2WY8A

Staphylococcus aureus complement subversion protein sbi-iv in complex with complement fragment c3d
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
DAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords COMPLEMENT C3D FRAGMENT
publication title A Structural Basis for Staphylococcal Complement Subversion: X-Ray Structure of the Complement- Binding Domain of Staphylococcus Aureus Protein Sbi in Complex with Ligand C3D.
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2wy8A00
3D5RA 3DSXB 1JCSB 4GTPB 4V1RA 1TNZB 3PZ3B 1C3DA 4D94A 2H6FB 4MU9A 1N4RB 4LNGB 3C72B 5JPMB 1H3CA 4ZRPA 3DPYB 4M76A 3DRAB 1X81B 1QSJA 4FXKB 1MZCB 1D8EB 3DSSB 1LD7B 1SA4B 2R2LB 1KZOB 3DSUB 2WY8A 1H3BA 1W6KA 3K7XA 1H37A 3Q7AB 3HXBB 1N4QB 1JCQB 4LNVA 4GTTB 1LD8B 2BB5A 3SQCA 3Q7FB 3PZ4B 2WY7A 3E37B 4GTQB 3E30B 1R76A 3Q75B 2H6HB 3KSQB 4GTRB 4KKJA 1N9AB 1FT2B 3D5SA 1TN7B 2V8IA 2SQCA 1TN6B 1O1RB 4YDEB 1TNOB 3SFXB 1O6HA 3Q73B 4D4CA 2V3NA 1TNYB 2BEDB 1GHQA 1DCEB 1HZFA 1W6JA 3CU7A 1QQFA 4ONTA 2ZIRB 1NL4B 4KKIA 1GXOA 3EU5B 3HXFB 3E32B 1QBQB 4MBGB 1O1SB 5JPNB 1GSZA 1TNBB 3HXEB 4GTMB 1GXMA 4V1SA 1FPPB 1SQCA 4EHMB 4L9PB 3HXDB 1H39A 1O5MB 1O6QA 1N95B 2H6GB 2V8JA 1S64B 3EUVB 3OEDA 4D4DA 3G6JB 2G0DA 1FT1B 2BBCA 2PN5A 3E33B 3E34B 5FO7B 4BOKA 4D4BA 2ZISB 2A73B 5AGDA 4BOJA 2V8KA 1H3AA 1SA5B 3KQ4A 2F0YB 3DSWB 1O1TB 1UMPA 4YDOB 3Q79B 4ZRQA 2PMVA 3KSLB 2V3PA 4D4AA 2XQWA 1TNUB 3DSTB 1NI1B 3OXUA 5FO9B 1LTXB 2I07B 3Q78B 3PZ1B 1S63B 1N4SB 5FO8B 2IEJB 3HXCB 1N4PB 2XWBB 1H35A 2NOJA 1JCRB 4FXGB 4GTVB 1N94B 4ZH1A 2BB6A 2B39A 5FOBB 1KZPB 2WINB 1H36A 1TN8B 2H6IB 1D8DB 3KLSA 3SFYB 1O79A 1O6RA 4LNBB 3DSVB 4GTSB 2XWJB 4C1SA 1GXNA 2WIIB 3PZ2B 3RJ3A 2GOXA 2G02A 4GTOB
chains in the Genus database with same CATH superfamily
1JCSB 1HCUA 1TNZB 3QFYA 3VXDA 1C3DA 1N4RB 1OJOA 4KTPA 4LNGB 3SDVA 3QWTA 1H3CA 1RW9A 5IKHA 4M76A 5EASA 1X81B 1C82A 2WYNA 3DSSB 1SA4B 3M00A 4YCRA 1HN0A 3DSUB 1H3BA 3G4FA 1H37A 5ILYA 2FUTA 1N7OA 4WVCA 3M74A 3E37B 4GTQB 4AYQA 3Q75B 4Z4LA 3KSQB 4FNVA 4GTRB 5JMFA 1KWFA 5C05A 3VSMA 1GAHA 2JG0A 2SQCA 3T33A 3Q73B 3N0GA 2V3NA 1RQ5A 1H14A 5ILDA 1QQFA 2AHFA 2ZIRB 5EATA 4CJ1A 2Z07A 5M7IA 3RX5A 4MBGB 1O1SB 2CQSA 1GXMA 4L9PB 3VW5A 2H6GB 4DOEA 1AGMA 1S64B 3EUVB 3OEDA 3GLYA 4L0GA 3A3VA 3G6JB 2G0DA 1AYXA 1FT1B 2BBCA 1F9OA 2YIKA 5DHIA 3M77A 2A73B 1SA5B 2F0YB 3DSWB 4KTRA 1HMUA 4F13A 3Q79B 2PMVA 4D4AA 1HM2A 3QSPA 2XQWA 1TNUB 1NI1B 2BRWA 3OXUA 3RSYA 4XUVA 2FV1A 3SDUA 1I8QA 1FO3A 4GAXA 1WZZA 3W5MA 1JCRB 4FJQA 2E22A 4Q2BA 1L2AA 2B39A 3RX8A 3M73A 3ON6A 1W3YA 1TN8B 3QG0A 3KLSA 1O79A 1RWGA 1N23A 1UG9A 3DSVB 3QT3A 4AYOA 3G4DA 1GLMA 1GXNA 1RWHA 5JMDA 3M7EA 1JS4A 5GY3A 4GTOB 3QDEA 3PZ3B 4OK2A 4WVAA 4D94A 4MU9A 1XWQA 1X9DA 2WCOA 3DPYB 3RRSA 2JF4A 3ANJA 3WIWA 2GZ6A 5ILJA 3VSNA 1D8EB 2A8ZA 5DHKA 2R2LB 1KZOB 2WY8A 1W6KA 3AFLA 4AYRA 1XWTA 3SAEA 3M01A 4LNVA 1LD8B 1X1JA 3H7LA 2BB5A 3SQCA 1G87A 3Q7FB 3PZ4B 1KKTA 1N21A 5KKBA 1R76A 4RNQA 1G6IA 2WDAA 4KKJA 1N9AB 3D5SA 5ILIA 2V8IA 4YDEB 1O1RB 1O6HA 4WVBA 2BEDB 4WU0A 5DGQA 5IK6A 3CU7A 1RWAA 3M7LA 4Q88A 2AHGA 3EU5B 2OKXA 3N0FA 1FP3A 1HXAA 1QBQB 3E32B 4OZVA 1TNBB 1FBOA 3EQAA 1SQCA 5EAUA 3M75A 3PYBA 4OZWA 1N22A 5E2JA 1N1ZA 1HM3A 4D4DA 3H3KA 3AFJA 2PN5A 3LZ9A 2BRPA 1CLCA 3SDTA 2D5JA 4D4BA 2V8KA 5IM1A 1O1TB 1UMPA 4YDOB 4F10A 1KSDA 3KSLB 1KRFA 2NVPA 3DSTB 3NNBA 1OJNA 3QFZA 5FO9B 1LTXB 2DRQA 3QT9A 3PZ1B 1S63B 3EU8A 3HXCB 1N4PB 2XWBB 2NOJA 4CE7A 4FXGB 4GTVB 2FBAA 1HXCA 1KZPB 1XW2A 3W5NA 4JJJA 3SFYB 1H13A 1IS9A 4L6XA 4LNBB 4ZH5A 1V5DA 4C1SA 1RWFA 3P5RA 3PZ2B 3RJ3A 1TF4A 1F9DA 2RGKA 1HV6A 2VN4A 3DSXB 4GTPB 3W7UA 2BRVX 2Q1FA 2H6FB 3E7JA 2XFGA 3C72B 5JPMB 4LIXA 1ULVA 3M78A 1QSJA 4FXKB 5CD2A 3W7WA 1LD7B 2DRRA 1IA6A 3S9VA 3M7CA 3K7XA 3Q7AB 5CA3A 3WKGA 1DL2A 1VD5A 4ZG8A 3WIRA 1N7QA 4TF4A 3W7XA 4CJ0A 3PYAA 1KFGA 1WU4A 3QXFA 2FV0A 1F9GA 1HX9A 1X1HA 1HMWA 1TN7B 1TN6B 3SFXB 1TNOB 4D4CA 1G9JA 3D3IA 3PMMA 5CZLA 3ANKA 5ILHA 1DCEB 1GHQA 1W6JA 2EAEA 4MMHA 2ZZRA 2DRSA 2EACA 3M71A 1FBWA 4ONTA 1HXGA 3WC3A 3WUXA 1LF6A 1V5CA 3HXFB 2J5CA 1LXMA 1X1IA 1FMIA 2VN7A 2FUQA 3S4AA 5IL3A 3HXDB 4E1YA 1O5MB 5IK9A 1N95B 3M76A 3H2WA 3ACTA 3RX7A 3SDQA 2X03A 5GW7A 2ONGA 3WKHA 2D8LA 3E6UA 1GA2A 3E73A 5FO7B 4BOKA 5AGDA 4BOJA 3P5PA 2DROA 1KREA 4ZRQA 3QPFA 2ZBLA 1QAZA 2V3PA 2P0VA 3WIQA 1J0NA 1OJPA 3X17A 1LF9A 5FO8B 3ACSA 2E24A 2IEJB 1CB8A 1N24A 3QXQA 1F1SA 1G9GA 1KSCA 2WINB 1FAEA 1V7XA 3WKIA 3M02A 1CEMA 5IK0A 1O6RA 2XWJB 2WIIB 2RI8A 3CIHA 3RENA 2GOXA 2GH4A 3D5RA 4V1RA 1OJMA 1V7VA 1DOGA 1UT9A 4ZRPA 3A0OA 3DRAB 2RI9A 1MZCB 1RWCA 3QRYA 3TF4A 1K72A 1N20A 3EZ8A 3K11A 3M7BA 3HXBB 1N4QB 1JCQB 4AYPA 4GTTB 1N1BA 1V7WA 4GL3A 3ANIA 2WY7A 4QT9A 3E30B 2EADA 4OJZA 5ILKA 2H6HB 1FT2B 3NFVA 5IKAA 1N7PA 1TNYB 1HZFA 2CQTA 3S4DA 1L1YA 1NL4B 4KKIA 5IL8A 1GXOA 3GT5A 4EL8A 2AFAA 3S4CA 5JPNB 1GSZA 2FUZA 3HXEB 4GTMB 4V1SA 5GZKA 1FPPB 4EHMB 3WKFA 1H39A 1FCEA 1O6QA 2V8JA 5ILZA 1NC5A 3E33B 1IA7A 3E34B 1FO2A 4Z4JA 3S4BA 2ZISB 2F6DA 4OK4A 3KQ4A 1H3AA 4TXTA 5MEHA 3GZKA 1EGUA 4J5TA 1N7NA 4DI5A 3M72A 4NEIA 4FUSA 3W7SA 1H12A 2JJBA 1H54A 2I07B 1KS8A 3Q78B 2B4FA 1N4SB 1H35A 3W7TA 1N94B 4ZH1A 2ONHA 1GAIA 2BB6A 4MMIA 2EABA 5FOBB 1H36A 1LXKA 1D8DB 1LOHA 2H6IB 3SDRA 3P2CA 5DGRA 1N7RA 1WU6A 4GTSB 2QNOA 1NXCA 5M7YA 1WU5A 1J0MA 2G02A 3E80A 4DODA
chains in the Genus database with same CATH topology
1JCSB 1HCUA 1TNZB 3QFYA 3VXDA 1C3DA 1N4RB 4KTPA 4LNGB 3SDVA 3QWTA 1H3CA 4M76A 1X81B 2WYNA 3DSSB 1SA4B 4YCRA 3DSUB 1H3BA 1H37A 4WVCA 3M74A 3E37B 4GTQB 4AYQA 3Q75B 4Z4LA 3KSQB 4GTRB 1KWFA 1GAHA 2JG0A 2SQCA 3T33A 3Q73B 2V3NA 1RQ5A 1H14A 1QQFA 2AHFA 2ZIRB 4CJ1A 2Z07A 5M7IA 3RX5A 4MBGB 1O1SB 2CQSA 1GXMA 4L9PB 3VW5A 2H6GB 4DOEA 1AGMA 1S64B 3EUVB 3OEDA 3GLYA 4L0GA 3A3VA 3G6JB 2G0DA 1AYXA 1FT1B 2BBCA 1F9OA 2YIKA 3M77A 2A73B 1SA5B 2F0YB 3DSWB 4KTRA 3Q79B 2PMVA 4D4AA 3QSPA 2XQWA 1TNUB 1NI1B 3OXUA 3RSYA 4XUVA 2FV1A 3SDUA 1FO3A 1WZZA 3W5MA 1JCRB 4Q2BA 1L2AA 2B39A 3RX8A 3M73A 3ON6A 1TN8B 3QG0A 3KLSA 1O79A 1UG9A 3DSVB 3QT3A 4AYOA 1GLMA 1GXNA 3M7EA 1JS4A 5GY3A 4GTOB 3QDEA 3PZ3B 4WVAA 4D94A 4MU9A 1XWQA 1X9DA 3DPYB 3RRSA 2JF4A 3ANJA 3WIWA 2GZ6A 1D8EB 2A8ZA 2R2LB 1KZOB 2WY8A 1W6KA 4AYRA 1XWTA 3SAEA 4LNVA 1LD8B 3H7LA 2BB5A 3SQCA 1G87A 3Q7FB 3PZ4B 1KKTA 5KKBA 1R76A 1G6IA 4KKJA 1N9AB 3D5SA 2V8IA 4YDEB 1O1RB 1O6HA 4WVBA 2BEDB 4WU0A 5DGQA 3CU7A 3M7LA 4Q88A 2AHGA 3EU5B 2OKXA 1FP3A 3E32B 1QBQB 1TNBB 1FBOA 3EQAA 1SQCA 3M75A 3PYBA 5E2JA 4D4DA 3H3KA 3AFJA 2PN5A 1CLCA 3SDTA 2D5JA 4D4BA 2V8KA 1O1TB 1UMPA 4YDOB 1KSDA 3KSLB 1KRFA 2NVPA 3DSTB 3QFZA 5FO9B 1LTXB 2DRQA 3QT9A 3PZ1B 1S63B 3EU8A 3HXCB 1N4PB 2XWBB 2NOJA 4CE7A 4FXGB 4GTVB 2FBAA 1KZPB 1XW2A 3W5NA 4JJJA 3SFYB 1H13A 1IS9A 4L6XA 4LNBB 4ZH5A 1V5DA 4C1SA 3P5RA 3PZ2B 3RJ3A 1TF4A 1F9DA 2RGKA 2VN4A 3DSXB 4GTPB 3W7UA 2H6FB 2XFGA 3C72B 5JPMB 4LIXA 1ULVA 3M78A 1QSJA 4FXKB 5CD2A 3W7WA 1LD7B 2DRRA 1IA6A 3S9VA 3M7CA 3K7XA 3Q7AB 5CA3A 3WKGA 1DL2A 1VD5A 4ZG8A 3WIRA 4TF4A 3W7XA 4CJ0A 3PYAA 1KFGA 1WU4A 3QXFA 2FV0A 1TN7B 1TN6B 3SFXB 1TNOB 4D4CA 1G9JA 3D3IA 3PMMA 5CZLA 3ANKA 1DCEB 1GHQA 1W6JA 2EAEA 3WC3A 2ZZRA 2DRSA 2EACA 3M71A 1FBWA 4ONTA 3WUXA 1LF6A 1V5CA 3HXFB 2VN7A 1FMIA 3S4AA 3HXDB 1O5MB 1N95B 3M76A 3H2WA 3ACTA 3RX7A 3SDQA 5GW7A 3WKHA 2D8LA 3E6UA 1GA2A 3E73A 5FO7B 4BOKA 5AGDA 4BOJA 3P5PA 2DROA 1KREA 4ZRQA 3QPFA 2ZBLA 2V3PA 2P0VA 3WIQA 3X17A 1LF9A 5FO8B 3ACSA 2IEJB 3QXQA 1G9GA 1KSCA 2WINB 1FAEA 1V7XA 3WKIA 1CEMA 1O6RA 2XWJB 2WIIB 2RI8A 3CIHA 3RENA 2GOXA 2GH4A 3D5RA 4V1RA 1V7VA 1DOGA 1UT9A 4ZRPA 3DRAB 2RI9A 1MZCB 3QRYA 3TF4A 1K72A 3EZ8A 3K11A 3M7BA 3HXBB 1N4QB 1JCQB 4AYPA 4GTTB 1V7WA 4GL3A 3ANIA 2WY7A 4QT9A 3E30B 2EADA 2H6HB 1FT2B 1TNYB 1HZFA 2CQTA 3S4DA 1L1YA 1NL4B 4KKIA 1GXOA 3GT5A 4EL8A 2AFAA 3S4CA 5JPNB 1GSZA 2FUZA 3HXEB 4GTMB 4V1SA 5GZKA 1FPPB 4EHMB 3WKFA 1H39A 1FCEA 1O6QA 2V8JA 1NC5A 3E33B 1IA7A 3E34B 1FO2A 4Z4JA 3S4BA 2ZISB 2F6DA 4TXTA 3KQ4A 1H3AA 5MEHA 3GZKA 4J5TA 3M72A 4FUSA 3W7SA 1H12A 2JJBA 1H54A 2I07B 1KS8A 3Q78B 2B4FA 1N4SB 1H35A 3W7TA 1N94B 4ZH1A 1GAIA 2BB6A 2EABA 5FOBB 1H36A 2H6IB 1D8DB 3SDRA 3P2CA 5DGRA 1WU6A 4GTSB 2QNOA 1NXCA 5M7YA 1WU5A 2G02A 4DODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5R A;  3DSX B;  1JCS B;  4GTP B;  4V1R A;  1TNZ B;  3PZ3 B;  1C3D A;  4D94 A;  2H6F B;  4MU9 A;  1N4R B;  4LNG B;  3C72 B;  5JPM B;  1H3C A;  4ZRP A;  3DPY B;  4M76 A;  3DRA B;  1X81 B;  1QSJ A;  4FXK B;  1MZC B;  1D8E B;  3DSS B;  1LD7 B;  1SA4 B;  2R2L B;  1KZO B;  3DSU B;  2WY8 A;  1H3B A;  1W6K A;  3K7X A;  1H37 A;  3Q7A B;  3HXB B;  1N4Q B;  1JCQ B;  4LNV A;  4GTT B;  1LD8 B;  2BB5 A;  3SQC A;  3Q7F B;  3PZ4 B;  2WY7 A;  3E37 B;  4GTQ B;  3E30 B;  1R76 A;  3Q75 B;  2H6H B;  3KSQ B;  4GTR B;  4KKJ A;  1N9A B;  1FT2 B;  3D5S A;  1TN7 B;  2V8I A;  2SQC A;  1TN6 B;  1O1R B;  4YDE B;  1TNO B;  3SFX B;  1O6H A;  3Q73 B;  4D4C A;  2V3N A;  1TNY B;  2BED B;  1GHQ A;  1DCE B;  1HZF A;  1W6J A;  3CU7 A;  1QQF A;  4ONT A;  2ZIR B;  1NL4 B;  4KKI A;  1GXO A;  3EU5 B;  3HXF B;  3E32 B;  1QBQ B;  4MBG B;  1O1S B;  5JPN B;  1GSZ A;  1TNB B;  3HXE B;  4GTM B;  1GXM A;  4V1S A;  1FPP B;  1SQC A;  4EHM B;  4L9P B;  3HXD B;  1H39 A;  1O5M B;  1O6Q A;  1N95 B;  2H6G B;  2V8J A;  1S64 B;  3EUV B;  3OED A;  4D4D A;  3G6J B;  2G0D A;  1FT1 B;  2BBC A;  2PN5 A;  3E33 B;  3E34 B;  5FO7 B;  4BOK A;  4D4B A;  2ZIS B;  2A73 B;  5AGD A;  4BOJ A;  2V8K A;  1H3A A;  1SA5 B;  3KQ4 A;  2F0Y B;  3DSW B;  1O1T B;  1UMP A;  4YDO B;  3Q79 B;  4ZRQ A;  2PMV A;  3KSL B;  2V3P A;  4D4A A;  2XQW A;  1TNU B;  3DST B;  1NI1 B;  3OXU A;  5FO9 B;  1LTX B;  2I07 B;  3Q78 B;  3PZ1 B;  1S63 B;  1N4S B;  5FO8 B;  2IEJ B;  3HXC B;  1N4P B;  2XWB B;  1H35 A;  2NOJ A;  1JCR B;  4FXG B;  4GTV B;  1N94 B;  4ZH1 A;  2BB6 A;  2B39 A;  5FOB B;  1KZP B;  2WIN B;  1H36 A;  1TN8 B;  2H6I B;  1D8D B;  3KLS A;  3SFY B;  1O79 A;  1O6R A;  4LNB B;  3DSV B;  4GTS B;  2XWJ B;  4C1S A;  1GXN A;  2WII B;  3PZ2 B;  3RJ3 A;  2GOX A;  2G02 A;  4GTO B; 
#chains in the Genus database with same CATH topology
 1JCS B;  1HCU A;  1TNZ B;  3QFY A;  3VXD A;  1C3D A;  1N4R B;  1OJO A;  4KTP A;  4LNG B;  3SDV A;  3QWT A;  1H3C A;  1RW9 A;  5IKH A;  4M76 A;  5EAS A;  1X81 B;  1C82 A;  2WYN A;  3DSS B;  1SA4 B;  3M00 A;  4YCR A;  1HN0 A;  3DSU B;  1H3B A;  3G4F A;  1H37 A;  5ILY A;  2FUT A;  1N7O A;  4WVC A;  3M74 A;  3E37 B;  4GTQ B;  4AYQ A;  3Q75 B;  4Z4L A;  3KSQ B;  4FNV A;  4GTR B;  5JMF A;  1KWF A;  5C05 A;  3VSM A;  1GAH A;  2JG0 A;  2SQC A;  3T33 A;  3Q73 B;  3N0G A;  2V3N A;  1RQ5 A;  1H14 A;  5ILD A;  1QQF A;  2AHF A;  2ZIR B;  5EAT A;  4CJ1 A;  2Z07 A;  5M7I A;  3RX5 A;  4MBG B;  1O1S B;  2CQS A;  1GXM A;  4L9P B;  3VW5 A;  2H6G B;  4DOE A;  1AGM A;  1S64 B;  3EUV B;  3OED A;  3GLY A;  4L0G A;  3A3V A;  3G6J B;  2G0D A;  1AYX A;  1FT1 B;  2BBC A;  1F9O A;  2YIK A;  5DHI A;  3M77 A;  2A73 B;  1SA5 B;  2F0Y B;  3DSW B;  4KTR A;  1HMU A;  4F13 A;  3Q79 B;  2PMV A;  4D4A A;  1HM2 A;  3QSP A;  2XQW A;  1TNU B;  1NI1 B;  2BRW A;  3OXU A;  3RSY A;  4XUV A;  2FV1 A;  3SDU A;  1I8Q A;  1FO3 A;  4GAX A;  1WZZ A;  3W5M A;  1JCR B;  4FJQ A;  2E22 A;  4Q2B A;  1L2A A;  2B39 A;  3RX8 A;  3M73 A;  3ON6 A;  1W3Y A;  1TN8 B;  3QG0 A;  3KLS A;  1O79 A;  1RWG A;  1N23 A;  1UG9 A;  3DSV B;  3QT3 A;  4AYO A;  3G4D A;  1GLM A;  1GXN A;  1RWH A;  5JMD A;  3M7E A;  1JS4 A;  5GY3 A;  4GTO B;  3QDE A;  3PZ3 B;  4OK2 A;  4WVA A;  4D94 A;  4MU9 A;  1XWQ A;  1X9D A;  2WCO A;  3DPY B;  3RRS A;  2JF4 A;  3ANJ A;  3WIW A;  2GZ6 A;  5ILJ A;  3VSN A;  1D8E B;  2A8Z A;  5DHK A;  2R2L B;  1KZO B;  2WY8 A;  1W6K A;  3AFL A;  4AYR A;  1XWT A;  3SAE A;  3M01 A;  4LNV A;  1LD8 B;  1X1J A;  3H7L A;  2BB5 A;  3SQC A;  1G87 A;  3Q7F B;  3PZ4 B;  1KKT A;  1N21 A;  5KKB A;  1R76 A;  4RNQ A;  1G6I A;  2WDA A;  4KKJ A;  1N9A B;  3D5S A;  5ILI A;  2V8I A;  4YDE B;  1O1R B;  1O6H A;  4WVB A;  2BED B;  4WU0 A;  5DGQ A;  5IK6 A;  3CU7 A;  1RWA A;  3M7L A;  4Q88 A;  2AHG A;  3EU5 B;  2OKX A;  3N0F A;  1FP3 A;  1HXA A;  1QBQ B;  3E32 B;  4OZV A;  1TNB B;  1FBO A;  3EQA A;  1SQC A;  5EAU A;  3M75 A;  3PYB A;  4OZW A;  1N22 A;  5E2J A;  1N1Z A;  1HM3 A;  4D4D A;  3H3K A;  3AFJ A;  2PN5 A;  3LZ9 A;  2BRP A;  1CLC A;  3SDT A;  2D5J A;  4D4B A;  2V8K A;  5IM1 A;  1O1T B;  1UMP A;  4YDO B;  4F10 A;  1KSD A;  3KSL B;  1KRF A;  2NVP A;  3DST B;  3NNB A;  1OJN A;  3QFZ A;  5FO9 B;  1LTX B;  2DRQ A;  3QT9 A;  3PZ1 B;  1S63 B;  3EU8 A;  3HXC B;  1N4P B;  2XWB B;  2NOJ A;  4CE7 A;  4FXG B;  4GTV B;  2FBA A;  1HXC A;  1KZP B;  1XW2 A;  3W5N A;  4JJJ A;  3SFY B;  1H13 A;  1IS9 A;  4L6X A;  4LNB B;  4ZH5 A;  1V5D A;  4C1S A;  1RWF A;  3P5R A;  3PZ2 B;  3RJ3 A;  1TF4 A;  1F9D A;  2RGK A;  1HV6 A;  2VN4 A;  3DSX B;  4GTP B;  3W7U A;  2BRV X;  2Q1F A;  2H6F B;  3E7J A;  2XFG A;  3C72 B;  5JPM B;  4LIX A;  1ULV A;  3M78 A;  1QSJ A;  4FXK B;  5CD2 A;  3W7W A;  1LD7 B;  2DRR A;  1IA6 A;  3S9V A;  3M7C A;  3K7X A;  3Q7A B;  5CA3 A;  3WKG A;  1DL2 A;  1VD5 A;  4ZG8 A;  3WIR A;  1N7Q A;  4TF4 A;  3W7X A;  4CJ0 A;  3PYA A;  1KFG A;  1WU4 A;  3QXF A;  2FV0 A;  1F9G A;  1HX9 A;  1X1H A;  1HMW A;  1TN7 B;  1TN6 B;  3SFX B;  1TNO B;  4D4C A;  1G9J A;  3D3I A;  3PMM A;  5CZL A;  3ANK A;  5ILH A;  1DCE B;  1GHQ A;  1W6J A;  2EAE A;  4MMH A;  2ZZR A;  2DRS A;  2EAC A;  3M71 A;  1FBW A;  4ONT A;  1HXG A;  3WC3 A;  3WUX A;  1LF6 A;  1V5C A;  3HXF B;  2J5C A;  1LXM A;  1X1I A;  1FMI A;  2VN7 A;  2FUQ A;  3S4A A;  5IL3 A;  3HXD B;  4E1Y A;  1O5M B;  5IK9 A;  1N95 B;  3M76 A;  3H2W A;  3ACT A;  3RX7 A;  3SDQ A;  2X03 A;  5GW7 A;  2ONG A;  3WKH A;  2D8L A;  3E6U A;  1GA2 A;  3E73 A;  5FO7 B;  4BOK A;  5AGD A;  4BOJ A;  3P5P A;  2DRO A;  1KRE A;  4ZRQ A;  3QPF A;  2ZBL A;  1QAZ A;  2V3P A;  2P0V A;  3WIQ A;  1J0N A;  1OJP A;  3X17 A;  1LF9 A;  5FO8 B;  3ACS A;  2E24 A;  2IEJ B;  1CB8 A;  1N24 A;  3QXQ A;  1F1S A;  1G9G A;  1KSC A;  2WIN B;  1FAE A;  1V7X A;  3WKI A;  3M02 A;  1CEM A;  5IK0 A;  1O6R A;  2XWJ B;  2WII B;  2RI8 A;  3CIH A;  3REN A;  2GOX A;  2GH4 A;  3D5R A;  4V1R A;  1OJM A;  1V7V A;  1DOG A;  1UT9 A;  4ZRP A;  3A0O A;  3DRA B;  2RI9 A;  1MZC B;  1RWC A;  3QRY A;  3TF4 A;  1K72 A;  1N20 A;  3EZ8 A;  3K11 A;  3M7B A;  3HXB B;  1N4Q B;  1JCQ B;  4AYP A;  4GTT B;  1N1B A;  1V7W A;  4GL3 A;  3ANI A;  2WY7 A;  4QT9 A;  3E30 B;  2EAD A;  4OJZ A;  5ILK A;  2H6H B;  1FT2 B;  3NFV A;  5IKA A;  1N7P A;  1TNY B;  1HZF A;  2CQT A;  3S4D A;  1L1Y A;  1NL4 B;  4KKI A;  5IL8 A;  1GXO A;  3GT5 A;  4EL8 A;  2AFA A;  3S4C A;  5JPN B;  1GSZ A;  2FUZ A;  3HXE B;  4GTM B;  4V1S A;  5GZK A;  1FPP B;  4EHM B;  3WKF A;  1H39 A;  1FCE A;  1O6Q A;  2V8J A;  5ILZ A;  1NC5 A;  3E33 B;  1IA7 A;  3E34 B;  1FO2 A;  4Z4J A;  3S4B A;  2ZIS B;  2F6D A;  4OK4 A;  3KQ4 A;  1H3A A;  4TXT A;  5MEH A;  3GZK A;  1EGU A;  4J5T A;  1N7N A;  4DI5 A;  3M72 A;  4NEI A;  4FUS A;  3W7S A;  1H12 A;  2JJB A;  1H54 A;  2I07 B;  1KS8 A;  3Q78 B;  2B4F A;  1N4S B;  1H35 A;  3W7T A;  1N94 B;  4ZH1 A;  2ONH A;  1GAI A;  2BB6 A;  4MMI A;  2EAB A;  5FOB B;  1H36 A;  1LXK A;  1D8D B;  1LOH A;  2H6I B;  3SDR A;  3P2C A;  5DGR A;  1N7R A;  1WU6 A;  4GTS B;  2QNO A;  1NXC A;  5M7Y A;  1WU5 A;  1J0M A;  2G02 A;  3E80 A;  4DOD A; 
#chains in the Genus database with same CATH homology
 1JCS B;  1HCU A;  1TNZ B;  3QFY A;  3VXD A;  1C3D A;  1N4R B;  4KTP A;  4LNG B;  3SDV A;  3QWT A;  1H3C A;  4M76 A;  1X81 B;  2WYN A;  3DSS B;  1SA4 B;  4YCR A;  3DSU B;  1H3B A;  1H37 A;  4WVC A;  3M74 A;  3E37 B;  4GTQ B;  4AYQ A;  3Q75 B;  4Z4L A;  3KSQ B;  4GTR B;  1KWF A;  1GAH A;  2JG0 A;  2SQC A;  3T33 A;  3Q73 B;  2V3N A;  1RQ5 A;  1H14 A;  1QQF A;  2AHF A;  2ZIR B;  4CJ1 A;  2Z07 A;  5M7I A;  3RX5 A;  4MBG B;  1O1S B;  2CQS A;  1GXM A;  4L9P B;  3VW5 A;  2H6G B;  4DOE A;  1AGM A;  1S64 B;  3EUV B;  3OED A;  3GLY A;  4L0G A;  3A3V A;  3G6J B;  2G0D A;  1AYX A;  1FT1 B;  2BBC A;  1F9O A;  2YIK A;  3M77 A;  2A73 B;  1SA5 B;  2F0Y B;  3DSW B;  4KTR A;  3Q79 B;  2PMV A;  4D4A A;  3QSP A;  2XQW A;  1TNU B;  1NI1 B;  3OXU A;  3RSY A;  4XUV A;  2FV1 A;  3SDU A;  1FO3 A;  1WZZ A;  3W5M A;  1JCR B;  4Q2B A;  1L2A A;  2B39 A;  3RX8 A;  3M73 A;  3ON6 A;  1TN8 B;  3QG0 A;  3KLS A;  1O79 A;  1UG9 A;  3DSV B;  3QT3 A;  4AYO A;  1GLM A;  1GXN A;  3M7E A;  1JS4 A;  5GY3 A;  4GTO B;  3QDE A;  3PZ3 B;  4WVA A;  4D94 A;  4MU9 A;  1XWQ A;  1X9D A;  3DPY B;  3RRS A;  2JF4 A;  3ANJ A;  3WIW A;  2GZ6 A;  1D8E B;  2A8Z A;  2R2L B;  1KZO B;  2WY8 A;  1W6K A;  4AYR A;  1XWT A;  3SAE A;  4LNV A;  1LD8 B;  3H7L A;  2BB5 A;  3SQC A;  1G87 A;  3Q7F B;  3PZ4 B;  1KKT A;  5KKB A;  1R76 A;  1G6I A;  4KKJ A;  1N9A B;  3D5S A;  2V8I A;  4YDE B;  1O1R B;  1O6H A;  4WVB A;  2BED B;  4WU0 A;  5DGQ A;  3CU7 A;  3M7L A;  4Q88 A;  2AHG A;  3EU5 B;  2OKX A;  1FP3 A;  3E32 B;  1QBQ B;  1TNB B;  1FBO A;  3EQA A;  1SQC A;  3M75 A;  3PYB A;  5E2J A;  4D4D A;  3H3K A;  3AFJ A;  2PN5 A;  1CLC A;  3SDT A;  2D5J A;  4D4B A;  2V8K A;  1O1T B;  1UMP A;  4YDO B;  1KSD A;  3KSL B;  1KRF A;  2NVP A;  3DST B;  3QFZ A;  5FO9 B;  1LTX B;  2DRQ A;  3QT9 A;  3PZ1 B;  1S63 B;  3EU8 A;  3HXC B;  1N4P B;  2XWB B;  2NOJ A;  4CE7 A;  4FXG B;  4GTV B;  2FBA A;  1KZP B;  1XW2 A;  3W5N A;  4JJJ A;  3SFY B;  1H13 A;  1IS9 A;  4L6X A;  4LNB B;  4ZH5 A;  1V5D A;  4C1S A;  3P5R A;  3PZ2 B;  3RJ3 A;  1TF4 A;  1F9D A;  2RGK A;  2VN4 A;  3DSX B;  4GTP B;  3W7U A;  2H6F B;  2XFG A;  3C72 B;  5JPM B;  4LIX A;  1ULV A;  3M78 A;  1QSJ A;  4FXK B;  5CD2 A;  3W7W A;  1LD7 B;  2DRR A;  1IA6 A;  3S9V A;  3M7C A;  3K7X A;  3Q7A B;  5CA3 A;  3WKG A;  1DL2 A;  1VD5 A;  4ZG8 A;  3WIR A;  4TF4 A;  3W7X A;  4CJ0 A;  3PYA A;  1KFG A;  1WU4 A;  3QXF A;  2FV0 A;  1TN7 B;  1TN6 B;  3SFX B;  1TNO B;  4D4C A;  1G9J A;  3D3I A;  3PMM A;  5CZL A;  3ANK A;  1DCE B;  1GHQ A;  1W6J A;  2EAE A;  3WC3 A;  2ZZR A;  2DRS A;  2EAC A;  3M71 A;  1FBW A;  4ONT A;  3WUX A;  1LF6 A;  1V5C A;  3HXF B;  2VN7 A;  1FMI A;  3S4A A;  3HXD B;  1O5M B;  1N95 B;  3M76 A;  3H2W A;  3ACT A;  3RX7 A;  3SDQ A;  5GW7 A;  3WKH A;  2D8L A;  3E6U A;  1GA2 A;  3E73 A;  5FO7 B;  4BOK A;  5AGD A;  4BOJ A;  3P5P A;  2DRO A;  1KRE A;  4ZRQ A;  3QPF A;  2ZBL A;  2V3P A;  2P0V A;  3WIQ A;  3X17 A;  1LF9 A;  5FO8 B;  3ACS A;  2IEJ B;  3QXQ A;  1G9G A;  1KSC A;  2WIN B;  1FAE A;  1V7X A;  3WKI A;  1CEM A;  1O6R A;  2XWJ B;  2WII B;  2RI8 A;  3CIH A;  3REN A;  2GOX A;  2GH4 A;  3D5R A;  4V1R A;  1V7V A;  1DOG A;  1UT9 A;  4ZRP A;  3DRA B;  2RI9 A;  1MZC B;  3QRY A;  3TF4 A;  1K72 A;  3EZ8 A;  3K11 A;  3M7B A;  3HXB B;  1N4Q B;  1JCQ B;  4AYP A;  4GTT B;  1V7W A;  4GL3 A;  3ANI A;  2WY7 A;  4QT9 A;  3E30 B;  2EAD A;  2H6H B;  1FT2 B;  1TNY B;  1HZF A;  2CQT A;  3S4D A;  1L1Y A;  1NL4 B;  4KKI A;  1GXO A;  3GT5 A;  4EL8 A;  2AFA A;  3S4C A;  5JPN B;  1GSZ A;  2FUZ A;  3HXE B;  4GTM B;  4V1S A;  5GZK A;  1FPP B;  4EHM B;  3WKF A;  1H39 A;  1FCE A;  1O6Q A;  2V8J A;  1NC5 A;  3E33 B;  1IA7 A;  3E34 B;  1FO2 A;  4Z4J A;  3S4B A;  2ZIS B;  2F6D A;  4TXT A;  3KQ4 A;  1H3A A;  5MEH A;  3GZK A;  4J5T A;  3M72 A;  4FUS A;  3W7S A;  1H12 A;  2JJB A;  1H54 A;  2I07 B;  1KS8 A;  3Q78 B;  2B4F A;  1N4S B;  1H35 A;  3W7T A;  1N94 B;  4ZH1 A;  1GAI A;  2BB6 A;  2EAB A;  5FOB B;  1H36 A;  2H6I B;  1D8D B;  3SDR A;  3P2C A;  5DGR A;  1WU6 A;  4GTS B;  2QNO A;  1NXC A;  5M7Y A;  1WU5 A;  2G02 A;  4DOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...