3HXDB

Engineered rabggtase in complex with a peptidomimetic inhibitor (compound 9)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 118
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3hxdB00
3E34B 2XWJB 4V1RA 4LNVA 2BEDB 2NOJA 3Q7FB 2F0YB 3PZ1B 4M76A 1SA5B 2V3NA 1D8EB 1N4SB 2WY7A 3E33B 3D5RA 2B39A 3KQ4A 4LNBB 2BBCA 3Q7AB 3DSTB 1O6RA 1TNZB 3DSVB 2H6GB 2R2LB 4MBGB 1O1TB 3HXEB 1H3CA 1QBQB 4GTPB 1NI1B 3DRAB 2H6HB 3HXDB 4KKIA 4LNGB 1KZOB 5AGDA 4ZRQA 4BOKA 1FPPB 1C3DA 1GHQA 3OXUA 3E30B 3KSLB 4GTRB 5FOBB 2XWBB 5FO9B 1TN8B 3DSSB 1H3AA 1JCRB 4C1SA 4EHMB 2BB5A 3DPYB 1NL4B 2BB6A 3D5SA 2IEJB 4ONTA 1N95B 1TN7B 2G02A 3SFYB 1GXNA 4D4AA 1R76A 3K7XA 1DCEB 1KZPB 4YDOB 3HXCB 1N9AB 4GTTB 2ZIRB 3CU7A 1LD7B 1FT1B 3KLSA 3SQCA 1FT2B 2PN5A 1S64B 2V3PA 2WINB 3E37B 4D4CA 3E32B 1N4PB 1QSJA 4FXKB 2H6IB 1O1RB 2A73B 3PZ4B 1TN6B 3DSWB 4D94A 3Q79B 3Q78B 1N94B 2PMVA 3HXBB 3PZ3B 1H35A 4ZRPA 2I07B 1TNBB 1SQCA 1H36A 5JPNB 1MZCB 1O79A 1TNYB 1GXMA 3OEDA 4YDEB 1JCQB 5JPMB 1UMPA 1O1SB 3Q75B 4L9PB 1GXOA 4ZH1A 3DSXB 1LTXB 3KSQB 2H6FB 4MU9A 2V8IA 5FO7B 1N4QB 4KKJA 1N4RB 2WIIB 1H3BA 2ZISB 2G0DA 1LD8B 1GSZA 3EU5B 1D8DB 5FO8B 2V8JA 1H39A 3EUVB 1S63B 1HZFA 1JCSB 3Q73B 4D4BA 2XQWA 1O6QA 3SFXB 3RJ3A 3DSUB 3C72B 1H37A 4D4DA 3HXFB 4GTVB 1W6JA 1TNUB 2SQCA 4GTQB 1O5MB 4BOJA 4GTSB 4V1SA 4GTOB 1W6KA 3PZ2B 1TNOB 4FXGB 1O6HA 3G6JB 2WY8A 1X81B 4GTMB 1SA4B 2GOXA 2V8KA 1QQFA
chains in the Genus database with same CATH superfamily
1FMIA 1HX9A 2XWJB 3ACSA 4OJZA 2BEDB 1RW9A 1RWCA 3PZ1B 4M76A 1SA5B 2ZBLA 5DGRA 1X9DA 4LNBB 3M7CA 4FNVA 4L6XA 5E2JA 3DSVB 3SDUA 4MBGB 5DHIA 2AHFA 1NXCA 3G4FA 1H3CA 4GTPB 3DRAB 4BOKA 4TXTA 2WYNA 1LF9A 4GTRB 5FOBB 5FO9B 1TN8B 4C1SA 3DPYB 2IEJB 3QPFA 1HMUA 2BRWA 1UT9A 3A3VA 4D4AA 3QT3A 3E7JA 1DCEB 1VD5A 3M78A 4GTTB 3CU7A 1LD7B 3KLSA 3SDQA 1KWFA 2V3PA 3E37B 3E32B 4ZG8A 4GL3A 5IK0A 4FXKB 3QDEA 5ILKA 3RX7A 1L1YA 1O1RB 3PZ4B 1G9GA 4D94A 4CJ1A 2Z07A 1V7WA 3E73A 3M00A 2I07B 3A0OA 5IM1A 1WU5A 1H36A 1N20A 1O79A 1TNYB 4TF4A 3W5NA 3WC3A 1LOHA 2BRVX 3M72A 2XFGA 5JPMB 2FV0A 3WUXA 1O1SB 4L9PB 1GXOA 3ANJA 1GAHA 3M71A 3M75A 3KSQB 5CD2A 4CE7A 5GZKA 2ZZRA 5FO7B 2DROA 3VW5A 1OJPA 2CQTA 2E24A 4KKJA 1N4RB 2G0DA 1H39A 3S9VA 1V5CA 3Q73B 3QSPA 5ILZA 4Q88A 4AYPA 3DSUB 4RNQA 2WDAA 1AYXA 3M73A 3M7BA 1AGMA 1RWFA 3WKGA 1RWHA 4GTSB 3EQAA 3SDRA 3PMMA 1TNOB 3P5RA 1RWGA 3M01A 1N7PA 1QQFA 5ILYA 1KFGA 4CJ0A 4MMHA 4LNVA 3Q7FB 2F0YB 3AFJA 1H12A 1N4SB 1DOGA 3D5RA 2RGKA 1O6RA 1X1HA 1K72A 5ILHA 3WKFA 3H3KA 3NNBA 3HXEB 1QBQB 1NI1B 4KTPA 3CIHA 2ONHA 3HXDB 1CLCA 4ZRQA 1KZOB 5DHKA 1NC5A 3WIRA 1FPPB 1N7RA 1HN0A 1XWQA 2FUZA 2XWBB 2X03A 4F10A 1H3AA 1JCRB 3SDVA 2BB5A 1NL4B 1OJMA 1N95B 1RQ5A 1FO3A 1GXNA 1QAZA 4EL8A 1F9GA 1R76A 3S4AA 5CZLA 1N24A 4YDOB 2F6DA 1LXMA 4FJQA 2ZIRB 3SQCA 5IL8A 2DRRA 2WINB 2J5CA 4OZWA 2RI9A 1N4PB 2AHGA 3EZ8A 1DL2A 1TN6B 3DSWB 5DGQA 3Q78B 1N22A 3SDTA 1H35A 4AYOA 3QFYA 1TNBB 3QT9A 3S4BA 2YIKA 3RX8A 5JPNB 2AFAA 2EAEA 1JCQB 1HV6A 3WKHA 3QFZA 4ZH1A 5EAUA 4YCRA 3DSXB 3M7EA 1LTXB 1HM2A 1N23A 4Z4JA 2H6FB 3E6UA 3M76A 1F1SA 3QXFA 1GSZA 3E80A 1V7VA 3P2CA 1GAIA 1N1BA 4D4BA 2XQWA 1XWTA 3WIQA 3GT5A 1FBWA 1H37A 1J0MA 1EGUA 4DODA 1L2AA 2GZ6A 2B4FA 2CQSA 1W6KA 1KSDA 2FUTA 1O6HA 3G6JB 1LXKA 2BRPA 2GOXA 4EHMB 2D5JA 3E34B 4AYQA 1G6IA 2DRQA 2FV1A 5IKHA 3N0GA 4ZH5A 2WY7A 3E33B 2B39A 3Q7AB 3X17A 1TNZB 5EATA 2R2LB 3WKIA 1UG9A 1O1TB 2DRSA 4OK4A 1RWAA 4XUVA 3M74A 5KKBA 1C3DA 1GHQA 1FCEA 3OXUA 1N21A 1LF6A 3K11A 3DSSB 4F13A 3W7TA 5C05A 2BB6A 1G9JA 5MEHA 4ONTA 5M7YA 4J5TA 4DOEA 3SFYB 3RX5A 1FO2A 3K7XA 3ACTA 2PN5A 1N7OA 4L0GA 1IS9A 4D4CA 3AFLA 5ILIA 4DI5A 2H6IB 1F9OA 3Q79B 1N94B 2PMVA 2QNOA 3PZ3B 2JJBA 1GA2A 2WCOA 4KTRA 2VN4A 1SQCA 4QT9A 5IK9A 3RRSA 1FAEA 2EACA 3VXDA 1UMPA 3RENA 5M7IA 2EABA 2GH4A 1ULVA 3ANKA 1G87A 4LIXA 1X1IA 2RI8A 2FBAA 1HM3A 1FP3A 2ZISB 1LD8B 5FO8B 1GLMA 2V8JA 3EUVB 1S63B 1H13A 2JF4A 3QWTA 1C82A 2JG0A 1H54A 3SFXB 3M77A 3M02A 3RJ3A 3RSYA 4MMIA 3C72B 4D4DA 4GTVB 1W6JA 4WU0A 1O5MB 1OJOA 3ANIA 3NFVA 4WVCA 2E22A 1KREA 5ILDA 1KRFA 1JS4A 1OJNA 3H7LA 4GTMB 3W5MA 1SA4B 2D8LA 2V3NA 3M7LA 1WU4A 3W7SA 1I8QA 3T33A 4V1RA 5EASA 3H2WA 2NOJA 4GAXA 4NEIA 1J0NA 1D8EB 4WVAA 3KQ4A 2BBCA 3DSTB 4JJJA 2H6GB 1W3YA 3QG0A 3ON6A 1TF4A 1XW2A 4FUSA 3VSMA 2H6HB 4KKIA 4LNGB 5AGDA 3W7XA 2P0VA 1HXCA 1KSCA 3N0FA 4Q2BA 5CA3A 3E30B 3KSLB 3G4DA 3W7WA 3D5SA 2VN7A 3S4DA 1TN7B 5IKAA 2G02A 2ONGA 2A8ZA 4Z4LA 4OK2A 1F9DA 3D3IA 1KZPB 5GW7A 3HXCB 1N9AB 1HMWA 1FT1B 1FT2B 3WIWA 1S64B 2Q1FA 1KS8A 3SAEA 1IA6A 2EADA 1N7QA 3W7UA 3VSNA 1KKTA 1CB8A 1QSJA 5JMDA 2NVPA 2A73B 5GY3A 3HXBB 3TF4A 3GZKA 1V5DA 1X1JA 4ZRPA 4AYRA 3EU8A 1MZCB 1HXAA 1GXMA 3OEDA 4YDEB 1HCUA 3Q75B 1WU6A 3LZ9A 5JMFA 4MU9A 3QRYA 2V8IA 3QXQA 1CEMA 1N4QB 2WIIB 1H3BA 3EU5B 4WVBA 1D8DB 3PYAA 3PYBA 1HZFA 1JCSB 2OKXA 1V7XA 1WZZA 1HXGA 1O6QA 1FBOA 4E1YA 3HXFB 2SQCA 1TNUB 4GTQB 4BOJA 5ILJA 3GLYA 5IK6A 3S4CA 5IL3A 4V1SA 4GTOB 3P5PA 1N1ZA 3PZ2B 4FXGB 4OZVA 1N7NA 2WY8A 1X81B 2FUQA 1IA7A 1H14A 2V8KA
chains in the Genus database with same CATH topology
1FMIA 2XWJB 3ACSA 2BEDB 3PZ1B 4M76A 1SA5B 2ZBLA 5DGRA 1X9DA 4LNBB 3M7CA 4L6XA 5E2JA 3DSVB 3SDUA 4MBGB 2AHFA 1NXCA 1H3CA 4GTPB 3DRAB 4BOKA 4TXTA 2WYNA 1LF9A 4GTRB 5FOBB 5FO9B 1TN8B 4C1SA 3DPYB 2IEJB 3QPFA 1UT9A 3A3VA 4D4AA 3QT3A 1DCEB 1VD5A 3M78A 4GTTB 3CU7A 1LD7B 3KLSA 3SDQA 1KWFA 2V3PA 3E37B 3E32B 4ZG8A 4GL3A 4FXKB 3QDEA 3RX7A 1L1YA 1O1RB 3PZ4B 1G9GA 4D94A 4CJ1A 2Z07A 1V7WA 3E73A 2I07B 1WU5A 1H36A 1O79A 1TNYB 4TF4A 3W5NA 3WC3A 3M72A 2XFGA 5JPMB 2FV0A 3WUXA 1O1SB 4L9PB 1GXOA 3ANJA 1GAHA 3M71A 3M75A 3KSQB 5CD2A 4CE7A 5GZKA 2ZZRA 5FO7B 2DROA 3VW5A 2CQTA 4KKJA 1N4RB 2G0DA 1H39A 3S9VA 1V5CA 3Q73B 3QSPA 4Q88A 4AYPA 3DSUB 1AYXA 3M73A 3M7BA 1AGMA 3WKGA 4GTSB 3EQAA 3SDRA 3PMMA 1TNOB 3P5RA 1QQFA 1KFGA 4CJ0A 4LNVA 3Q7FB 2F0YB 3AFJA 1H12A 1N4SB 1DOGA 3D5RA 2RGKA 1O6RA 1K72A 3WKFA 3H3KA 3HXEB 1QBQB 1NI1B 4KTPA 3CIHA 3HXDB 1CLCA 4ZRQA 1KZOB 1NC5A 3WIRA 1FPPB 1XWQA 2FUZA 2XWBB 1H3AA 1JCRB 3SDVA 2BB5A 1NL4B 1N95B 1RQ5A 1FO3A 1GXNA 4EL8A 1R76A 3S4AA 5CZLA 4YDOB 2F6DA 2ZIRB 3SQCA 2DRRA 2WINB 2RI9A 1N4PB 2AHGA 3EZ8A 1DL2A 1TN6B 3DSWB 5DGQA 3Q78B 3SDTA 1H35A 4AYOA 3QFYA 1TNBB 3QT9A 3S4BA 2YIKA 3RX8A 5JPNB 2AFAA 2EAEA 1JCQB 3WKHA 3QFZA 4ZH1A 4YCRA 3DSXB 3M7EA 1LTXB 4Z4JA 2H6FB 3E6UA 3M76A 3QXFA 1GSZA 1V7VA 3P2CA 1GAIA 4D4BA 2XQWA 1XWTA 3WIQA 3GT5A 1FBWA 1H37A 4DODA 1L2AA 2GZ6A 2B4FA 2CQSA 1W6KA 1KSDA 1O6HA 3G6JB 2GOXA 4EHMB 2D5JA 3E34B 4AYQA 1G6IA 2DRQA 2FV1A 4ZH5A 2WY7A 3E33B 2B39A 3Q7AB 3X17A 1TNZB 2R2LB 3WKIA 1UG9A 1O1TB 2DRSA 4XUVA 3M74A 5KKBA 1C3DA 1GHQA 1FCEA 3OXUA 1LF6A 3K11A 3DSSB 3W7TA 2BB6A 1G9JA 5MEHA 4ONTA 5M7YA 4J5TA 4DOEA 3SFYB 3RX5A 1FO2A 3K7XA 3ACTA 2PN5A 4L0GA 1IS9A 4D4CA 2H6IB 1F9OA 3Q79B 1N94B 2PMVA 2QNOA 3PZ3B 2JJBA 1GA2A 4KTRA 2VN4A 1SQCA 4QT9A 3RRSA 1FAEA 2EACA 3VXDA 1UMPA 3RENA 5M7IA 2EABA 2GH4A 1ULVA 3ANKA 1G87A 4LIXA 2RI8A 2FBAA 1FP3A 2ZISB 1LD8B 5FO8B 1GLMA 2V8JA 3EUVB 1S63B 1H13A 2JF4A 3QWTA 2JG0A 1H54A 3SFXB 3M77A 3RJ3A 3RSYA 3C72B 4D4DA 4GTVB 1W6JA 4WU0A 1O5MB 3ANIA 4WVCA 1KREA 1KRFA 1JS4A 3H7LA 4GTMB 3W5MA 1SA4B 2D8LA 2V3NA 3M7LA 1WU4A 3W7SA 3T33A 4V1RA 3H2WA 2NOJA 1D8EB 4WVAA 3KQ4A 2BBCA 3DSTB 4JJJA 2H6GB 3QG0A 3ON6A 1TF4A 1XW2A 4FUSA 2H6HB 4KKIA 4LNGB 5AGDA 3W7XA 2P0VA 1KSCA 4Q2BA 5CA3A 3E30B 3KSLB 3W7WA 3D5SA 2VN7A 3S4DA 1TN7B 2G02A 2A8ZA 4Z4LA 1F9DA 3D3IA 1KZPB 5GW7A 3HXCB 1N9AB 1FT1B 1FT2B 3WIWA 1S64B 3SAEA 1KS8A 1IA6A 2EADA 3W7UA 1KKTA 1QSJA 2NVPA 2A73B 5GY3A 3HXBB 3TF4A 3GZKA 1V5DA 4ZRPA 4AYRA 3EU8A 1MZCB 1GXMA 3OEDA 4YDEB 1HCUA 3Q75B 1WU6A 4MU9A 3QRYA 2V8IA 3QXQA 1CEMA 1N4QB 2WIIB 1H3BA 3EU5B 4WVBA 1D8DB 3PYAA 3PYBA 1HZFA 1JCSB 2OKXA 1V7XA 1WZZA 1O6QA 1FBOA 3HXFB 2SQCA 1TNUB 4GTQB 4BOJA 3GLYA 3S4CA 4V1SA 4GTOB 3P5PA 3PZ2B 4FXGB 2WY8A 1X81B 1IA7A 1H14A 2V8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E34 B;  2XWJ B;  4V1R A;  4LNV A;  2BED B;  2NOJ A;  3Q7F B;  2F0Y B;  3PZ1 B;  4M76 A;  1SA5 B;  2V3N A;  1D8E B;  1N4S B;  2WY7 A;  3E33 B;  3D5R A;  2B39 A;  3KQ4 A;  4LNB B;  2BBC A;  3Q7A B;  3DST B;  1O6R A;  1TNZ B;  3DSV B;  2H6G B;  2R2L B;  4MBG B;  1O1T B;  3HXE B;  1H3C A;  1QBQ B;  4GTP B;  1NI1 B;  3DRA B;  2H6H B;  3HXD B;  4KKI A;  4LNG B;  1KZO B;  5AGD A;  4ZRQ A;  4BOK A;  1FPP B;  1C3D A;  1GHQ A;  3OXU A;  3E30 B;  3KSL B;  4GTR B;  5FOB B;  2XWB B;  5FO9 B;  1TN8 B;  3DSS B;  1H3A A;  1JCR B;  4C1S A;  4EHM B;  2BB5 A;  3DPY B;  1NL4 B;  2BB6 A;  3D5S A;  2IEJ B;  4ONT A;  1N95 B;  1TN7 B;  2G02 A;  3SFY B;  1GXN A;  4D4A A;  1R76 A;  3K7X A;  1DCE B;  1KZP B;  4YDO B;  3HXC B;  1N9A B;  4GTT B;  2ZIR B;  3CU7 A;  1LD7 B;  1FT1 B;  3KLS A;  3SQC A;  1FT2 B;  2PN5 A;  1S64 B;  2V3P A;  2WIN B;  3E37 B;  4D4C A;  3E32 B;  1N4P B;  1QSJ A;  4FXK B;  2H6I B;  1O1R B;  2A73 B;  3PZ4 B;  1TN6 B;  3DSW B;  4D94 A;  3Q79 B;  3Q78 B;  1N94 B;  2PMV A;  3HXB B;  3PZ3 B;  1H35 A;  4ZRP A;  2I07 B;  1TNB B;  1SQC A;  1H36 A;  5JPN B;  1MZC B;  1O79 A;  1TNY B;  1GXM A;  3OED A;  4YDE B;  1JCQ B;  5JPM B;  1UMP A;  1O1S B;  3Q75 B;  4L9P B;  1GXO A;  4ZH1 A;  3DSX B;  1LTX B;  3KSQ B;  2H6F B;  4MU9 A;  2V8I A;  5FO7 B;  1N4Q B;  4KKJ A;  1N4R B;  2WII B;  1H3B A;  2ZIS B;  2G0D A;  1LD8 B;  1GSZ A;  3EU5 B;  1D8D B;  5FO8 B;  2V8J A;  1H39 A;  3EUV B;  1S63 B;  1HZF A;  1JCS B;  3Q73 B;  4D4B A;  2XQW A;  1O6Q A;  3SFX B;  3RJ3 A;  3DSU B;  3C72 B;  1H37 A;  4D4D A;  3HXF B;  4GTV B;  1W6J A;  1TNU B;  2SQC A;  4GTQ B;  1O5M B;  4BOJ A;  4GTS B;  4V1S A;  4GTO B;  1W6K A;  3PZ2 B;  1TNO B;  4FXG B;  1O6H A;  3G6J B;  2WY8 A;  1X81 B;  4GTM B;  1SA4 B;  2GOX A;  2V8K A;  1QQF A; 
#chains in the Genus database with same CATH topology
 1FMI A;  1HX9 A;  2XWJ B;  3ACS A;  4OJZ A;  2BED B;  1RW9 A;  1RWC A;  3PZ1 B;  4M76 A;  1SA5 B;  2ZBL A;  5DGR A;  1X9D A;  4LNB B;  3M7C A;  4FNV A;  4L6X A;  5E2J A;  3DSV B;  3SDU A;  4MBG B;  5DHI A;  2AHF A;  1NXC A;  3G4F A;  1H3C A;  4GTP B;  3DRA B;  4BOK A;  4TXT A;  2WYN A;  1LF9 A;  4GTR B;  5FOB B;  5FO9 B;  1TN8 B;  4C1S A;  3DPY B;  2IEJ B;  3QPF A;  1HMU A;  2BRW A;  1UT9 A;  3A3V A;  4D4A A;  3QT3 A;  3E7J A;  1DCE B;  1VD5 A;  3M78 A;  4GTT B;  3CU7 A;  1LD7 B;  3KLS A;  3SDQ A;  1KWF A;  2V3P A;  3E37 B;  3E32 B;  4ZG8 A;  4GL3 A;  5IK0 A;  4FXK B;  3QDE A;  5ILK A;  3RX7 A;  1L1Y A;  1O1R B;  3PZ4 B;  1G9G A;  4D94 A;  4CJ1 A;  2Z07 A;  1V7W A;  3E73 A;  3M00 A;  2I07 B;  3A0O A;  5IM1 A;  1WU5 A;  1H36 A;  1N20 A;  1O79 A;  1TNY B;  4TF4 A;  3W5N A;  3WC3 A;  1LOH A;  2BRV X;  3M72 A;  2XFG A;  5JPM B;  2FV0 A;  3WUX A;  1O1S B;  4L9P B;  1GXO A;  3ANJ A;  1GAH A;  3M71 A;  3M75 A;  3KSQ B;  5CD2 A;  4CE7 A;  5GZK A;  2ZZR A;  5FO7 B;  2DRO A;  3VW5 A;  1OJP A;  2CQT A;  2E24 A;  4KKJ A;  1N4R B;  2G0D A;  1H39 A;  3S9V A;  1V5C A;  3Q73 B;  3QSP A;  5ILZ A;  4Q88 A;  4AYP A;  3DSU B;  4RNQ A;  2WDA A;  1AYX A;  3M73 A;  3M7B A;  1AGM A;  1RWF A;  3WKG A;  1RWH A;  4GTS B;  3EQA A;  3SDR A;  3PMM A;  1TNO B;  3P5R A;  1RWG A;  3M01 A;  1N7P A;  1QQF A;  5ILY A;  1KFG A;  4CJ0 A;  4MMH A;  4LNV A;  3Q7F B;  2F0Y B;  3AFJ A;  1H12 A;  1N4S B;  1DOG A;  3D5R A;  2RGK A;  1O6R A;  1X1H A;  1K72 A;  5ILH A;  3WKF A;  3H3K A;  3NNB A;  3HXE B;  1QBQ B;  1NI1 B;  4KTP A;  3CIH A;  2ONH A;  3HXD B;  1CLC A;  4ZRQ A;  1KZO B;  5DHK A;  1NC5 A;  3WIR A;  1FPP B;  1N7R A;  1HN0 A;  1XWQ A;  2FUZ A;  2XWB B;  2X03 A;  4F10 A;  1H3A A;  1JCR B;  3SDV A;  2BB5 A;  1NL4 B;  1OJM A;  1N95 B;  1RQ5 A;  1FO3 A;  1GXN A;  1QAZ A;  4EL8 A;  1F9G A;  1R76 A;  3S4A A;  5CZL A;  1N24 A;  4YDO B;  2F6D A;  1LXM A;  4FJQ A;  2ZIR B;  3SQC A;  5IL8 A;  2DRR A;  2WIN B;  2J5C A;  4OZW A;  2RI9 A;  1N4P B;  2AHG A;  3EZ8 A;  1DL2 A;  1TN6 B;  3DSW B;  5DGQ A;  3Q78 B;  1N22 A;  3SDT A;  1H35 A;  4AYO A;  3QFY A;  1TNB B;  3QT9 A;  3S4B A;  2YIK A;  3RX8 A;  5JPN B;  2AFA A;  2EAE A;  1JCQ B;  1HV6 A;  3WKH A;  3QFZ A;  4ZH1 A;  5EAU A;  4YCR A;  3DSX B;  3M7E A;  1LTX B;  1HM2 A;  1N23 A;  4Z4J A;  2H6F B;  3E6U A;  3M76 A;  1F1S A;  3QXF A;  1GSZ A;  3E80 A;  1V7V A;  3P2C A;  1GAI A;  1N1B A;  4D4B A;  2XQW A;  1XWT A;  3WIQ A;  3GT5 A;  1FBW A;  1H37 A;  1J0M A;  1EGU A;  4DOD A;  1L2A A;  2GZ6 A;  2B4F A;  2CQS A;  1W6K A;  1KSD A;  2FUT A;  1O6H A;  3G6J B;  1LXK A;  2BRP A;  2GOX A;  4EHM B;  2D5J A;  3E34 B;  4AYQ A;  1G6I A;  2DRQ A;  2FV1 A;  5IKH A;  3N0G A;  4ZH5 A;  2WY7 A;  3E33 B;  2B39 A;  3Q7A B;  3X17 A;  1TNZ B;  5EAT A;  2R2L B;  3WKI A;  1UG9 A;  1O1T B;  2DRS A;  4OK4 A;  1RWA A;  4XUV A;  3M74 A;  5KKB A;  1C3D A;  1GHQ A;  1FCE A;  3OXU A;  1N21 A;  1LF6 A;  3K11 A;  3DSS B;  4F13 A;  3W7T A;  5C05 A;  2BB6 A;  1G9J A;  5MEH A;  4ONT A;  5M7Y A;  4J5T A;  4DOE A;  3SFY B;  3RX5 A;  1FO2 A;  3K7X A;  3ACT A;  2PN5 A;  1N7O A;  4L0G A;  1IS9 A;  4D4C A;  3AFL A;  5ILI A;  4DI5 A;  2H6I B;  1F9O A;  3Q79 B;  1N94 B;  2PMV A;  2QNO A;  3PZ3 B;  2JJB A;  1GA2 A;  2WCO A;  4KTR A;  2VN4 A;  1SQC A;  4QT9 A;  5IK9 A;  3RRS A;  1FAE A;  2EAC A;  3VXD A;  1UMP A;  3REN A;  5M7I A;  2EAB A;  2GH4 A;  1ULV A;  3ANK A;  1G87 A;  4LIX A;  1X1I A;  2RI8 A;  2FBA A;  1HM3 A;  1FP3 A;  2ZIS B;  1LD8 B;  5FO8 B;  1GLM A;  2V8J A;  3EUV B;  1S63 B;  1H13 A;  2JF4 A;  3QWT A;  1C82 A;  2JG0 A;  1H54 A;  3SFX B;  3M77 A;  3M02 A;  3RJ3 A;  3RSY A;  4MMI A;  3C72 B;  4D4D A;  4GTV B;  1W6J A;  4WU0 A;  1O5M B;  1OJO A;  3ANI A;  3NFV A;  4WVC A;  2E22 A;  1KRE A;  5ILD A;  1KRF A;  1JS4 A;  1OJN A;  3H7L A;  4GTM B;  3W5M A;  1SA4 B;  2D8L A;  2V3N A;  3M7L A;  1WU4 A;  3W7S A;  1I8Q A;  3T33 A;  4V1R A;  5EAS A;  3H2W A;  2NOJ A;  4GAX A;  4NEI A;  1J0N A;  1D8E B;  4WVA A;  3KQ4 A;  2BBC A;  3DST B;  4JJJ A;  2H6G B;  1W3Y A;  3QG0 A;  3ON6 A;  1TF4 A;  1XW2 A;  4FUS A;  3VSM A;  2H6H B;  4KKI A;  4LNG B;  5AGD A;  3W7X A;  2P0V A;  1HXC A;  1KSC A;  3N0F A;  4Q2B A;  5CA3 A;  3E30 B;  3KSL B;  3G4D A;  3W7W A;  3D5S A;  2VN7 A;  3S4D A;  1TN7 B;  5IKA A;  2G02 A;  2ONG A;  2A8Z A;  4Z4L A;  4OK2 A;  1F9D A;  3D3I A;  1KZP B;  5GW7 A;  3HXC B;  1N9A B;  1HMW A;  1FT1 B;  1FT2 B;  3WIW A;  1S64 B;  2Q1F A;  1KS8 A;  3SAE A;  1IA6 A;  2EAD A;  1N7Q A;  3W7U A;  3VSN A;  1KKT A;  1CB8 A;  1QSJ A;  5JMD A;  2NVP A;  2A73 B;  5GY3 A;  3HXB B;  3TF4 A;  3GZK A;  1V5D A;  1X1J A;  4ZRP A;  4AYR A;  3EU8 A;  1MZC B;  1HXA A;  1GXM A;  3OED A;  4YDE B;  1HCU A;  3Q75 B;  1WU6 A;  3LZ9 A;  5JMF A;  4MU9 A;  3QRY A;  2V8I A;  3QXQ A;  1CEM A;  1N4Q B;  2WII B;  1H3B A;  3EU5 B;  4WVB A;  1D8D B;  3PYA A;  3PYB A;  1HZF A;  1JCS B;  2OKX A;  1V7X A;  1WZZ A;  1HXG A;  1O6Q A;  1FBO A;  4E1Y A;  3HXF B;  2SQC A;  1TNU B;  4GTQ B;  4BOJ A;  5ILJ A;  3GLY A;  5IK6 A;  3S4C A;  5IL3 A;  4V1S A;  4GTO B;  3P5P A;  1N1Z A;  3PZ2 B;  4FXG B;  4OZV A;  1N7N A;  2WY8 A;  1X81 B;  2FUQ A;  1IA7 A;  1H14 A;  2V8K A; 
#chains in the Genus database with same CATH homology
 1FMI A;  2XWJ B;  3ACS A;  2BED B;  3PZ1 B;  4M76 A;  1SA5 B;  2ZBL A;  5DGR A;  1X9D A;  4LNB B;  3M7C A;  4L6X A;  5E2J A;  3DSV B;  3SDU A;  4MBG B;  2AHF A;  1NXC A;  1H3C A;  4GTP B;  3DRA B;  4BOK A;  4TXT A;  2WYN A;  1LF9 A;  4GTR B;  5FOB B;  5FO9 B;  1TN8 B;  4C1S A;  3DPY B;  2IEJ B;  3QPF A;  1UT9 A;  3A3V A;  4D4A A;  3QT3 A;  1DCE B;  1VD5 A;  3M78 A;  4GTT B;  3CU7 A;  1LD7 B;  3KLS A;  3SDQ A;  1KWF A;  2V3P A;  3E37 B;  3E32 B;  4ZG8 A;  4GL3 A;  4FXK B;  3QDE A;  3RX7 A;  1L1Y A;  1O1R B;  3PZ4 B;  1G9G A;  4D94 A;  4CJ1 A;  2Z07 A;  1V7W A;  3E73 A;  2I07 B;  1WU5 A;  1H36 A;  1O79 A;  1TNY B;  4TF4 A;  3W5N A;  3WC3 A;  3M72 A;  2XFG A;  5JPM B;  2FV0 A;  3WUX A;  1O1S B;  4L9P B;  1GXO A;  3ANJ A;  1GAH A;  3M71 A;  3M75 A;  3KSQ B;  5CD2 A;  4CE7 A;  5GZK A;  2ZZR A;  5FO7 B;  2DRO A;  3VW5 A;  2CQT A;  4KKJ A;  1N4R B;  2G0D A;  1H39 A;  3S9V A;  1V5C A;  3Q73 B;  3QSP A;  4Q88 A;  4AYP A;  3DSU B;  1AYX A;  3M73 A;  3M7B A;  1AGM A;  3WKG A;  4GTS B;  3EQA A;  3SDR A;  3PMM A;  1TNO B;  3P5R A;  1QQF A;  1KFG A;  4CJ0 A;  4LNV A;  3Q7F B;  2F0Y B;  3AFJ A;  1H12 A;  1N4S B;  1DOG A;  3D5R A;  2RGK A;  1O6R A;  1K72 A;  3WKF A;  3H3K A;  3HXE B;  1QBQ B;  1NI1 B;  4KTP A;  3CIH A;  3HXD B;  1CLC A;  4ZRQ A;  1KZO B;  1NC5 A;  3WIR A;  1FPP B;  1XWQ A;  2FUZ A;  2XWB B;  1H3A A;  1JCR B;  3SDV A;  2BB5 A;  1NL4 B;  1N95 B;  1RQ5 A;  1FO3 A;  1GXN A;  4EL8 A;  1R76 A;  3S4A A;  5CZL A;  4YDO B;  2F6D A;  2ZIR B;  3SQC A;  2DRR A;  2WIN B;  2RI9 A;  1N4P B;  2AHG A;  3EZ8 A;  1DL2 A;  1TN6 B;  3DSW B;  5DGQ A;  3Q78 B;  3SDT A;  1H35 A;  4AYO A;  3QFY A;  1TNB B;  3QT9 A;  3S4B A;  2YIK A;  3RX8 A;  5JPN B;  2AFA A;  2EAE A;  1JCQ B;  3WKH A;  3QFZ A;  4ZH1 A;  4YCR A;  3DSX B;  3M7E A;  1LTX B;  4Z4J A;  2H6F B;  3E6U A;  3M76 A;  3QXF A;  1GSZ A;  1V7V A;  3P2C A;  1GAI A;  4D4B A;  2XQW A;  1XWT A;  3WIQ A;  3GT5 A;  1FBW A;  1H37 A;  4DOD A;  1L2A A;  2GZ6 A;  2B4F A;  2CQS A;  1W6K A;  1KSD A;  1O6H A;  3G6J B;  2GOX A;  4EHM B;  2D5J A;  3E34 B;  4AYQ A;  1G6I A;  2DRQ A;  2FV1 A;  4ZH5 A;  2WY7 A;  3E33 B;  2B39 A;  3Q7A B;  3X17 A;  1TNZ B;  2R2L B;  3WKI A;  1UG9 A;  1O1T B;  2DRS A;  4XUV A;  3M74 A;  5KKB A;  1C3D A;  1GHQ A;  1FCE A;  3OXU A;  1LF6 A;  3K11 A;  3DSS B;  3W7T A;  2BB6 A;  1G9J A;  5MEH A;  4ONT A;  5M7Y A;  4J5T A;  4DOE A;  3SFY B;  3RX5 A;  1FO2 A;  3K7X A;  3ACT A;  2PN5 A;  4L0G A;  1IS9 A;  4D4C A;  2H6I B;  1F9O A;  3Q79 B;  1N94 B;  2PMV A;  2QNO A;  3PZ3 B;  2JJB A;  1GA2 A;  4KTR A;  2VN4 A;  1SQC A;  4QT9 A;  3RRS A;  1FAE A;  2EAC A;  3VXD A;  1UMP A;  3REN A;  5M7I A;  2EAB A;  2GH4 A;  1ULV A;  3ANK A;  1G87 A;  4LIX A;  2RI8 A;  2FBA A;  1FP3 A;  2ZIS B;  1LD8 B;  5FO8 B;  1GLM A;  2V8J A;  3EUV B;  1S63 B;  1H13 A;  2JF4 A;  3QWT A;  2JG0 A;  1H54 A;  3SFX B;  3M77 A;  3RJ3 A;  3RSY A;  3C72 B;  4D4D A;  4GTV B;  1W6J A;  4WU0 A;  1O5M B;  3ANI A;  4WVC A;  1KRE A;  1KRF A;  1JS4 A;  3H7L A;  4GTM B;  3W5M A;  1SA4 B;  2D8L A;  2V3N A;  3M7L A;  1WU4 A;  3W7S A;  3T33 A;  4V1R A;  3H2W A;  2NOJ A;  1D8E B;  4WVA A;  3KQ4 A;  2BBC A;  3DST B;  4JJJ A;  2H6G B;  3QG0 A;  3ON6 A;  1TF4 A;  1XW2 A;  4FUS A;  2H6H B;  4KKI A;  4LNG B;  5AGD A;  3W7X A;  2P0V A;  1KSC A;  4Q2B A;  5CA3 A;  3E30 B;  3KSL B;  3W7W A;  3D5S A;  2VN7 A;  3S4D A;  1TN7 B;  2G02 A;  2A8Z A;  4Z4L A;  1F9D A;  3D3I A;  1KZP B;  5GW7 A;  3HXC B;  1N9A B;  1FT1 B;  1FT2 B;  3WIW A;  1S64 B;  3SAE A;  1KS8 A;  1IA6 A;  2EAD A;  3W7U A;  1KKT A;  1QSJ A;  2NVP A;  2A73 B;  5GY3 A;  3HXB B;  3TF4 A;  3GZK A;  1V5D A;  4ZRP A;  4AYR A;  3EU8 A;  1MZC B;  1GXM A;  3OED A;  4YDE B;  1HCU A;  3Q75 B;  1WU6 A;  4MU9 A;  3QRY A;  2V8I A;  3QXQ A;  1CEM A;  1N4Q B;  2WII B;  1H3B A;  3EU5 B;  4WVB A;  1D8D B;  3PYA A;  3PYB A;  1HZF A;  1JCS B;  2OKX A;  1V7X A;  1WZZ A;  1O6Q A;  1FBO A;  3HXF B;  2SQC A;  1TNU B;  4GTQ B;  4BOJ A;  3GLY A;  3S4C A;  4V1S A;  4GTO B;  3P5P A;  3PZ2 B;  4FXG B;  2WY8 A;  1X81 B;  1IA7 A;  1H14 A;  2V8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...