2DRSA

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263s mutant
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
379
structure length
379
Chain Sequence
KTTEGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPETKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSSSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase Y
publication title Structural explanation for the acquisition of glycosynthase activity
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 154
structure length 379
sequence length 379
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2drsA01
3QWTA 1GAIA 3WKFA 2VN4A 3VW5A 5E2JA 2FV1A 3ACSA 4L6XA 3S4DA 3WIWA 1H13A 4Q88A 2AFAA 1TF4A 4ZG8A 3QRYA 3WUXA 2QNOA 1FMIA 3WKGA 2JJBA 4Q2BA 5M7IA 3QPFA 2Z07A 1H12A 4XUVA 1WU4A 2B4FA 1IA7A 4CE7A 1V7XA 4JJJA 1NXCA 4EL8A 2FV0A 1IS9A 4TXTA 3RRSA 2EAEA 4TF4A 3RENA 3RSYA 1G6IA 2RI8A 3E73A 3QDEA 3EZ8A 3H3KA 4ZH5A 2CQTA 2JG0A 3H7LA 5CZLA 1K72A 1XWQA 3W5NA 5MEHA 3X17A 3S4BA 3K11A 2EADA 4WU0A 3QG0A 4AYRA 1FCEA 1XWTA 1KRFA 2ZBLA 3QT9A 1DL2A 2AHFA 3W7SA 1LF9A 1H14A 5CA3A 4Z4LA 2RI9A 1CEMA 2CQSA 3QXFA 4WVCA 3ANJA 4DOEA 3W7UA 5GW7A 2EABA 5DGRA 5DGQA 1L2AA 2JF4A 3PMMA 4AYPA 1KREA 2DRRA 2YIKA 1NC5A 1H54A 1GAHA 1UT9A 1FO2A 3S4AA 3QFZA 3QT3A 2D5JA 2A8ZA 3WIQA 2RGKA 3ON6A 3GT5A 3EQAA 5GY3A 3A3VA 1FBWA 2DRSA 1V7WA 1HCUA 3S4CA 2OKXA 3ANIA 1G9JA 3WKHA 5KKBA 2ZZRA 3WKIA 1FP3A 4CJ1A 3T33A 4DODA 1ULVA 1X9DA 3W7WA 1XW2A 3WC3A 3W7TA 1DOGA 3AFJA 3QXQA 2NVPA 1FBOA 1F9DA 1CLCA 1WU5A 3W5MA 1G87A 3W7XA 1V5CA 2VN7A 1F9OA 1UG9A 3VXDA 2FBAA 2EACA 1GA2A 1KS8A 1KKTA 1LF6A 1FAEA 2GH4A 2XFGA 3P2CA 3QFYA 3D3IA 1KSDA 4Z4JA 3RX8A 2F6DA 4WVBA 4AYOA 1L1YA 4KTRA 5CD2A 3RX5A 3H2WA 1KWFA 2DROA 4WVAA 2P0VA 1WU6A 2D8LA 1V5DA 5M7YA 3ANKA 4CJ0A 4L0GA 3WIRA 2WYNA 2DRQA 1G9GA 1GLMA 3CIHA 2AHGA 2FUZA 1IA6A 1KFGA 1AYXA 3E6UA 3QSPA 1JS4A 4FUSA 1KSCA 1V7VA 1RQ5A 2GZ6A 3GLYA 4J5TA 3RX7A 1WZZA 3GZKA 1FO3A 1VD5A 1AGMA 4AYQA 3ACTA 3TF4A 4KTPA
chains in the Genus database with same CATH superfamily
4FNVA 1GAIA 3VW5A 5E2JA 3DPYB 1HM3A 2A73B 2BRWA 1TF4A 1HXGA 1W6KA 1R76A 5M7IA 2FUQA 3M72A 1N4SB 1IA7A 2B4FA 3PYBA 1LD7B 1NXCA 4EL8A 1LXMA 2SQCA 3RRSA 3M7BA 3E7JA 3RENA 1G6IA 4MMIA 4OK2A 3EZ8A 4EHMB 1XWQA 1TNYB 3HXBB 2FUTA 4OJZA 3EU5B 5EATA 3S4BA 5FO8B 1HMUA 2WCOA 3M73A 1XWTA 1H3CA 2ZBLA 5IKHA 1H3BA 4OK4A 4LIXA 4FJQA 2RI9A 3QXFA 4GTSB 5DGRA 3PMMA 1KREA 2I07B 4ZRPA 1QAZA 2B39A 1RWGA 1GAHA 1UT9A 3Q79B 3S4AA 2WY8A 3QFZA 2D5JA 3P5PA 1X1HA 1LTXB 5GY3A 4OZVA 2DRSA 3E30B 1HCUA 2V3PA 3ANIA 4CJ1A 1FP3A 5IL3A 1N21A 3T33A 5JMDA 1X9DA 2BEDB 3W7WA 3W7TA 1H3AA 3AFJA 3PZ4B 3QXQA 2ONHA 4D94A 1F9DA 5ILDA 5IK9A 4LNVA 3VXDA 2FBAA 2EACA 4MMHA 1TNBB 3DSVB 1GXMA 2XFGA 1KSDA 4GTTB 1HN0A 5IL8A 1GXNA 4AYOA 1N7NA 3PYAA 2P0VA 2XWBB 3CU7A 1V5DA 2NOJA 4CJ0A 5JPNB 1RWAA 4L9PB 5FO7B 1N4QB 3CIHA 3QSPA 1KFGA 1JS4A 4ZRQA 1TN7B 1KSCA 3GLYA 1WZZA 4OZWA 1C82A 4KTPA 1O1TB 3DSXB 1D8DB 1F9GA 4E1YA 5ILYA 1NI1B 2XWJB 1H13A 4D4BA 1W3YA 4Q88A 1N4PB 2AFAA 1FMIA 2JJBA 4Q2BA 4LNGB 4QT9A 3KSQB 2Z07A 3OEDA 3PZ3B 1V7XA 1N20A 2FV0A 1IS9A 4TXTA 1JCQB 3RSYA 2V8KA 3E73A 3QDEA 1C3DA 1HX9A 3M77A 4LNBB 1J0NA 2CQTA 4V1SA 2JG0A 5CZLA 1F1SA 2F0YB 3W5NA 1GSZA 4D4CA 3X17A 1HXAA 3RJ3A 2EADA 1RWCA 4WU0A 1N95B 1DL2A 1H37A 2BRPA 2AHFA 2BRVX 1LF9A 3D5RA 5CA3A 4YDEB 4WVCA 3Q75B 1N94B 5DGQA 1L2AA 2JF4A 4AYPA 1LOHA 2YIKA 1SQCA 3M00A 2ZISB 1H54A 1O1SB 3M01A 1CB8A 2E24A 4GL3A 2A8ZA 2R2LB 1X1IA 3OXUA 3A3VA 2PMVA 1O6QA 1V7WA 1G9JA 1FT1B 2ZZRA 3WKIA 1TNOB 1UMPA 1XW2A 2ONGA 3WC3A 1X1JA 1DOGA 4ONTA 1FBOA 1H36A 3AFLA 1WU5A 3W5MA 3M02A 3SDVA 1V5CA 2VN7A 1UG9A 1N24A 1KKTA 2BB6A 1EGUA 3P2CA 4D4DA 3D3IA 3KSLB 1HXCA 1J0MA 1L1YA 4KTRA 1MZCB 3H2WA 2X03A 2G02A 3KQ4A 4WVAA 1N1ZA 4GTMB 1WU6A 5M7YA 3DSTB 2ZIRB 4L0GA 2DRQA 1G9GA 1QQFA 3S9VA 5EASA 1AYXA 3DSSB 4FUSA 1V7VA 1RQ5A 1QBQB 3GZKA 1LXKA 2H6FB 5ILZA 1VD5A 1RWFA 1AGMA 4GAXA 3QWTA 2VN4A 3HXEB 4FXGB 3NNBA 4MU9A 4YDOB 3ACSA 3M74A 3M7LA 4L6XA 3S4DA 3WIWA 1DCEB 2J5CA 1FPPB 5ILHA 3QRYA 2V3NA 1H35A 1SA5B 4GTQB 4FXKB 3DRAB 3QPFA 1H12A 1TN6B 2WINB 4XUVA 1WU4A 5FO9B 5ILKA 1N7OA 4ZH1A 3G4FA 2EAEA 4TF4A 1HZFA 3H7LA 2WY7A 1K72A 2E22A 4V1RA 3K11A 2V8JA 2GOXA 4AYRA 3M76A 1KRFA 1RW9A 1I8QA 3Q7AB 2XQWA 4C1SA 3KLSA 1N4RB 2V8IA 5JMFA 5IKAA 4DOEA 3C72B 5GW7A 1OJPA 4BOJA 2DRRA 1NC5A 1NL4B 3LZ9A 3WIQA 3DSWB 3GT5A 4F13A 2G0DA 3S4CA 2OKXA 1TNZB 3WKHA 3P5RA 2WDAA 1ULVA 3N0FA 4KKIA 5JPMB 1D8EB 3M7CA 3E33B 4RNQA 1N22A 4MBGB 3EU8A 4YCRA 1LD8B 4BOKA 1CLCA 1G87A 1S64B 1GA2A 1GHQA 4DI5A 1KS8A 1FAEA 3QFYA 1X81B 3DSUB 2F6DA 4WVBA 3PZ2B 5IM1A 3RX5A 3M78A 1RWHA 5FOBB 1KWFA 3M7EA 2DROA 5AGDA 4M76A 2D8LA 3D5SA 3VSMA 1N7RA 3WIRA 3NFVA 2PN5A 5DHKA 3SAEA 4NEIA 1GLMA 1TN8B 3E6UA 2AHGA 2FUZA 1IA6A 1S63B 3PZ1B 2H6HB 3K7XA 3SDRA 1QSJA 3SFYB 3E80A 3HXFB 1JCSB 3TF4A 3ACTA 2BB5A 5DHIA 3EUVB 3WKFA 4KKJA 2FV1A 1OJMA 3A0OA 5EAUA 4ZG8A 4D4AA 3WUXA 2QNOA 2IEJB 3WKGA 1HMWA 3Q7FB 1N7QA 3SDQA 1O1RB 4CE7A 4JJJA 3M71A 2Q1FA 1KZPB 2RI8A 3E32B 3H3KA 4ZH5A 1KZOB 3M75A 3G6JB 1O6RA 5MEHA 1N9AB 1HV6A 3SQCA 3N0GA 3HXCB 4GTVB 3HXDB 3QG0A 1JCRB 1FCEA 3G4DA 1OJOA 3Q78B 3QT9A 3W7SA 1H14A 2WIIB 4Z4LA 1OJNA 1CEMA 2BBCA 2CQSA 3ANJA 3SDUA 3W7UA 2EABA 3VSNA 1W6JA 1O5MB 1N1BA 3E34B 3SDTA 1FO2A 3QT3A 3E37B 1O6HA 2RGKA 3ON6A 3EQAA 5ILJA 2H6GB 1FBWA 5KKBA 4GTRB 2H6IB 1O79A 4DODA 1FT2B 4GTOB 2NVPA 3W7XA 1F9OA 4F10A 1LF6A 1H39A 2GH4A 4Z4JA 3RX8A 1N7PA 1N23A 3Q73B 5IK0A 1TNUB 1SA4B 5CD2A 4GTPB 3ANKA 5ILIA 5GZKA 5IK6A 2WYNA 3SFXB 5C05A 1GXOA 2GZ6A 4J5TA 3RX7A 1HM2A 1FO3A 4AYQA
chains in the Genus database with same CATH topology
1GAIA 3VW5A 5E2JA 3DPYB 2A73B 1TF4A 1W6KA 1R76A 5M7IA 3M72A 1N4SB 1IA7A 2B4FA 3PYBA 1LD7B 1NXCA 4EL8A 2SQCA 3RRSA 3M7BA 3RENA 1G6IA 3EZ8A 4EHMB 1XWQA 1TNYB 3HXBB 3EU5B 3S4BA 5FO8B 3M73A 1XWTA 1H3CA 2ZBLA 1H3BA 4LIXA 2RI9A 3QXFA 4GTSB 5DGRA 3PMMA 1KREA 2I07B 4ZRPA 2B39A 1GAHA 1UT9A 3Q79B 3S4AA 2WY8A 3QFZA 2D5JA 3P5PA 1LTXB 5GY3A 2DRSA 3E30B 1HCUA 2V3PA 3ANIA 4CJ1A 1FP3A 3T33A 1X9DA 2BEDB 3W7WA 3W7TA 1H3AA 3AFJA 3PZ4B 3QXQA 4D94A 1F9DA 4LNVA 3VXDA 2FBAA 2EACA 1TNBB 3DSVB 1GXMA 2XFGA 1KSDA 4GTTB 1GXNA 4AYOA 3PYAA 2P0VA 2XWBB 3CU7A 1V5DA 2NOJA 4CJ0A 5JPNB 4L9PB 5FO7B 1N4QB 3CIHA 3QSPA 1KFGA 1JS4A 4ZRQA 1TN7B 1KSCA 3GLYA 1WZZA 4KTPA 1O1TB 3DSXB 1D8DB 1NI1B 2XWJB 1H13A 4D4BA 4Q88A 1N4PB 2AFAA 1FMIA 2JJBA 4Q2BA 4LNGB 4QT9A 3KSQB 2Z07A 3OEDA 3PZ3B 1V7XA 2FV0A 1IS9A 4TXTA 1JCQB 3RSYA 2V8KA 3E73A 3QDEA 1C3DA 3M77A 4LNBB 2CQTA 4V1SA 2JG0A 5CZLA 2F0YB 3W5NA 1GSZA 4D4CA 3X17A 3RJ3A 2EADA 4WU0A 1N95B 1DL2A 1H37A 2AHFA 1LF9A 3D5RA 5CA3A 4YDEB 4WVCA 3Q75B 1N94B 5DGQA 1L2AA 2JF4A 4AYPA 2YIKA 1SQCA 2ZISB 1H54A 1O1SB 4GL3A 2A8ZA 2R2LB 3OXUA 3A3VA 2PMVA 1O6QA 1V7WA 1G9JA 1FT1B 2ZZRA 3WKIA 1TNOB 1UMPA 1XW2A 3WC3A 1DOGA 4ONTA 1FBOA 1H36A 1WU5A 3W5MA 3SDVA 1V5CA 2VN7A 1UG9A 1KKTA 2BB6A 3P2CA 4D4DA 3D3IA 3KSLB 1L1YA 4KTRA 1MZCB 3H2WA 2G02A 3KQ4A 4WVAA 4GTMB 1WU6A 5M7YA 3DSTB 2ZIRB 4L0GA 2DRQA 1G9GA 1QQFA 3S9VA 1AYXA 3DSSB 4FUSA 1V7VA 1RQ5A 1QBQB 3GZKA 2H6FB 1VD5A 1AGMA 3QWTA 2VN4A 3HXEB 4FXGB 4MU9A 4YDOB 3ACSA 3M74A 3M7LA 4L6XA 3S4DA 3WIWA 1DCEB 1FPPB 3QRYA 2V3NA 1H35A 1SA5B 4GTQB 4FXKB 3DRAB 3QPFA 1H12A 1TN6B 2WINB 4XUVA 1WU4A 5FO9B 4ZH1A 2EAEA 4TF4A 1HZFA 3H7LA 2WY7A 1K72A 4V1RA 3K11A 2V8JA 2GOXA 4AYRA 3M76A 1KRFA 3Q7AB 2XQWA 4C1SA 3KLSA 1N4RB 2V8IA 4DOEA 3C72B 5GW7A 4BOJA 2DRRA 1NC5A 1NL4B 3WIQA 3DSWB 3GT5A 2G0DA 3S4CA 2OKXA 1TNZB 3WKHA 3P5RA 1ULVA 4KKIA 5JPMB 1D8EB 3M7CA 3E33B 4MBGB 3EU8A 4YCRA 1LD8B 4BOKA 1CLCA 1G87A 1S64B 1GA2A 1GHQA 1KS8A 1FAEA 3QFYA 1X81B 3DSUB 2F6DA 4WVBA 3PZ2B 3RX5A 3M78A 5FOBB 1KWFA 3M7EA 2DROA 5AGDA 4M76A 2D8LA 3D5SA 3WIRA 2PN5A 3SAEA 1GLMA 1TN8B 3E6UA 2AHGA 2FUZA 1IA6A 1S63B 3PZ1B 2H6HB 3K7XA 3SDRA 1QSJA 3SFYB 3HXFB 1JCSB 3TF4A 3ACTA 2BB5A 3EUVB 3WKFA 4KKJA 2FV1A 4ZG8A 4D4AA 3WUXA 2QNOA 2IEJB 3WKGA 3Q7FB 3SDQA 1O1RB 4CE7A 4JJJA 3M71A 1KZPB 2RI8A 3E32B 3H3KA 4ZH5A 1KZOB 3M75A 3G6JB 1O6RA 5MEHA 1N9AB 3SQCA 4GTVB 3HXCB 3HXDB 3QG0A 1JCRB 1FCEA 3Q78B 3QT9A 3W7SA 1H14A 2WIIB 4Z4LA 1CEMA 2BBCA 2CQSA 3ANJA 3SDUA 3W7UA 2EABA 1W6JA 1O5MB 3E34B 3SDTA 1FO2A 3QT3A 3E37B 1O6HA 2RGKA 3ON6A 3EQAA 2H6GB 1FBWA 5KKBA 4GTRB 2H6IB 1O79A 4DODA 1FT2B 4GTOB 2NVPA 3W7XA 1F9OA 1LF6A 1H39A 2GH4A 4Z4JA 3RX8A 3Q73B 1TNUB 1SA4B 5CD2A 4GTPB 3ANKA 5GZKA 2WYNA 3SFXB 1GXOA 2GZ6A 4J5TA 3RX7A 1FO3A 4AYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWT A;  1GAI A;  3WKF A;  2VN4 A;  3VW5 A;  5E2J A;  2FV1 A;  3ACS A;  4L6X A;  3S4D A;  3WIW A;  1H13 A;  4Q88 A;  2AFA A;  1TF4 A;  4ZG8 A;  3QRY A;  3WUX A;  2QNO A;  1FMI A;  3WKG A;  2JJB A;  4Q2B A;  5M7I A;  3QPF A;  2Z07 A;  1H12 A;  4XUV A;  1WU4 A;  2B4F A;  1IA7 A;  4CE7 A;  1V7X A;  4JJJ A;  1NXC A;  4EL8 A;  2FV0 A;  1IS9 A;  4TXT A;  3RRS A;  2EAE A;  4TF4 A;  3REN A;  3RSY A;  1G6I A;  2RI8 A;  3E73 A;  3QDE A;  3EZ8 A;  3H3K A;  4ZH5 A;  2CQT A;  2JG0 A;  3H7L A;  5CZL A;  1K72 A;  1XWQ A;  3W5N A;  5MEH A;  3X17 A;  3S4B A;  3K11 A;  2EAD A;  4WU0 A;  3QG0 A;  4AYR A;  1FCE A;  1XWT A;  1KRF A;  2ZBL A;  3QT9 A;  1DL2 A;  2AHF A;  3W7S A;  1LF9 A;  1H14 A;  5CA3 A;  4Z4L A;  2RI9 A;  1CEM A;  2CQS A;  3QXF A;  4WVC A;  3ANJ A;  4DOE A;  3W7U A;  5GW7 A;  2EAB A;  5DGR A;  5DGQ A;  1L2A A;  2JF4 A;  3PMM A;  4AYP A;  1KRE A;  2DRR A;  2YIK A;  1NC5 A;  1H54 A;  1GAH A;  1UT9 A;  1FO2 A;  3S4A A;  3QFZ A;  3QT3 A;  2D5J A;  2A8Z A;  3WIQ A;  2RGK A;  3ON6 A;  3GT5 A;  3EQA A;  5GY3 A;  3A3V A;  1FBW A;  2DRS A;  1V7W A;  1HCU A;  3S4C A;  2OKX A;  3ANI A;  1G9J A;  3WKH A;  5KKB A;  2ZZR A;  3WKI A;  1FP3 A;  4CJ1 A;  3T33 A;  4DOD A;  1ULV A;  1X9D A;  3W7W A;  1XW2 A;  3WC3 A;  3W7T A;  1DOG A;  3AFJ A;  3QXQ A;  2NVP A;  1FBO A;  1F9D A;  1CLC A;  1WU5 A;  3W5M A;  1G87 A;  3W7X A;  1V5C A;  2VN7 A;  1F9O A;  1UG9 A;  3VXD A;  2FBA A;  2EAC A;  1GA2 A;  1KS8 A;  1KKT A;  1LF6 A;  1FAE A;  2GH4 A;  2XFG A;  3P2C A;  3QFY A;  3D3I A;  1KSD A;  4Z4J A;  3RX8 A;  2F6D A;  4WVB A;  4AYO A;  1L1Y A;  4KTR A;  5CD2 A;  3RX5 A;  3H2W A;  1KWF A;  2DRO A;  4WVA A;  2P0V A;  1WU6 A;  2D8L A;  1V5D A;  5M7Y A;  3ANK A;  4CJ0 A;  4L0G A;  3WIR A;  2WYN A;  2DRQ A;  1G9G A;  1GLM A;  3CIH A;  2AHG A;  2FUZ A;  1IA6 A;  1KFG A;  1AYX A;  3E6U A;  3QSP A;  1JS4 A;  4FUS A;  1KSC A;  1V7V A;  1RQ5 A;  2GZ6 A;  3GLY A;  4J5T A;  3RX7 A;  1WZZ A;  3GZK A;  1FO3 A;  1VD5 A;  1AGM A;  4AYQ A;  3ACT A;  3TF4 A;  4KTP A; 
#chains in the Genus database with same CATH topology
 4FNV A;  1GAI A;  3VW5 A;  5E2J A;  3DPY B;  1HM3 A;  2A73 B;  2BRW A;  1TF4 A;  1HXG A;  1W6K A;  1R76 A;  5M7I A;  2FUQ A;  3M72 A;  1N4S B;  1IA7 A;  2B4F A;  3PYB A;  1LD7 B;  1NXC A;  4EL8 A;  1LXM A;  2SQC A;  3RRS A;  3M7B A;  3E7J A;  3REN A;  1G6I A;  4MMI A;  4OK2 A;  3EZ8 A;  4EHM B;  1XWQ A;  1TNY B;  3HXB B;  2FUT A;  4OJZ A;  3EU5 B;  5EAT A;  3S4B A;  5FO8 B;  1HMU A;  2WCO A;  3M73 A;  1XWT A;  1H3C A;  2ZBL A;  5IKH A;  1H3B A;  4OK4 A;  4LIX A;  4FJQ A;  2RI9 A;  3QXF A;  4GTS B;  5DGR A;  3PMM A;  1KRE A;  2I07 B;  4ZRP A;  1QAZ A;  2B39 A;  1RWG A;  1GAH A;  1UT9 A;  3Q79 B;  3S4A A;  2WY8 A;  3QFZ A;  2D5J A;  3P5P A;  1X1H A;  1LTX B;  5GY3 A;  4OZV A;  2DRS A;  3E30 B;  1HCU A;  2V3P A;  3ANI A;  4CJ1 A;  1FP3 A;  5IL3 A;  1N21 A;  3T33 A;  5JMD A;  1X9D A;  2BED B;  3W7W A;  3W7T A;  1H3A A;  3AFJ A;  3PZ4 B;  3QXQ A;  2ONH A;  4D94 A;  1F9D A;  5ILD A;  5IK9 A;  4LNV A;  3VXD A;  2FBA A;  2EAC A;  4MMH A;  1TNB B;  3DSV B;  1GXM A;  2XFG A;  1KSD A;  4GTT B;  1HN0 A;  5IL8 A;  1GXN A;  4AYO A;  1N7N A;  3PYA A;  2P0V A;  2XWB B;  3CU7 A;  1V5D A;  2NOJ A;  4CJ0 A;  5JPN B;  1RWA A;  4L9P B;  5FO7 B;  1N4Q B;  3CIH A;  3QSP A;  1KFG A;  1JS4 A;  4ZRQ A;  1TN7 B;  1KSC A;  3GLY A;  1WZZ A;  4OZW A;  1C82 A;  4KTP A;  1O1T B;  3DSX B;  1D8D B;  1F9G A;  4E1Y A;  5ILY A;  1NI1 B;  2XWJ B;  1H13 A;  4D4B A;  1W3Y A;  4Q88 A;  1N4P B;  2AFA A;  1FMI A;  2JJB A;  4Q2B A;  4LNG B;  4QT9 A;  3KSQ B;  2Z07 A;  3OED A;  3PZ3 B;  1V7X A;  1N20 A;  2FV0 A;  1IS9 A;  4TXT A;  1JCQ B;  3RSY A;  2V8K A;  3E73 A;  3QDE A;  1C3D A;  1HX9 A;  3M77 A;  4LNB B;  1J0N A;  2CQT A;  4V1S A;  2JG0 A;  5CZL A;  1F1S A;  2F0Y B;  3W5N A;  1GSZ A;  4D4C A;  3X17 A;  1HXA A;  3RJ3 A;  2EAD A;  1RWC A;  4WU0 A;  1N95 B;  1DL2 A;  1H37 A;  2BRP A;  2AHF A;  2BRV X;  1LF9 A;  3D5R A;  5CA3 A;  4YDE B;  4WVC A;  3Q75 B;  1N94 B;  5DGQ A;  1L2A A;  2JF4 A;  4AYP A;  1LOH A;  2YIK A;  1SQC A;  3M00 A;  2ZIS B;  1H54 A;  1O1S B;  3M01 A;  1CB8 A;  2E24 A;  4GL3 A;  2A8Z A;  2R2L B;  1X1I A;  3OXU A;  3A3V A;  2PMV A;  1O6Q A;  1V7W A;  1G9J A;  1FT1 B;  2ZZR A;  3WKI A;  1TNO B;  1UMP A;  1XW2 A;  2ONG A;  3WC3 A;  1X1J A;  1DOG A;  4ONT A;  1FBO A;  1H36 A;  3AFL A;  1WU5 A;  3W5M A;  3M02 A;  3SDV A;  1V5C A;  2VN7 A;  1UG9 A;  1N24 A;  1KKT A;  2BB6 A;  1EGU A;  3P2C A;  4D4D A;  3D3I A;  3KSL B;  1HXC A;  1J0M A;  1L1Y A;  4KTR A;  1MZC B;  3H2W A;  2X03 A;  2G02 A;  3KQ4 A;  4WVA A;  1N1Z A;  4GTM B;  1WU6 A;  5M7Y A;  3DST B;  2ZIR B;  4L0G A;  2DRQ A;  1G9G A;  1QQF A;  3S9V A;  5EAS A;  1AYX A;  3DSS B;  4FUS A;  1V7V A;  1RQ5 A;  1QBQ B;  3GZK A;  1LXK A;  2H6F B;  5ILZ A;  1VD5 A;  1RWF A;  1AGM A;  4GAX A;  3QWT A;  2VN4 A;  3HXE B;  4FXG B;  3NNB A;  4MU9 A;  4YDO B;  3ACS A;  3M74 A;  3M7L A;  4L6X A;  3S4D A;  3WIW A;  1DCE B;  2J5C A;  1FPP B;  5ILH A;  3QRY A;  2V3N A;  1H35 A;  1SA5 B;  4GTQ B;  4FXK B;  3DRA B;  3QPF A;  1H12 A;  1TN6 B;  2WIN B;  4XUV A;  1WU4 A;  5FO9 B;  5ILK A;  1N7O A;  4ZH1 A;  3G4F A;  2EAE A;  4TF4 A;  1HZF A;  3H7L A;  2WY7 A;  1K72 A;  2E22 A;  4V1R A;  3K11 A;  2V8J A;  2GOX A;  4AYR A;  3M76 A;  1KRF A;  1RW9 A;  1I8Q A;  3Q7A B;  2XQW A;  4C1S A;  3KLS A;  1N4R B;  2V8I A;  5JMF A;  5IKA A;  4DOE A;  3C72 B;  5GW7 A;  1OJP A;  4BOJ A;  2DRR A;  1NC5 A;  1NL4 B;  3LZ9 A;  3WIQ A;  3DSW B;  3GT5 A;  4F13 A;  2G0D A;  3S4C A;  2OKX A;  1TNZ B;  3WKH A;  3P5R A;  2WDA A;  1ULV A;  3N0F A;  4KKI A;  5JPM B;  1D8E B;  3M7C A;  3E33 B;  4RNQ A;  1N22 A;  4MBG B;  3EU8 A;  4YCR A;  1LD8 B;  4BOK A;  1CLC A;  1G87 A;  1S64 B;  1GA2 A;  1GHQ A;  4DI5 A;  1KS8 A;  1FAE A;  3QFY A;  1X81 B;  3DSU B;  2F6D A;  4WVB A;  3PZ2 B;  5IM1 A;  3RX5 A;  3M78 A;  1RWH A;  5FOB B;  1KWF A;  3M7E A;  2DRO A;  5AGD A;  4M76 A;  2D8L A;  3D5S A;  3VSM A;  1N7R A;  3WIR A;  3NFV A;  2PN5 A;  5DHK A;  3SAE A;  4NEI A;  1GLM A;  1TN8 B;  3E6U A;  2AHG A;  2FUZ A;  1IA6 A;  1S63 B;  3PZ1 B;  2H6H B;  3K7X A;  3SDR A;  1QSJ A;  3SFY B;  3E80 A;  3HXF B;  1JCS B;  3TF4 A;  3ACT A;  2BB5 A;  5DHI A;  3EUV B;  3WKF A;  4KKJ A;  2FV1 A;  1OJM A;  3A0O A;  5EAU A;  4ZG8 A;  4D4A A;  3WUX A;  2QNO A;  2IEJ B;  3WKG A;  1HMW A;  3Q7F B;  1N7Q A;  3SDQ A;  1O1R B;  4CE7 A;  4JJJ A;  3M71 A;  2Q1F A;  1KZP B;  2RI8 A;  3E32 B;  3H3K A;  4ZH5 A;  1KZO B;  3M75 A;  3G6J B;  1O6R A;  5MEH A;  1N9A B;  1HV6 A;  3SQC A;  3N0G A;  3HXC B;  4GTV B;  3HXD B;  3QG0 A;  1JCR B;  1FCE A;  3G4D A;  1OJO A;  3Q78 B;  3QT9 A;  3W7S A;  1H14 A;  2WII B;  4Z4L A;  1OJN A;  1CEM A;  2BBC A;  2CQS A;  3ANJ A;  3SDU A;  3W7U A;  2EAB A;  3VSN A;  1W6J A;  1O5M B;  1N1B A;  3E34 B;  3SDT A;  1FO2 A;  3QT3 A;  3E37 B;  1O6H A;  2RGK A;  3ON6 A;  3EQA A;  5ILJ A;  2H6G B;  1FBW A;  5KKB A;  4GTR B;  2H6I B;  1O79 A;  4DOD A;  1FT2 B;  4GTO B;  2NVP A;  3W7X A;  1F9O A;  4F10 A;  1LF6 A;  1H39 A;  2GH4 A;  4Z4J A;  3RX8 A;  1N7P A;  1N23 A;  3Q73 B;  5IK0 A;  1TNU B;  1SA4 B;  5CD2 A;  4GTP B;  3ANK A;  5ILI A;  5GZK A;  5IK6 A;  2WYN A;  3SFX B;  5C05 A;  1GXO A;  2GZ6 A;  4J5T A;  3RX7 A;  1HM2 A;  1FO3 A;  4AYQ A; 
#chains in the Genus database with same CATH homology
 1GAI A;  3VW5 A;  5E2J A;  3DPY B;  2A73 B;  1TF4 A;  1W6K A;  1R76 A;  5M7I A;  3M72 A;  1N4S B;  1IA7 A;  2B4F A;  3PYB A;  1LD7 B;  1NXC A;  4EL8 A;  2SQC A;  3RRS A;  3M7B A;  3REN A;  1G6I A;  3EZ8 A;  4EHM B;  1XWQ A;  1TNY B;  3HXB B;  3EU5 B;  3S4B A;  5FO8 B;  3M73 A;  1XWT A;  1H3C A;  2ZBL A;  1H3B A;  4LIX A;  2RI9 A;  3QXF A;  4GTS B;  5DGR A;  3PMM A;  1KRE A;  2I07 B;  4ZRP A;  2B39 A;  1GAH A;  1UT9 A;  3Q79 B;  3S4A A;  2WY8 A;  3QFZ A;  2D5J A;  3P5P A;  1LTX B;  5GY3 A;  2DRS A;  3E30 B;  1HCU A;  2V3P A;  3ANI A;  4CJ1 A;  1FP3 A;  3T33 A;  1X9D A;  2BED B;  3W7W A;  3W7T A;  1H3A A;  3AFJ A;  3PZ4 B;  3QXQ A;  4D94 A;  1F9D A;  4LNV A;  3VXD A;  2FBA A;  2EAC A;  1TNB B;  3DSV B;  1GXM A;  2XFG A;  1KSD A;  4GTT B;  1GXN A;  4AYO A;  3PYA A;  2P0V A;  2XWB B;  3CU7 A;  1V5D A;  2NOJ A;  4CJ0 A;  5JPN B;  4L9P B;  5FO7 B;  1N4Q B;  3CIH A;  3QSP A;  1KFG A;  1JS4 A;  4ZRQ A;  1TN7 B;  1KSC A;  3GLY A;  1WZZ A;  4KTP A;  1O1T B;  3DSX B;  1D8D B;  1NI1 B;  2XWJ B;  1H13 A;  4D4B A;  4Q88 A;  1N4P B;  2AFA A;  1FMI A;  2JJB A;  4Q2B A;  4LNG B;  4QT9 A;  3KSQ B;  2Z07 A;  3OED A;  3PZ3 B;  1V7X A;  2FV0 A;  1IS9 A;  4TXT A;  1JCQ B;  3RSY A;  2V8K A;  3E73 A;  3QDE A;  1C3D A;  3M77 A;  4LNB B;  2CQT A;  4V1S A;  2JG0 A;  5CZL A;  2F0Y B;  3W5N A;  1GSZ A;  4D4C A;  3X17 A;  3RJ3 A;  2EAD A;  4WU0 A;  1N95 B;  1DL2 A;  1H37 A;  2AHF A;  1LF9 A;  3D5R A;  5CA3 A;  4YDE B;  4WVC A;  3Q75 B;  1N94 B;  5DGQ A;  1L2A A;  2JF4 A;  4AYP A;  2YIK A;  1SQC A;  2ZIS B;  1H54 A;  1O1S B;  4GL3 A;  2A8Z A;  2R2L B;  3OXU A;  3A3V A;  2PMV A;  1O6Q A;  1V7W A;  1G9J A;  1FT1 B;  2ZZR A;  3WKI A;  1TNO B;  1UMP A;  1XW2 A;  3WC3 A;  1DOG A;  4ONT A;  1FBO A;  1H36 A;  1WU5 A;  3W5M A;  3SDV A;  1V5C A;  2VN7 A;  1UG9 A;  1KKT A;  2BB6 A;  3P2C A;  4D4D A;  3D3I A;  3KSL B;  1L1Y A;  4KTR A;  1MZC B;  3H2W A;  2G02 A;  3KQ4 A;  4WVA A;  4GTM B;  1WU6 A;  5M7Y A;  3DST B;  2ZIR B;  4L0G A;  2DRQ A;  1G9G A;  1QQF A;  3S9V A;  1AYX A;  3DSS B;  4FUS A;  1V7V A;  1RQ5 A;  1QBQ B;  3GZK A;  2H6F B;  1VD5 A;  1AGM A;  3QWT A;  2VN4 A;  3HXE B;  4FXG B;  4MU9 A;  4YDO B;  3ACS A;  3M74 A;  3M7L A;  4L6X A;  3S4D A;  3WIW A;  1DCE B;  1FPP B;  3QRY A;  2V3N A;  1H35 A;  1SA5 B;  4GTQ B;  4FXK B;  3DRA B;  3QPF A;  1H12 A;  1TN6 B;  2WIN B;  4XUV A;  1WU4 A;  5FO9 B;  4ZH1 A;  2EAE A;  4TF4 A;  1HZF A;  3H7L A;  2WY7 A;  1K72 A;  4V1R A;  3K11 A;  2V8J A;  2GOX A;  4AYR A;  3M76 A;  1KRF A;  3Q7A B;  2XQW A;  4C1S A;  3KLS A;  1N4R B;  2V8I A;  4DOE A;  3C72 B;  5GW7 A;  4BOJ A;  2DRR A;  1NC5 A;  1NL4 B;  3WIQ A;  3DSW B;  3GT5 A;  2G0D A;  3S4C A;  2OKX A;  1TNZ B;  3WKH A;  3P5R A;  1ULV A;  4KKI A;  5JPM B;  1D8E B;  3M7C A;  3E33 B;  4MBG B;  3EU8 A;  4YCR A;  1LD8 B;  4BOK A;  1CLC A;  1G87 A;  1S64 B;  1GA2 A;  1GHQ A;  1KS8 A;  1FAE A;  3QFY A;  1X81 B;  3DSU B;  2F6D A;  4WVB A;  3PZ2 B;  3RX5 A;  3M78 A;  5FOB B;  1KWF A;  3M7E A;  2DRO A;  5AGD A;  4M76 A;  2D8L A;  3D5S A;  3WIR A;  2PN5 A;  3SAE A;  1GLM A;  1TN8 B;  3E6U A;  2AHG A;  2FUZ A;  1IA6 A;  1S63 B;  3PZ1 B;  2H6H B;  3K7X A;  3SDR A;  1QSJ A;  3SFY B;  3HXF B;  1JCS B;  3TF4 A;  3ACT A;  2BB5 A;  3EUV B;  3WKF A;  4KKJ A;  2FV1 A;  4ZG8 A;  4D4A A;  3WUX A;  2QNO A;  2IEJ B;  3WKG A;  3Q7F B;  3SDQ A;  1O1R B;  4CE7 A;  4JJJ A;  3M71 A;  1KZP B;  2RI8 A;  3E32 B;  3H3K A;  4ZH5 A;  1KZO B;  3M75 A;  3G6J B;  1O6R A;  5MEH A;  1N9A B;  3SQC A;  4GTV B;  3HXC B;  3HXD B;  3QG0 A;  1JCR B;  1FCE A;  3Q78 B;  3QT9 A;  3W7S A;  1H14 A;  2WII B;  4Z4L A;  1CEM A;  2BBC A;  2CQS A;  3ANJ A;  3SDU A;  3W7U A;  2EAB A;  1W6J A;  1O5M B;  3E34 B;  3SDT A;  1FO2 A;  3QT3 A;  3E37 B;  1O6H A;  2RGK A;  3ON6 A;  3EQA A;  2H6G B;  1FBW A;  5KKB A;  4GTR B;  2H6I B;  1O79 A;  4DOD A;  1FT2 B;  4GTO B;  2NVP A;  3W7X A;  1F9O A;  1LF6 A;  1H39 A;  2GH4 A;  4Z4J A;  3RX8 A;  3Q73 B;  1TNU B;  1SA4 B;  5CD2 A;  4GTP B;  3ANK A;  5GZK A;  2WYN A;  3SFX B;  1GXO A;  2GZ6 A;  4J5T A;  3RX7 A;  1FO3 A;  4AYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...