2WY8A

Staphylococcus aureus complement subversion protein sbi-iv in complex with complement fragment c3d
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
292
structure length
292
Chain Sequence
DAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C3D FRAGMENT
publication title A Structural Basis for Staphylococcal Complement Subversion: X-Ray Structure of the Complement- Binding Domain of Staphylococcus Aureus Protein Sbi in Complex with Ligand C3D.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 114
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2009-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2wy8A00
1JCQB 3CU7A 1H3CA 2WY7A 3E30B 2WY8A 2H6FB 3Q7FB 5JPMB 2R2LB 1N94B 4D4AA 1H36A 4FXGB 2H6HB 1KZOB 3D5SA 3KSLB 4D4CA 1O1TB 1KZPB 3DSXB 1NL4B 1SA5B 4GTPB 4FXKB 3E34B 5JPNB 3HXCB 1FT2B 2BBCA 1O1SB 1N4RB 1DCEB 3Q75B 2V8JA 3HXBB 3OEDA 4MU9A 1H3BA 1R76A 1N4QB 3SFXB 4M76A 1MZCB 5FO9B 4YDOB 1O79A 1S64B 1QQFA 1O6HA 1C3DA 2V8IA 3G6JB 2G0DA 3DSUB 4GTQB 3E32B 5AGDA 1D8DB 1FT1B 1O1RB 4ZRQA 4ZH1A 1UMPA 3PZ1B 2WINB 3D5RA 2XQWA 4MBGB 3OXUA 1D8EB 3DRAB 1H3AA 1LD8B 1TNBB 4GTMB 1TNUB 3K7XA 2XWBB 3C72B 3RJ3A 2PMVA 2G02A 4GTTB 4D4DA 2XWJB 1JCRB 1TNOB 1QSJA 4BOJA 1N9AB 3DSTB 1GXOA 3DSSB 2BB6A 1W6JA 3Q79B 3DSVB 3PZ2B 4D94A 1LD7B 1N4SB 1TNYB 1TN7B 2H6IB 3SFYB 1GHQA 2WIIB 1S63B 1N95B 1X81B 1O5MB 3E33B 4LNBB 2NOJA 1GSZA 2SQCA 5FO7B 4KKIA 1H37A 4D4BA 4C1SA 1TN8B 3HXEB 3PZ4B 3E37B 4V1SA 2ZIRB 3Q73B 4ZRPA 2I07B 2A73B 1JCSB 3EUVB 1TNZB 3HXFB 1W6KA 3PZ3B 2BB5A 4BOKA 3DSWB 1FPPB 2GOXA 2PN5A 2V3NA 2V3PA 1NI1B 4GTSB 4L9PB 4KKJA 1HZFA 3KLSA 3Q7AB 1TN6B 1H35A 4LNVA 3Q78B 3EU5B 4V1RA 3DPYB 2IEJB 1N4PB 1SQCA 1H39A 4ONTA 3HXDB 3KSQB 3KQ4A 2V8KA 4EHMB 5FO8B 2F0YB 2H6GB 2B39A 1LTXB 1O6QA 1GXMA 4LNGB 4GTOB 5FOBB 2BEDB 1GXNA 4GTRB 1O6RA 2ZISB 4YDEB 3SQCA 1QBQB 4GTVB 1SA4B
chains in the Genus database with same CATH superfamily
3CU7A 5ILJA 1H3CA 2EACA 3WKFA 4TF4A 4E1YA 3SDQA 3Q7FB 3M7EA 1N94B 1H36A 2H6HB 1KZOB 1O1TB 5IL8A 1KS8A 2FBAA 1HM3A 5JPNB 3HXCB 1FT2B 2BBCA 1N4RB 1N24A 3RENA 1AYXA 1HXGA 2ONGA 3SDVA 1RW9A 1S64B 1HX9A 4L6XA 4OZWA 1WZZA 2G0DA 3QT9A 4GTQB 2AHGA 1FT1B 4GAXA 1UMPA 2WINB 3A0OA 3W5MA 1L2AA 3S4BA 1H3AA 3K11A 1FO3A 1LD8B 4DODA 3NNBA 4GTMB 3T33A 5CD2A 3C72B 1F9OA 2CQSA 4Z4LA 1K72A 1QSJA 1VD5A 1GLMA 3AFJA 3DSSB 1W6JA 3WKGA 3PZ2B 1TN7B 1FBWA 3SFYB 1CEMA 3M75A 3RX8A 2WDAA 3M77A 4LNBB 2NOJA 2P0VA 2SQCA 5FO7B 4JJJA 4OZVA 4KTRA 4C1SA 3S4DA 3HXEB 3M74A 3E37B 1RWAA 3S4AA 2I07B 3N0GA 1FAEA 5DHKA 1JCSB 4Z4JA 1W6KA 2D8LA 1OJNA 1TF4A 3PZ3B 1FPPB 1RWCA 2GOXA 5IK6A 4DI5A 1HZFA 3LZ9A 1TN6B 1V5DA 4LNVA 4Q88A 1N7NA 3WIQA 4F10A 2GH4A 1N4PB 1H39A 1N7RA 4ONTA 4AYOA 2J5CA 2EABA 3QPFA 1V7XA 3M7BA 3M73A 3ANKA 2BRWA 2B39A 5CZLA 4GTOB 2BRVX 5CA3A 3GLYA 1NC5A 3D3IA 4GTRB 3M76A 2ZISB 3GZKA 3SQCA 3QT3A 4GTVB 1JCQB 4CJ1A 1RQ5A 3EQAA 3QXFA 4WVBA 2WY7A 3E30B 5C05A 2WY8A 2H6FB 3ON6A 2BRPA 3X17A 2R2LB 4D4CA 1WU4A 1KKTA 5EATA 3M78A 1I8QA 3SDTA 4GTPB 1DCEB 1XW2A 2V8JA 1ULVA 3HXBB 3OEDA 1LF6A 3NFVA 3A3VA 1N4QB 1MZCB 1O79A 3VXDA 2JF4A 5ILKA 4OJZA 5GW7A 1V7VA 3E32B 4DOEA 1HXAA 1D8DB 4ZRQA 5JMDA 1XWTA 4L0GA 1FO2A 1N20A 4MBGB 4NEIA 3GT5A 1L1YA 2WYNA 3E6UA 3WIRA 4J5TA 1TNBB 1EGUA 2G02A 4GTTB 4AYQA 1GAHA 1N1BA 2XWJB 1TNOB 1N23A 3H3KA 1LXKA 1NXCA 1GXOA 1KSDA 1KWFA 4CE7A 5ILHA 3W7UA 3QG0A 1LD7B 1IS9A 1CLCA 1GHQA 5EASA 1S63B 1XWQA 2RGKA 3QWTA 2ONHA 1O5MB 4OK2A 3ACTA 1HMWA 5M7YA 3ACSA 1TN8B 2FUZA 3W7TA 3P2CA 2EADA 3M71A 3HXFB 1KSCA 1N7PA 1OJMA 3M02A 3PYAA 2PN5A 1FMIA 3VSNA 4L9PB 3M01A 3ANJA 3KLSA 1N1ZA 1H35A 1AGMA 5ILYA 3H2WA 3EU5B 3DPYB 3E73A 1N7OA 3HXDB 3W7SA 2FV1A 5FO8B 4FJQA 2F0YB 2H6GB 1LTXB 1O6QA 4KTPA 1N7QA 2DRSA 1O6RA 2GZ6A 3P5RA 1RWGA 1RWHA 2AHFA 3P5PA 1HM2A 5JPMB 1KREA 1H12A 2EAEA 1H13A 4FXGB 2A8ZA 3QDEA 1KZPB 3DSXB 4WU0A 1NL4B 3E34B 1X1HA 1WU6A 1O1SB 1DOGA 3S4CA 4F13A 1F9GA 1R76A 1G9GA 2Q1FA 4M76A 5FO9B 4YDOB 1V7WA 1CB8A 3QRYA 1C3DA 3WKIA 3ANIA 2V8IA 1N21A 4ZH1A 3PZ1B 3VSMA 3D5RA 3H7LA 3OXUA 2D5JA 3DRAB 4AYPA 3SDRA 2RI9A 3SAEA 3PMMA 3W7WA 3E7JA 3RX5A 2XWBB 3RJ3A 1HXCA 4TXTA 4D4DA 1F9DA 5DHIA 1H54A 1JCRB 5ILZA 4BOJA 5M7IA 1N9AB 1J0MA 5KKBA 1OJPA 4WVCA 1G87A 4ZG8A 2H6IB 4WVAA 2FUTA 3E33B 3TF4A 1G9JA 1GSZA 2JG0A 2VN7A 3M00A 1HV6A 1X9DA 1H37A 4YCRA 5EAUA 3CIHA 1LF9A 2CQTA 5IL3A 3PZ4B 2ZIRB 3Q73B 5IK0A 1TNZB 4OK4A 3QXQA 2BB5A 4EL8A 1HN0A 3G4DA 2V3NA 4GTSB 1NI1B 5IKAA 5GY3A 3S9VA 3W7XA 3W5NA 4FNVA 4KKJA 3M72A 1F1SA 5MEHA 2IEJB 1OJOA 1SQCA 3WUXA 2DRRA 1QAZA 3QFZA 1X1JA 3AFLA 3KQ4A 2ZZRA 5IKHA 2V8KA 3PYBA 5JMFA 1J0NA 1FCEA 2F6DA 1IA6A 1UG9A 2BEDB 1H14A 4AYRA 1GXNA 4YDEB 2OKXA 1KFGA 2E22A 3EU8A 3WC3A 1JS4A 1V5CA 3RSYA 4D4AA 3D5SA 3KSLB 1RWFA 4MMHA 1SA5B 4FXKB 1FP3A 4MU9A 3Q75B 1C82A 2RI8A 1H3BA 3QSPA 1KRFA 3M7LA 3SFXB 5ILIA 5E2JA 1HMUA 1QQFA 1O6HA 5IM1A 3G6JB 3DSUB 4GL3A 4ZH5A 3E80A 5AGDA 2FV0A 1O1RB 4FUSA 2FUQA 2XQWA 1D8EB 5GZKA 1GA2A 4QT9A 1TNUB 3K7XA 2PMVA 2DRQA 2Z07A 2X03A 1X1IA 4XUVA 3DSTB 2BB6A 1LXMA 3Q79B 4MMIA 3DSVB 4D94A 5DGQA 1N4SB 1TNYB 2E24A 1LOHA 2XFGA 2WIIB 3SDUA 1WU5A 1N95B 2AFAA 3N0FA 1IA7A 1X81B 1W3YA 4KKIA 1HCUA 2NVPA 4D4BA 2WCOA 5ILDA 1FBOA 4V1SA 2DROA 4ZRPA 3VW5A 2A73B 3EUVB 4RNQA 4CJ0A 3QFYA 4BOKA 3DSWB 1UT9A 2V3PA 1GAIA 2JJBA 5DGRA 3Q7AB 2ZBLA 1G6IA 3RRSA 3Q78B 4V1RA 3EZ8A 1DL2A 4Q2BA 3G4FA 3KSQB 2B4FA 3WIWA 3RX7A 2VN4A 3WKHA 4EHMB 4LIXA 5IK9A 3M7CA 1GXMA 4LNGB 5FOBB 2QNOA 1N22A 1QBQB 2YIKA 1SA4B
chains in the Genus database with same CATH topology
3CU7A 1H3CA 2EACA 3WKFA 4TF4A 3SDQA 3Q7FB 3M7EA 1N94B 1H36A 2H6HB 1KZOB 1O1TB 1KS8A 2FBAA 5JPNB 3HXCB 1FT2B 2BBCA 1N4RB 3RENA 1AYXA 3SDVA 1S64B 4L6XA 1WZZA 2G0DA 3QT9A 4GTQB 2AHGA 1FT1B 1UMPA 2WINB 3W5MA 1L2AA 3S4BA 1H3AA 3K11A 1FO3A 1LD8B 4DODA 4GTMB 3T33A 5CD2A 3C72B 1F9OA 2CQSA 4Z4LA 1K72A 1QSJA 1VD5A 1GLMA 3AFJA 3DSSB 1W6JA 3WKGA 3PZ2B 1TN7B 1FBWA 3SFYB 1CEMA 3M75A 3RX8A 3M77A 4LNBB 2NOJA 2P0VA 2SQCA 5FO7B 4JJJA 4KTRA 4C1SA 3S4DA 3HXEB 3M74A 3E37B 3S4AA 2I07B 1FAEA 1JCSB 4Z4JA 1W6KA 2D8LA 1TF4A 3PZ3B 1FPPB 2GOXA 1HZFA 1TN6B 1V5DA 4LNVA 4Q88A 3WIQA 2GH4A 1N4PB 1H39A 4ONTA 4AYOA 2EABA 3QPFA 1V7XA 3M7BA 3M73A 2B39A 3ANKA 5CZLA 4GTOB 5CA3A 3GLYA 1NC5A 3D3IA 4GTRB 3M76A 2ZISB 3GZKA 3SQCA 3QT3A 4GTVB 1JCQB 4CJ1A 1RQ5A 3EQAA 3QXFA 4WVBA 2WY7A 3E30B 2WY8A 2H6FB 3ON6A 3X17A 2R2LB 4D4CA 1WU4A 1KKTA 3M78A 3SDTA 4GTPB 1DCEB 1XW2A 2V8JA 1ULVA 3HXBB 3OEDA 1LF6A 3A3VA 1N4QB 1MZCB 1O79A 3VXDA 2JF4A 5GW7A 1V7VA 3E32B 4DOEA 1D8DB 4ZRQA 1XWTA 4L0GA 1FO2A 4MBGB 3GT5A 1L1YA 2WYNA 3E6UA 3WIRA 4J5TA 1TNBB 2G02A 4GTTB 4AYQA 1GAHA 2XWJB 1TNOB 3H3KA 1NXCA 1GXOA 1KSDA 1KWFA 4CE7A 3W7UA 3QG0A 1LD7B 1IS9A 1CLCA 1GHQA 1S63B 1XWQA 2RGKA 3QWTA 1O5MB 3ACTA 5M7YA 3ACSA 1TN8B 2FUZA 3W7TA 3P2CA 2EADA 3M71A 3HXFB 1KSCA 3PYAA 2PN5A 1FMIA 4L9PB 3ANJA 3KLSA 1H35A 1AGMA 3H2WA 3EU5B 3DPYB 3E73A 3HXDB 3W7SA 2FV1A 5FO8B 2F0YB 2H6GB 1LTXB 1O6QA 4KTPA 2DRSA 1O6RA 2GZ6A 3P5RA 2AHFA 3P5PA 5JPMB 1KREA 1H12A 2EAEA 1H13A 4FXGB 2A8ZA 3QDEA 1KZPB 3DSXB 4WU0A 1NL4B 3E34B 1WU6A 1O1SB 1DOGA 3S4CA 1R76A 1G9GA 4M76A 5FO9B 4YDOB 1V7WA 3QRYA 1C3DA 3WKIA 3ANIA 2V8IA 4ZH1A 3PZ1B 3D5RA 3H7LA 3OXUA 2D5JA 3DRAB 4AYPA 3SDRA 2RI9A 3SAEA 3PMMA 3W7WA 3RX5A 2XWBB 3RJ3A 4TXTA 4D4DA 1F9DA 1H54A 1JCRB 4BOJA 5M7IA 1N9AB 5KKBA 4WVCA 1G87A 4ZG8A 2H6IB 4WVAA 3E33B 3TF4A 1G9JA 1GSZA 2JG0A 2VN7A 1X9DA 1H37A 4YCRA 3CIHA 1LF9A 2CQTA 3PZ4B 2ZIRB 3Q73B 1TNZB 3QXQA 2BB5A 4EL8A 2V3NA 4GTSB 1NI1B 5GY3A 3S9VA 3W7XA 3W5NA 4KKJA 3M72A 5MEHA 2IEJB 1SQCA 3WUXA 2DRRA 3QFZA 3KQ4A 2ZZRA 2V8KA 3PYBA 1FCEA 2F6DA 1IA6A 1UG9A 2BEDB 1H14A 4AYRA 1GXNA 4YDEB 2OKXA 1KFGA 3EU8A 3WC3A 1JS4A 1V5CA 3RSYA 4D4AA 3D5SA 3KSLB 1SA5B 4FXKB 1FP3A 4MU9A 3Q75B 2RI8A 1H3BA 3QSPA 1KRFA 3M7LA 3SFXB 5E2JA 1QQFA 1O6HA 3G6JB 3DSUB 4GL3A 4ZH5A 5AGDA 2FV0A 1O1RB 4FUSA 2XQWA 1D8EB 5GZKA 1GA2A 4QT9A 1TNUB 3K7XA 2PMVA 2DRQA 2Z07A 4XUVA 3DSTB 2BB6A 3Q79B 3DSVB 4D94A 5DGQA 1N4SB 1TNYB 2WIIB 2XFGA 3SDUA 1WU5A 1N95B 2AFAA 1IA7A 1X81B 4KKIA 1HCUA 2NVPA 4D4BA 1FBOA 4V1SA 2DROA 4ZRPA 3VW5A 2A73B 3EUVB 4CJ0A 3QFYA 4BOKA 3DSWB 1UT9A 2V3PA 1GAIA 2JJBA 5DGRA 3Q7AB 2ZBLA 1G6IA 3RRSA 3Q78B 4V1RA 3EZ8A 1DL2A 4Q2BA 3KSQB 2B4FA 3WIWA 3RX7A 2VN4A 3WKHA 4EHMB 4LIXA 3M7CA 1GXMA 4LNGB 5FOBB 2QNOA 1QBQB 2YIKA 1SA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JCQ B;  3CU7 A;  1H3C A;  2WY7 A;  3E30 B;  2WY8 A;  2H6F B;  3Q7F B;  5JPM B;  2R2L B;  1N94 B;  4D4A A;  1H36 A;  4FXG B;  2H6H B;  1KZO B;  3D5S A;  3KSL B;  4D4C A;  1O1T B;  1KZP B;  3DSX B;  1NL4 B;  1SA5 B;  4GTP B;  4FXK B;  3E34 B;  5JPN B;  3HXC B;  1FT2 B;  2BBC A;  1O1S B;  1N4R B;  1DCE B;  3Q75 B;  2V8J A;  3HXB B;  3OED A;  4MU9 A;  1H3B A;  1R76 A;  1N4Q B;  3SFX B;  4M76 A;  1MZC B;  5FO9 B;  4YDO B;  1O79 A;  1S64 B;  1QQF A;  1O6H A;  1C3D A;  2V8I A;  3G6J B;  2G0D A;  3DSU B;  4GTQ B;  3E32 B;  5AGD A;  1D8D B;  1FT1 B;  1O1R B;  4ZRQ A;  4ZH1 A;  1UMP A;  3PZ1 B;  2WIN B;  3D5R A;  2XQW A;  4MBG B;  3OXU A;  1D8E B;  3DRA B;  1H3A A;  1LD8 B;  1TNB B;  4GTM B;  1TNU B;  3K7X A;  2XWB B;  3C72 B;  3RJ3 A;  2PMV A;  2G02 A;  4GTT B;  4D4D A;  2XWJ B;  1JCR B;  1TNO B;  1QSJ A;  4BOJ A;  1N9A B;  3DST B;  1GXO A;  3DSS B;  2BB6 A;  1W6J A;  3Q79 B;  3DSV B;  3PZ2 B;  4D94 A;  1LD7 B;  1N4S B;  1TNY B;  1TN7 B;  2H6I B;  3SFY B;  1GHQ A;  2WII B;  1S63 B;  1N95 B;  1X81 B;  1O5M B;  3E33 B;  4LNB B;  2NOJ A;  1GSZ A;  2SQC A;  5FO7 B;  4KKI A;  1H37 A;  4D4B A;  4C1S A;  1TN8 B;  3HXE B;  3PZ4 B;  3E37 B;  4V1S A;  2ZIR B;  3Q73 B;  4ZRP A;  2I07 B;  2A73 B;  1JCS B;  3EUV B;  1TNZ B;  3HXF B;  1W6K A;  3PZ3 B;  2BB5 A;  4BOK A;  3DSW B;  1FPP B;  2GOX A;  2PN5 A;  2V3N A;  2V3P A;  1NI1 B;  4GTS B;  4L9P B;  4KKJ A;  1HZF A;  3KLS A;  3Q7A B;  1TN6 B;  1H35 A;  4LNV A;  3Q78 B;  3EU5 B;  4V1R A;  3DPY B;  2IEJ B;  1N4P B;  1SQC A;  1H39 A;  4ONT A;  3HXD B;  3KSQ B;  3KQ4 A;  2V8K A;  4EHM B;  5FO8 B;  2F0Y B;  2H6G B;  2B39 A;  1LTX B;  1O6Q A;  1GXM A;  4LNG B;  4GTO B;  5FOB B;  2BED B;  1GXN A;  4GTR B;  1O6R A;  2ZIS B;  4YDE B;  3SQC A;  1QBQ B;  4GTV B;  1SA4 B; 
#chains in the Genus database with same CATH topology
 3CU7 A;  5ILJ A;  1H3C A;  2EAC A;  3WKF A;  4TF4 A;  4E1Y A;  3SDQ A;  3Q7F B;  3M7E A;  1N94 B;  1H36 A;  2H6H B;  1KZO B;  1O1T B;  5IL8 A;  1KS8 A;  2FBA A;  1HM3 A;  5JPN B;  3HXC B;  1FT2 B;  2BBC A;  1N4R B;  1N24 A;  3REN A;  1AYX A;  1HXG A;  2ONG A;  3SDV A;  1RW9 A;  1S64 B;  1HX9 A;  4L6X A;  4OZW A;  1WZZ A;  2G0D A;  3QT9 A;  4GTQ B;  2AHG A;  1FT1 B;  4GAX A;  1UMP A;  2WIN B;  3A0O A;  3W5M A;  1L2A A;  3S4B A;  1H3A A;  3K11 A;  1FO3 A;  1LD8 B;  4DOD A;  3NNB A;  4GTM B;  3T33 A;  5CD2 A;  3C72 B;  1F9O A;  2CQS A;  4Z4L A;  1K72 A;  1QSJ A;  1VD5 A;  1GLM A;  3AFJ A;  3DSS B;  1W6J A;  3WKG A;  3PZ2 B;  1TN7 B;  1FBW A;  3SFY B;  1CEM A;  3M75 A;  3RX8 A;  2WDA A;  3M77 A;  4LNB B;  2NOJ A;  2P0V A;  2SQC A;  5FO7 B;  4JJJ A;  4OZV A;  4KTR A;  4C1S A;  3S4D A;  3HXE B;  3M74 A;  3E37 B;  1RWA A;  3S4A A;  2I07 B;  3N0G A;  1FAE A;  5DHK A;  1JCS B;  4Z4J A;  1W6K A;  2D8L A;  1OJN A;  1TF4 A;  3PZ3 B;  1FPP B;  1RWC A;  2GOX A;  5IK6 A;  4DI5 A;  1HZF A;  3LZ9 A;  1TN6 B;  1V5D A;  4LNV A;  4Q88 A;  1N7N A;  3WIQ A;  4F10 A;  2GH4 A;  1N4P B;  1H39 A;  1N7R A;  4ONT A;  4AYO A;  2J5C A;  2EAB A;  3QPF A;  1V7X A;  3M7B A;  3M73 A;  3ANK A;  2BRW A;  2B39 A;  5CZL A;  4GTO B;  2BRV X;  5CA3 A;  3GLY A;  1NC5 A;  3D3I A;  4GTR B;  3M76 A;  2ZIS B;  3GZK A;  3SQC A;  3QT3 A;  4GTV B;  1JCQ B;  4CJ1 A;  1RQ5 A;  3EQA A;  3QXF A;  4WVB A;  2WY7 A;  3E30 B;  5C05 A;  2WY8 A;  2H6F B;  3ON6 A;  2BRP A;  3X17 A;  2R2L B;  4D4C A;  1WU4 A;  1KKT A;  5EAT A;  3M78 A;  1I8Q A;  3SDT A;  4GTP B;  1DCE B;  1XW2 A;  2V8J A;  1ULV A;  3HXB B;  3OED A;  1LF6 A;  3NFV A;  3A3V A;  1N4Q B;  1MZC B;  1O79 A;  3VXD A;  2JF4 A;  5ILK A;  4OJZ A;  5GW7 A;  1V7V A;  3E32 B;  4DOE A;  1HXA A;  1D8D B;  4ZRQ A;  5JMD A;  1XWT A;  4L0G A;  1FO2 A;  1N20 A;  4MBG B;  4NEI A;  3GT5 A;  1L1Y A;  2WYN A;  3E6U A;  3WIR A;  4J5T A;  1TNB B;  1EGU A;  2G02 A;  4GTT B;  4AYQ A;  1GAH A;  1N1B A;  2XWJ B;  1TNO B;  1N23 A;  3H3K A;  1LXK A;  1NXC A;  1GXO A;  1KSD A;  1KWF A;  4CE7 A;  5ILH A;  3W7U A;  3QG0 A;  1LD7 B;  1IS9 A;  1CLC A;  1GHQ A;  5EAS A;  1S63 B;  1XWQ A;  2RGK A;  3QWT A;  2ONH A;  1O5M B;  4OK2 A;  3ACT A;  1HMW A;  5M7Y A;  3ACS A;  1TN8 B;  2FUZ A;  3W7T A;  3P2C A;  2EAD A;  3M71 A;  3HXF B;  1KSC A;  1N7P A;  1OJM A;  3M02 A;  3PYA A;  2PN5 A;  1FMI A;  3VSN A;  4L9P B;  3M01 A;  3ANJ A;  3KLS A;  1N1Z A;  1H35 A;  1AGM A;  5ILY A;  3H2W A;  3EU5 B;  3DPY B;  3E73 A;  1N7O A;  3HXD B;  3W7S A;  2FV1 A;  5FO8 B;  4FJQ A;  2F0Y B;  2H6G B;  1LTX B;  1O6Q A;  4KTP A;  1N7Q A;  2DRS A;  1O6R A;  2GZ6 A;  3P5R A;  1RWG A;  1RWH A;  2AHF A;  3P5P A;  1HM2 A;  5JPM B;  1KRE A;  1H12 A;  2EAE A;  1H13 A;  4FXG B;  2A8Z A;  3QDE A;  1KZP B;  3DSX B;  4WU0 A;  1NL4 B;  3E34 B;  1X1H A;  1WU6 A;  1O1S B;  1DOG A;  3S4C A;  4F13 A;  1F9G A;  1R76 A;  1G9G A;  2Q1F A;  4M76 A;  5FO9 B;  4YDO B;  1V7W A;  1CB8 A;  3QRY A;  1C3D A;  3WKI A;  3ANI A;  2V8I A;  1N21 A;  4ZH1 A;  3PZ1 B;  3VSM A;  3D5R A;  3H7L A;  3OXU A;  2D5J A;  3DRA B;  4AYP A;  3SDR A;  2RI9 A;  3SAE A;  3PMM A;  3W7W A;  3E7J A;  3RX5 A;  2XWB B;  3RJ3 A;  1HXC A;  4TXT A;  4D4D A;  1F9D A;  5DHI A;  1H54 A;  1JCR B;  5ILZ A;  4BOJ A;  5M7I A;  1N9A B;  1J0M A;  5KKB A;  1OJP A;  4WVC A;  1G87 A;  4ZG8 A;  2H6I B;  4WVA A;  2FUT A;  3E33 B;  3TF4 A;  1G9J A;  1GSZ A;  2JG0 A;  2VN7 A;  3M00 A;  1HV6 A;  1X9D A;  1H37 A;  4YCR A;  5EAU A;  3CIH A;  1LF9 A;  2CQT A;  5IL3 A;  3PZ4 B;  2ZIR B;  3Q73 B;  5IK0 A;  1TNZ B;  4OK4 A;  3QXQ A;  2BB5 A;  4EL8 A;  1HN0 A;  3G4D A;  2V3N A;  4GTS B;  1NI1 B;  5IKA A;  5GY3 A;  3S9V A;  3W7X A;  3W5N A;  4FNV A;  4KKJ A;  3M72 A;  1F1S A;  5MEH A;  2IEJ B;  1OJO A;  1SQC A;  3WUX A;  2DRR A;  1QAZ A;  3QFZ A;  1X1J A;  3AFL A;  3KQ4 A;  2ZZR A;  5IKH A;  2V8K A;  3PYB A;  5JMF A;  1J0N A;  1FCE A;  2F6D A;  1IA6 A;  1UG9 A;  2BED B;  1H14 A;  4AYR A;  1GXN A;  4YDE B;  2OKX A;  1KFG A;  2E22 A;  3EU8 A;  3WC3 A;  1JS4 A;  1V5C A;  3RSY A;  4D4A A;  3D5S A;  3KSL B;  1RWF A;  4MMH A;  1SA5 B;  4FXK B;  1FP3 A;  4MU9 A;  3Q75 B;  1C82 A;  2RI8 A;  1H3B A;  3QSP A;  1KRF A;  3M7L A;  3SFX B;  5ILI A;  5E2J A;  1HMU A;  1QQF A;  1O6H A;  5IM1 A;  3G6J B;  3DSU B;  4GL3 A;  4ZH5 A;  3E80 A;  5AGD A;  2FV0 A;  1O1R B;  4FUS A;  2FUQ A;  2XQW A;  1D8E B;  5GZK A;  1GA2 A;  4QT9 A;  1TNU B;  3K7X A;  2PMV A;  2DRQ A;  2Z07 A;  2X03 A;  1X1I A;  4XUV A;  3DST B;  2BB6 A;  1LXM A;  3Q79 B;  4MMI A;  3DSV B;  4D94 A;  5DGQ A;  1N4S B;  1TNY B;  2E24 A;  1LOH A;  2XFG A;  2WII B;  3SDU A;  1WU5 A;  1N95 B;  2AFA A;  3N0F A;  1IA7 A;  1X81 B;  1W3Y A;  4KKI A;  1HCU A;  2NVP A;  4D4B A;  2WCO A;  5ILD A;  1FBO A;  4V1S A;  2DRO A;  4ZRP A;  3VW5 A;  2A73 B;  3EUV B;  4RNQ A;  4CJ0 A;  3QFY A;  4BOK A;  3DSW B;  1UT9 A;  2V3P A;  1GAI A;  2JJB A;  5DGR A;  3Q7A B;  2ZBL A;  1G6I A;  3RRS A;  3Q78 B;  4V1R A;  3EZ8 A;  1DL2 A;  4Q2B A;  3G4F A;  3KSQ B;  2B4F A;  3WIW A;  3RX7 A;  2VN4 A;  3WKH A;  4EHM B;  4LIX A;  5IK9 A;  3M7C A;  1GXM A;  4LNG B;  5FOB B;  2QNO A;  1N22 A;  1QBQ B;  2YIK A;  1SA4 B; 
#chains in the Genus database with same CATH homology
 3CU7 A;  1H3C A;  2EAC A;  3WKF A;  4TF4 A;  3SDQ A;  3Q7F B;  3M7E A;  1N94 B;  1H36 A;  2H6H B;  1KZO B;  1O1T B;  1KS8 A;  2FBA A;  5JPN B;  3HXC B;  1FT2 B;  2BBC A;  1N4R B;  3REN A;  1AYX A;  3SDV A;  1S64 B;  4L6X A;  1WZZ A;  2G0D A;  3QT9 A;  4GTQ B;  2AHG A;  1FT1 B;  1UMP A;  2WIN B;  3W5M A;  1L2A A;  3S4B A;  1H3A A;  3K11 A;  1FO3 A;  1LD8 B;  4DOD A;  4GTM B;  3T33 A;  5CD2 A;  3C72 B;  1F9O A;  2CQS A;  4Z4L A;  1K72 A;  1QSJ A;  1VD5 A;  1GLM A;  3AFJ A;  3DSS B;  1W6J A;  3WKG A;  3PZ2 B;  1TN7 B;  1FBW A;  3SFY B;  1CEM A;  3M75 A;  3RX8 A;  3M77 A;  4LNB B;  2NOJ A;  2P0V A;  2SQC A;  5FO7 B;  4JJJ A;  4KTR A;  4C1S A;  3S4D A;  3HXE B;  3M74 A;  3E37 B;  3S4A A;  2I07 B;  1FAE A;  1JCS B;  4Z4J A;  1W6K A;  2D8L A;  1TF4 A;  3PZ3 B;  1FPP B;  2GOX A;  1HZF A;  1TN6 B;  1V5D A;  4LNV A;  4Q88 A;  3WIQ A;  2GH4 A;  1N4P B;  1H39 A;  4ONT A;  4AYO A;  2EAB A;  3QPF A;  1V7X A;  3M7B A;  3M73 A;  2B39 A;  3ANK A;  5CZL A;  4GTO B;  5CA3 A;  3GLY A;  1NC5 A;  3D3I A;  4GTR B;  3M76 A;  2ZIS B;  3GZK A;  3SQC A;  3QT3 A;  4GTV B;  1JCQ B;  4CJ1 A;  1RQ5 A;  3EQA A;  3QXF A;  4WVB A;  2WY7 A;  3E30 B;  2WY8 A;  2H6F B;  3ON6 A;  3X17 A;  2R2L B;  4D4C A;  1WU4 A;  1KKT A;  3M78 A;  3SDT A;  4GTP B;  1DCE B;  1XW2 A;  2V8J A;  1ULV A;  3HXB B;  3OED A;  1LF6 A;  3A3V A;  1N4Q B;  1MZC B;  1O79 A;  3VXD A;  2JF4 A;  5GW7 A;  1V7V A;  3E32 B;  4DOE A;  1D8D B;  4ZRQ A;  1XWT A;  4L0G A;  1FO2 A;  4MBG B;  3GT5 A;  1L1Y A;  2WYN A;  3E6U A;  3WIR A;  4J5T A;  1TNB B;  2G02 A;  4GTT B;  4AYQ A;  1GAH A;  2XWJ B;  1TNO B;  3H3K A;  1NXC A;  1GXO A;  1KSD A;  1KWF A;  4CE7 A;  3W7U A;  3QG0 A;  1LD7 B;  1IS9 A;  1CLC A;  1GHQ A;  1S63 B;  1XWQ A;  2RGK A;  3QWT A;  1O5M B;  3ACT A;  5M7Y A;  3ACS A;  1TN8 B;  2FUZ A;  3W7T A;  3P2C A;  2EAD A;  3M71 A;  3HXF B;  1KSC A;  3PYA A;  2PN5 A;  1FMI A;  4L9P B;  3ANJ A;  3KLS A;  1H35 A;  1AGM A;  3H2W A;  3EU5 B;  3DPY B;  3E73 A;  3HXD B;  3W7S A;  2FV1 A;  5FO8 B;  2F0Y B;  2H6G B;  1LTX B;  1O6Q A;  4KTP A;  2DRS A;  1O6R A;  2GZ6 A;  3P5R A;  2AHF A;  3P5P A;  5JPM B;  1KRE A;  1H12 A;  2EAE A;  1H13 A;  4FXG B;  2A8Z A;  3QDE A;  1KZP B;  3DSX B;  4WU0 A;  1NL4 B;  3E34 B;  1WU6 A;  1O1S B;  1DOG A;  3S4C A;  1R76 A;  1G9G A;  4M76 A;  5FO9 B;  4YDO B;  1V7W A;  3QRY A;  1C3D A;  3WKI A;  3ANI A;  2V8I A;  4ZH1 A;  3PZ1 B;  3D5R A;  3H7L A;  3OXU A;  2D5J A;  3DRA B;  4AYP A;  3SDR A;  2RI9 A;  3SAE A;  3PMM A;  3W7W A;  3RX5 A;  2XWB B;  3RJ3 A;  4TXT A;  4D4D A;  1F9D A;  1H54 A;  1JCR B;  4BOJ A;  5M7I A;  1N9A B;  5KKB A;  4WVC A;  1G87 A;  4ZG8 A;  2H6I B;  4WVA A;  3E33 B;  3TF4 A;  1G9J A;  1GSZ A;  2JG0 A;  2VN7 A;  1X9D A;  1H37 A;  4YCR A;  3CIH A;  1LF9 A;  2CQT A;  3PZ4 B;  2ZIR B;  3Q73 B;  1TNZ B;  3QXQ A;  2BB5 A;  4EL8 A;  2V3N A;  4GTS B;  1NI1 B;  5GY3 A;  3S9V A;  3W7X A;  3W5N A;  4KKJ A;  3M72 A;  5MEH A;  2IEJ B;  1SQC A;  3WUX A;  2DRR A;  3QFZ A;  3KQ4 A;  2ZZR A;  2V8K A;  3PYB A;  1FCE A;  2F6D A;  1IA6 A;  1UG9 A;  2BED B;  1H14 A;  4AYR A;  1GXN A;  4YDE B;  2OKX A;  1KFG A;  3EU8 A;  3WC3 A;  1JS4 A;  1V5C A;  3RSY A;  4D4A A;  3D5S A;  3KSL B;  1SA5 B;  4FXK B;  1FP3 A;  4MU9 A;  3Q75 B;  2RI8 A;  1H3B A;  3QSP A;  1KRF A;  3M7L A;  3SFX B;  5E2J A;  1QQF A;  1O6H A;  3G6J B;  3DSU B;  4GL3 A;  4ZH5 A;  5AGD A;  2FV0 A;  1O1R B;  4FUS A;  2XQW A;  1D8E B;  5GZK A;  1GA2 A;  4QT9 A;  1TNU B;  3K7X A;  2PMV A;  2DRQ A;  2Z07 A;  4XUV A;  3DST B;  2BB6 A;  3Q79 B;  3DSV B;  4D94 A;  5DGQ A;  1N4S B;  1TNY B;  2WII B;  2XFG A;  3SDU A;  1WU5 A;  1N95 B;  2AFA A;  1IA7 A;  1X81 B;  4KKI A;  1HCU A;  2NVP A;  4D4B A;  1FBO A;  4V1S A;  2DRO A;  4ZRP A;  3VW5 A;  2A73 B;  3EUV B;  4CJ0 A;  3QFY A;  4BOK A;  3DSW B;  1UT9 A;  2V3P A;  1GAI A;  2JJB A;  5DGR A;  3Q7A B;  2ZBL A;  1G6I A;  3RRS A;  3Q78 B;  4V1R A;  3EZ8 A;  1DL2 A;  4Q2B A;  3KSQ B;  2B4F A;  3WIW A;  3RX7 A;  2VN4 A;  3WKH A;  4EHM B;  4LIX A;  3M7C A;  1GXM A;  4LNG B;  5FOB B;  2QNO A;  1QBQ B;  2YIK A;  1SA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...