKA 1FO3A 3T33A 3M71A 1FMIA 1N4QB 4QT9A 4ZRQA 3S9VA 1UT9A 1GAHA 4KKIA 1H54A 3KSLB 3W5MA 3OEDA 3K11A 1RQ5A 3A3VA 3HXCB 2BB5A 1HZFA 1TNUB 1V5CA 2ZISB 1DCEB 4GTRB 1WU6A 3EU5B 4LNVA 1KKTA 3Q79B 3SDVA 3CIHA 1H3BA 3DSTB 3W7TA 3Q7AB 1AYXA 3WKIA 2GH4A 4ZH1A 1SA5B 2PN5A 3GZKA 2A8ZA 1SA4B 1X81B 1GXOA 2V8KA 3Q7FB 5DGQA 1TNBB 3HXEB 1O6RA 3EU8A 3M77A 3S4DA 3W7UA 3ANKA 3SDUA 1WU5A 1N4RB 3PZ3B 1WZZA 1UMPA 3P2CA 1VD5A 3H7LA 4LNGB 5MEHA 3HXDB 1KSDA 2V8IA 3VW5A 1N4PB 4M76A 2OKXA 5GW7A 4FXGB 1CLCA 1V7VA 3RX8A 3DSXB 4XUVA 4Q2BA 1F9OA 3H2WA 3SQCA 2CQTA 1O5MB 3M73A 2Z07A 2DRRA 4ZG8A 2GZ6A 3ANJA 5AGDA 2FBAA 4GTTB 2EADA 1GXMA 3DRAB 4YDOB 3QWTA 4GTQB 4Z4LA 4LIXA 1NXCA 1F9DA 1DL2A 3P5PA 4L6XA 3QT9A 2D8LA 5FO8B 1KS8A 2BB6A 4WU0A 4GL3A 1V7XA 2H6GB 4MBGB 4GTVB 1FCEA 2FV0A 1FT1B 3W7XA 3PMMA 4FUSA 1O1TB 4JJJA 3W5NA 3M7CA 4L0GA 3M74A 3M78A 1H35A 1H12A 1LD7B 2P0VA 1GLMA 2EABA 1L1YA 1KFGA 3AFJA 2DROA 3RSYA 4D4CA 3QDEA 3M75A 3Q75B 3S4AA 1O1SB 2AFAA 2JF4A 1FO2A 3H3KA 5CA3A 1LF9A 1FBOA 2H6HB 2H6FB 2VN4A 3GT5A 2H6IB 4GTMB 1H36A 1H3AA 2AHFA 1AGMA 3EZ8A 3D3IA 4DODA 1JCSB 5GY3A 1IA7A 3RX5A 4ZH5A 3QRYA 2B39A 3D5RA 1N94B 1XW2A 1S63B 5JPNB 4DOEA 3HXBB 3GLYA 3DSWB 1HCUA 1FAEA 3QFZA 4LNBB 4J5TA 3SDQA 3RJ3A 4WVCA 1G87A 4Z4JA 1O6QA 3Q73B 4CJ0A 4GTOB 3WIRA 1KSCA 1JS4A 1N9AB 3S4BA 2R2LB 1N4SB 3KLSA 2ZZRA 1XWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBC A;  1N95 B;  1TNZ B;  4MU9 A;  2F0Y B;  3DSV B;  2V3N A;  3DPY B;  5AGD A;  1JCQ B;  3E33 B;  3CU7 A;  4GTT B;  1TNY B;  1GXM A;  3EUV B;  3DRA B;  4YDO B;  4GTQ B;  4ONT A;  1LTX B;  2I07 B;  4FXK B;  1FT2 B;  2WY8 A;  4L9P B;  4V1R A;  3DSS B;  1LD8 B;  4D4B A;  4EHM B;  2A73 B;  4KKJ A;  2XQW A;  2V8J A;  4ZRP A;  4GTP B;  4BOK A;  3G6J B;  3DSU B;  1NL4 B;  1TNO B;  5FO8 B;  1C3D A;  2BB6 A;  3E30 B;  1N4Q B;  4ZRQ A;  1D8D B;  3PZ4 B;  1D8E B;  4C1S A;  3E34 B;  4KKI A;  2H6G B;  4MBG B;  1GXN A;  4GTV B;  3KSL B;  2XWJ B;  3OED A;  1FT1 B;  1TN7 B;  3HXC B;  1O79 A;  2BB5 A;  1HZF A;  1TNU B;  1O1T B;  2ZIS B;  3KQ4 A;  1DCE B;  3HXF B;  2XWB B;  1H35 A;  3EU5 B;  4GTR B;  1LD7 B;  4LNV A;  3Q79 B;  3OXU A;  2BED B;  1H3C A;  1QSJ A;  3E37 B;  1O6H A;  1H3B A;  3DST B;  1O1R B;  3Q7A B;  1GHQ A;  4D94 A;  3SFY B;  2SQC A;  4D4C A;  1MZC B;  2G0D A;  4V1S A;  4ZH1 A;  3Q75 B;  1SA5 B;  1O1S B;  2PN5 A;  3KSQ B;  3D5S A;  4YDE B;  1SA4 B;  4GTS B;  1O5M B;  1X81 B;  1NI1 B;  1GXO A;  2V8K A;  2H6H B;  1TN8 B;  2H6F B;  3Q7F B;  2H6I B;  3PZ1 B;  4D4D A;  4GTM B;  1H36 A;  1FPP B;  1TNB B;  2WIN B;  1H3A A;  2ZIR B;  3HXE B;  1O6R A;  5JPM B;  2NOJ A;  3C72 B;  3E32 B;  1JCS B;  3SFX B;  5FO9 B;  5FO7 B;  2B39 A;  3D5R A;  1N94 B;  4D4A A;  1S63 B;  1N4R B;  5JPN B;  3HXB B;  3DSW B;  1JCR B;  1UMP A;  2IEJ B;  2WII B;  3PZ3 B;  3PZ2 B;  5FOB B;  4LNG B;  1H39 A;  3HXD B;  1GSZ A;  2WY7 A;  1KZO B;  4LNB B;  2V8I A;  1R76 A;  1S64 B;  1N4P B;  3KLS A;  4M76 A;  1TN6 B;  1W6K A;  4FXG B;  3RJ3 A;  2PMV A;  3DSX B;  1O6Q A;  4BOJ A;  3Q73 B;  3Q78 B;  2GOX A;  4GTO B;  2V3P A;  3K7X A;  1N9A B;  1QBQ B;  2G02 A;  1QQF A;  3SQC A;  1KZP B;  2R2L B;  1N4S B;  1SQC A;  1W6J A;  1H37 A; 
#chains in the Genus database with same CATH topology
 1N7P A;  4AYR A;  2F0Y B;  2XFG A;  3RX7 A;  5DHK A;  1JCQ B;  1FBW A;  2F6D A;  1G6I A;  4FXK B;  1FT2 B;  1UG9 A;  2X03 A;  3M7L A;  3SAE A;  3M7E A;  1LD8 B;  2E24 A;  4AYP A;  5M7I A;  4KKJ A;  2XQW A;  2V8J A;  4F10 A;  1RWA A;  3P5R A;  4GTP B;  4AYQ A;  4YCR A;  1G9J A;  3DSU B;  5IK6 A;  4OK4 A;  3TF4 A;  3S4C A;  2BRV X;  1N22 A;  1X1J A;  1GXN A;  4CJ1 A;  1KRE A;  2XWJ B;  5GZK A;  2VN7 A;  2RGK A;  1LF6 A;  3KQ4 A;  4E1Y A;  1H13 A;  3M72 A;  3WIQ A;  1X1I A;  4AYO A;  3E37 B;  1O6H A;  1O1R B;  2RI9 A;  4D94 A;  3SFY B;  1MZC B;  3X17 A;  3PYA A;  5IK0 A;  5CD2 A;  3KSQ B;  4YDE B;  4OJZ A;  1J0N A;  1NI1 B;  3WIW A;  2JJB A;  4KTR A;  5CZL A;  3SDR A;  2WCO A;  3WKF A;  4D4D A;  1FPP B;  3REN A;  2BRP A;  5JPM B;  2NOJ A;  3C72 B;  3EQA A;  5FO7 B;  4RNQ A;  4EL8 A;  1HN0 A;  3QFY A;  1JCR B;  1HM2 A;  2WII B;  3PZ2 B;  5JMF A;  2JG0 A;  5FOB B;  1LXK A;  1H39 A;  2WY7 A;  1R76 A;  4NEI A;  1S64 B;  1KRF A;  1TN6 B;  1W6K A;  3ACT A;  1IS9 A;  1DOG A;  3QXQ A;  2B4F A;  2PMV A;  4FNV A;  2V3P A;  4DI5 A;  1HV6 A;  1QBQ B;  4OZV A;  3RRS A;  1OJN A;  3QXF A;  1SQC A;  1W6J A;  1H37 A;  5ILY A;  2BBC A;  4MU9 A;  2V3N A;  3DPY B;  1KWF A;  1N1Z A;  3CU7 A;  2ONH A;  5EAU A;  1TNY B;  3G4D A;  3EUV B;  1H14 A;  1G9G A;  3QG0 A;  1RWG A;  1V7W A;  4V1R A;  3DSS B;  1GA2 A;  2RI8 A;  4D4B A;  5C05 A;  4ZRP A;  3WUX A;  3G6J B;  1NL4 B;  1TNO B;  2FUQ A;  2WYN A;  3QSP A;  1C3D A;  3E30 B;  1D8D B;  3W7S A;  1RW9 A;  3PZ4 B;  1D8E B;  1N1B A;  3E34 B;  2YIK A;  4C1S A;  2QNO A;  4TXT A;  1XWT A;  4WVA A;  3N0F A;  5EAS A;  3ACS A;  2FUZ A;  4Q88 A;  1TN7 B;  1O79 A;  3SDT A;  1N7O A;  3WC3 A;  4OZW A;  3HXF B;  2XWB B;  3WKG A;  3OXU A;  2BED B;  1H3C A;  1QSJ A;  1ULV A;  1RWH A;  1HXC A;  1GHQ A;  3QT3 A;  2SQC A;  3QPF A;  4OK2 A;  1L2A A;  2DRQ A;  2G0D A;  4V1S A;  2D5J A;  1NC5 A;  3D5S A;  3A0O A;  4GTS B;  2NVP A;  4WVB A;  3M7B A;  2FUT A;  1TN8 B;  3M00 A;  3PYB A;  3PZ1 B;  2BRW A;  2EAC A;  2WIN B;  2ZIR B;  5E2J A;  2DRS A;  3E32 B;  1OJM A;  5DGR A;  3SFX B;  5FO9 B;  5KKB A;  1WU4 A;  4D4A A;  2AHG A;  2IEJ B;  1TF4 A;  2ZBL A;  1RWC A;  5IL8 A;  1GSZ A;  4TF4 A;  1KZO B;  4FJQ A;  1IA6 A;  5M7Y A;  1X9D A;  5ILD A;  1OJO A;  1V5D A;  1FP3 A;  1K72 A;  4BOJ A;  3Q78 B;  2GOX A;  1N20 A;  4KTP A;  3K7X A;  2FV1 A;  3E6U A;  3NFV A;  3W7W A;  2G02 A;  1J0M A;  3ANI A;  2EAE A;  2CQS A;  2J5C A;  1QQF A;  1KZP B;  1GAI A;  1N95 B;  1TNZ B;  4GAX A;  3E73 A;  3DSV B;  1CEM A;  3E33 B;  3ON6 A;  3M76 A;  3WKH A;  4ONT A;  1LTX B;  2I07 B;  3AFL A;  2WY8 A;  4CE7 A;  4L9P B;  1C82 A;  1LOH A;  3VXD A;  4EHM B;  2A73 B;  1HXA A;  4BOK A;  3VSN A;  1FO3 A;  3T33 A;  3M71 A;  1FMI A;  1N4Q B;  1N7Q A;  4QT9 A;  4ZRQ A;  3S9V A;  1UT9 A;  1GAH A;  4KKI A;  1N7R A;  1H54 A;  3KSL B;  3W5M A;  3OED A;  3K11 A;  1N7N A;  1RQ5 A;  3A3V A;  3HXC B;  2BB5 A;  1HZF A;  1TNU B;  1V5C A;  5JMD A;  2Q1F A;  2ZIS B;  1DCE B;  5ILZ A;  4GTR B;  1WU6 A;  3EU5 B;  4LNV A;  1KKT A;  3Q79 B;  1I8Q A;  3SDV A;  3CIH A;  3DST B;  1H3B A;  1CB8 A;  3W7T A;  3Q7A B;  1AYX A;  3WKI A;  2GH4 A;  1F1S A;  4ZH1 A;  5DHI A;  1SA5 B;  2PN5 A;  3GZK A;  3E80 A;  2A8Z A;  1SA4 B;  3NNB A;  1X81 B;  1HMW A;  2WDA A;  5IKH A;  1GXO A;  2V8K A;  3Q7F B;  4MMI A;  5DGQ A;  1TNB B;  3HXE B;  1O6R A;  3EU8 A;  3M77 A;  1F9G A;  3S4D A;  3W7U A;  3ANK A;  3M02 A;  3SDU A;  1WU5 A;  1N4R B;  1W3Y A;  3PZ3 B;  1WZZ A;  1UMP A;  1RWF A;  5EAT A;  3P2C A;  5ILI A;  3N0G A;  1VD5 A;  3H7L A;  4LNG B;  5MEH A;  3HXD B;  1KSD A;  2V8I A;  3VW5 A;  1N4P B;  4M76 A;  2OKX A;  1N24 A;  5GW7 A;  3LZ9 A;  4FXG B;  1CLC A;  1V7V A;  1N21 A;  3RX8 A;  3DSX B;  4XUV A;  4Q2B A;  1EGU A;  1F9O A;  3H2W A;  3SQC A;  2CQT A;  1O5M B;  3M73 A;  2Z07 A;  2DRR A;  4ZG8 A;  2GZ6 A;  3ANJ A;  5AGD A;  4MMH A;  2FBA A;  4GTT B;  2EAD A;  1GXM A;  3DRA B;  4YDO B;  3QWT A;  4GTQ B;  1LXM A;  4Z4L A;  4LIX A;  1NXC A;  1F9D A;  1DL2 A;  3P5P A;  4L6X A;  3QT9 A;  1HXG A;  2D8L A;  5FO8 B;  1KS8 A;  2BB6 A;  4WU0 A;  4GL3 A;  1V7X A;  1N23 A;  2H6G B;  4MBG B;  5IM1 A;  4GTV B;  3M01 A;  1FCE A;  2FV0 A;  1FT1 B;  3W7X A;  2ONG A;  3PMM A;  4FUS A;  1O1T B;  4JJJ A;  3W5N A;  3M7C A;  4L0G A;  3M74 A;  3M78 A;  1H35 A;  1H12 A;  5IL3 A;  1LD7 B;  2P0V A;  1GLM A;  2EAB A;  5ILK A;  1L1Y A;  1KFG A;  3AFJ A;  2DRO A;  3RSY A;  4D4C A;  3QDE A;  3M75 A;  3Q75 B;  3VSM A;  3S4A A;  1O1S B;  2AFA A;  2JF4 A;  1HMU A;  1FO2 A;  5ILH A;  3H3K A;  5CA3 A;  1LF9 A;  1FBO A;  2H6H B;  2H6F B;  1HX9 A;  2VN4 A;  3GT5 A;  2H6I B;  4GTM B;  1H36 A;  1H3A A;  2AHF A;  1AGM A;  2E22 A;  3EZ8 A;  3D3I A;  4DOD A;  5IKA A;  1JCS B;  5GY3 A;  1IA7 A;  3RX5 A;  4ZH5 A;  3QRY A;  2B39 A;  3D5R A;  1N94 B;  1XW2 A;  1S63 B;  5JPN B;  4DOE A;  3HXB B;  3GLY A;  3DSW B;  1HCU A;  4F13 A;  5ILJ A;  1FAE A;  3QFZ A;  4LNB B;  4J5T A;  3SDQ A;  1HM3 A;  1QAZ A;  1OJP A;  3RJ3 A;  4WVC A;  1G87 A;  4Z4J A;  1O6Q A;  3Q73 B;  4CJ0 A;  4GTO B;  3WIR A;  1KSC A;  1JS4 A;  1N9A B;  3S4B A;  1X1H A;  2R2L B;  1N4S B;  3G4F A;  5IK9 A;  3KLS A;  2ZZR A;  3E7J A;  1XWQ A; 
#chains in the Genus database with same CATH homology
 4AYR A;  2F0Y B;  2XFG A;  3RX7 A;  1JCQ B;  1FBW A;  2F6D A;  1G6I A;  4FXK B;  1FT2 B;  1UG9 A;  3M7L A;  3SAE A;  3M7E A;  1LD8 B;  5M7I A;  4AYP A;  4KKJ A;  2XQW A;  2V8J A;  3P5R A;  4GTP B;  4AYQ A;  4YCR A;  1G9J A;  3DSU B;  3TF4 A;  3S4C A;  1GXN A;  4CJ1 A;  1KRE A;  2XWJ B;  5GZK A;  2VN7 A;  2RGK A;  1LF6 A;  3KQ4 A;  1H13 A;  3M72 A;  3WIQ A;  4AYO A;  3E37 B;  1O6H A;  1O1R B;  2RI9 A;  4D94 A;  3SFY B;  1MZC B;  3X17 A;  3PYA A;  5CD2 A;  3KSQ B;  4YDE B;  1NI1 B;  3WIW A;  2JJB A;  4KTR A;  5CZL A;  3SDR A;  3WKF A;  4D4D A;  1FPP B;  3REN A;  5JPM B;  2NOJ A;  3C72 B;  3EQA A;  5FO7 B;  4EL8 A;  3QFY A;  1JCR B;  3PZ2 B;  2WII B;  2JG0 A;  5FOB B;  1H39 A;  2WY7 A;  1R76 A;  1S64 B;  1KRF A;  1TN6 B;  1W6K A;  3ACT A;  1IS9 A;  1DOG A;  3QXQ A;  2B4F A;  2PMV A;  2V3P A;  1QBQ B;  3RRS A;  3QXF A;  1SQC A;  1W6J A;  1H37 A;  2BBC A;  4MU9 A;  2V3N A;  3DPY B;  1KWF A;  3CU7 A;  1TNY B;  3EUV B;  1H14 A;  1G9G A;  3QG0 A;  1V7W A;  4V1R A;  3DSS B;  1GA2 A;  2RI8 A;  4D4B A;  4ZRP A;  3WUX A;  3G6J B;  1NL4 B;  1TNO B;  2WYN A;  3QSP A;  1C3D A;  3E30 B;  1D8D B;  3W7S A;  3PZ4 B;  1D8E B;  4C1S A;  3E34 B;  2YIK A;  2QNO A;  4TXT A;  1XWT A;  4WVA A;  3ACS A;  2FUZ A;  4Q88 A;  1TN7 B;  1O79 A;  3SDT A;  3WC3 A;  3HXF B;  2XWB B;  3WKG A;  3OXU A;  2BED B;  1H3C A;  1QSJ A;  1ULV A;  1GHQ A;  3QT3 A;  2SQC A;  3QPF A;  1L2A A;  2DRQ A;  2G0D A;  4V1S A;  2D5J A;  1NC5 A;  3D5S A;  2NVP A;  4GTS B;  4WVB A;  3M7B A;  1TN8 B;  3PYB A;  3PZ1 B;  2EAC A;  2WIN B;  2ZIR B;  5E2J A;  2DRS A;  3E32 B;  5DGR A;  3SFX B;  5FO9 B;  5KKB A;  1WU4 A;  4D4A A;  2AHG A;  2IEJ B;  1TF4 A;  2ZBL A;  1GSZ A;  4TF4 A;  1KZO B;  1IA6 A;  5M7Y A;  1X9D A;  1V5D A;  1FP3 A;  1K72 A;  4BOJ A;  3Q78 B;  2GOX A;  4KTP A;  3K7X A;  2FV1 A;  3E6U A;  3W7W A;  2G02 A;  3ANI A;  2EAE A;  2CQS A;  1QQF A;  1KZP B;  1GAI A;  1N95 B;  1TNZ B;  3E73 A;  3DSV B;  1CEM A;  3E33 B;  3ON6 A;  3M76 A;  3WKH A;  4ONT A;  1LTX B;  2I07 B;  2WY8 A;  4CE7 A;  4L9P B;  3VXD A;  4EHM B;  2A73 B;  4BOK A;  1FO3 A;  3T33 A;  3M71 A;  1FMI A;  1N4Q B;  4QT9 A;  4ZRQ A;  3S9V A;  1UT9 A;  1GAH A;  4KKI A;  1H54 A;  3KSL B;  3W5M A;  3OED A;  3K11 A;  1RQ5 A;  3A3V A;  3HXC B;  2BB5 A;  1HZF A;  1TNU B;  1V5C A;  2ZIS B;  1DCE B;  4GTR B;  1WU6 A;  3EU5 B;  4LNV A;  1KKT A;  3Q79 B;  3SDV A;  3CIH A;  1H3B A;  3DST B;  3W7T A;  3Q7A B;  1AYX A;  3WKI A;  2GH4 A;  4ZH1 A;  1SA5 B;  2PN5 A;  3GZK A;  2A8Z A;  1SA4 B;  1X81 B;  1GXO A;  2V8K A;  3Q7F B;  5DGQ A;  1TNB B;  3HXE B;  1O6R A;  3EU8 A;  3M77 A;  3S4D A;  3W7U A;  3ANK A;  3SDU A;  1WU5 A;  1N4R B;  3PZ3 B;  1WZZ A;  1UMP A;  3P2C A;  1VD5 A;  3H7L A;  4LNG B;  5MEH A;  3HXD B;  1KSD A;  2V8I A;  3VW5 A;  1N4P B;  4M76 A;  2OKX A;  5GW7 A;  4FXG B;  1CLC A;  1V7V A;  3RX8 A;  3DSX B;  4XUV A;  4Q2B A;  1F9O A;  3H2W A;  3SQC A;  2CQT A;  1O5M B;  3M73 A;  2Z07 A;  2DRR A;  4ZG8 A;  2GZ6 A;  3ANJ A;  5AGD A;  2FBA A;  4GTT B;  2EAD A;  1GXM A;  3DRA B;  4YDO B;  3QWT A;  4GTQ B;  4Z4L A;  4LIX A;  1NXC A;  1F9D A;  1DL2 A;  3P5P A;  4L6X A;  3QT9 A;  2D8L A;  5FO8 B;  1KS8 A;  2BB6 A;  4WU0 A;  4GL3 A;  1V7X A;  2H6G B;  4MBG B;  4GTV B;  1FCE A;  2FV0 A;  1FT1 B;  3W7X A;  3PMM A;  4FUS A;  1O1T B;  4JJJ A;  3W5N A;  3M7C A;  4L0G A;  3M74 A;  3M78 A;  1H35 A;  1H12 A;  1LD7 B;  2P0V A;  1GLM A;  2EAB A;  1L1Y A;  1KFG A;  3AFJ A;  2DRO A;  3RSY A;  4D4C A;  3QDE A;  3M75 A;  3Q75 B;  3S4A A;  1O1S B;  2AFA A;  2JF4 A;  1FO2 A;  3H3K A;  5CA3 A;  1LF9 A;  1FBO A;  2H6H B;  2H6F B;  2VN4 A;  3GT5 A;  2H6I B;  4GTM B;  1H36 A;  1H3A A;  2AHF A;  1AGM A;  3EZ8 A;  3D3I A;  4DOD A;  1JCS B;  5GY3 A;  1IA7 A;  3RX5 A;  4ZH5 A;  3QRY A;  2B39 A;  3D5R A;  1N94 B;  1XW2 A;  1S63 B;  5JPN B;  4DOE A;  3HXB B;  3GLY A;  3DSW B;  1HCU A;  1FAE A;  3QFZ A;  4LNB B;  4J5T A;  3SDQ A;  3RJ3 A;  4WVC A;  1G87 A;  4Z4J A;  1O6Q A;  3Q73 B;  4CJ0 A;  4GTO B;  3WIR A;  1KSC A;  1JS4 A;  1N9A B;  3S4B A;  2R2L B;  1N4S B;  3KLS A;  2ZZR A;  1XWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...