2DRSA

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263s mutant
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
379
structure length
379
Chain Sequence
KTTEGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPETKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSSSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xylanase Y
publication title Structural explanation for the acquisition of glycosynthase activity
pubmed doi rcsb
source organism Bacillus halodurans
total genus 154
structure length 379
sequence length 379
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2drsA01
1WU4A 1JS4A 4KTPA 1F9DA 5KKBA 2OKXA 1AGMA 2Z07A 3WKFA 1CEMA 3X17A 1XW2A 4EL8A 3WC3A 2RGKA 1L1YA 3T33A 4Q88A 1DOGA 3QRYA 3WIRA 3ACTA 3W7XA 2GH4A 1H54A 4DODA 4CE7A 4ZH5A 1F9OA 1G9JA 3H3KA 2B4FA 3EQAA 1IA6A 2EACA 2AHFA 1H14A 2DROA 3WKGA 2DRSA 3GZKA 3RRSA 2JJBA 5CD2A 4ZG8A 3RENA 1AYXA 1FO3A 3ANJA 2CQSA 3ACSA 3ON6A 3QDEA 3WIQA 1XWQA 4AYPA 1WU5A 2QNOA 1H12A 2EABA 5CZLA 3WIWA 1V7XA 1FAEA 2EADA 1H13A 2RI8A 4CJ0A 3W5MA 1NXCA 3WKHA 3D3IA 4JJJA 1WZZA 1KREA 1V5DA 3RSYA 2AHGA 2D5JA 2A8ZA 2DRQA 3E73A 4CJ1A 3W7UA 4WVAA 3VW5A 5E2JA 3QT3A 1KRFA 1V7VA 1K72A 2FV1A 4AYQA 3VXDA 1CLCA 3CIHA 5CA3A 1G6IA 1GAHA 3AFJA 1KSDA 2DRRA 1X9DA 1G9GA 3QSPA 3S4BA 3W7WA 2D8LA 3WUXA 3QFYA 5MEHA 2GZ6A 2JG0A 4TF4A 1DL2A 3QFZA 3RX7A 3E6UA 3QWTA 3A3VA 5DGRA 3K11A 1VD5A 4L6XA 2RI9A 1IS9A 1XWTA 2F6DA 3QXFA 2VN7A 3PMMA 3W5NA 1GAIA 1WU6A 1FCEA 3GLYA 5M7IA 1V7WA 2NVPA 5M7YA 3EZ8A 1ULVA 3RX5A 1FP3A 4Q2BA 1FBWA 1RQ5A 4WVBA 2ZBLA 4L0GA 3S4DA 3S4CA 2AFAA 2FBAA 2EAEA 2CQTA 1NC5A 3ANIA 3QT9A 1FO2A 3QPFA 3ANKA 1FBOA 3P2CA 3RX8A 4AYRA 1L2AA 1LF6A 1LF9A 4WVCA 2JF4A 2XFGA 1GLMA 4XUVA 1TF4A 1UG9A 3H7LA 4Z4LA 3WKIA 4J5TA 4KTRA 5GY3A 3GT5A 5DGQA 4FUSA 1KFGA 2P0VA 2ZZRA 4AYOA 2FUZA 1KKTA 3QG0A 4TXTA 2FV0A 5GW7A 2YIKA 3S4AA 1HCUA 4WU0A 3W7SA 1GA2A 3QXQA 4Z4JA 1FMIA 3H2WA 1KS8A 3W7TA 1KWFA 2VN4A 2WYNA 3TF4A 1IA7A 1V5CA 4DOEA 1UT9A 1KSCA 1G87A
chains in the Genus database with same CATH superfamily
1HMWA 3AFLA 1JS4A 3N0FA 3N0GA 3KSLB 2OKXA 3Q79B 3WKFA 5EATA 1CEMA 4QT9A 3G4DA 2H6FB 4Q88A 3P5RA 5IL3A 3M74A 1N9AB 1N24A 2E24A 3EQAA 1IA6A 1TNOB 3M02A 1O5MB 5IK0A 1H37A 2JJBA 1HXAA 3RJ3A 3RENA 1AYXA 3ANJA 3ACSA 1LXMA 2H6GB 1N4RB 4LNGB 3E80A 3WIWA 2I07B 4GTRB 2A73B 1TNYB 1H13A 5C05A 1WZZA 3SAEA 3RSYA 4D4DA 1N7RA 1H39A 2ZIRB 3Q7FB 2DRQA 4D4CA 3VW5A 3P5PA 1K72A 1CLCA 3QSPA 1KSDA 3M78A 3SDRA 1G9GA 5ILDA 1D8DB 1OJNA 5MEHA 4NEIA 1DL2A 1C3DA 1RWAA 2FUTA 3A3VA 1HV6A 4FNVA 1XWTA 1N21A 2F6DA 2J5CA 4OZWA 2VN7A 4KKJA 3PMMA 1WU6A 2BRWA 3EZ8A 4C1SA 1W6KA 3M72A 4Q2BA 3S4DA 1O1TB 3DSWB 3S4CA 2AFAA 4MBGB 2EAEA 2CQTA 3ANIA 2FUQA 3SFXB 3S9VA 3RX8A 2H6HB 2PMVA 2JF4A 2ONGA 1JCRB 4XUVA 4GL3A 1LTXB 1N7QA 1QBQB 4KTRA 3HXEB 3PZ3B 1NI1B 1KKTA 5IKAA 4M76A 2YIKA 2ONHA 3S4AA 3SDVA 1GA2A 3KSQB 1HZFA 2VN4A 3TF4A 1S63B 1IA7A 1V5CA 5JMFA 3KLSA 3SDQA 2R2LB 5KKBA 3X17A 1HXCA 4EL8A 1XW2A 4LNVA 1SA4B 1O6HA 3EU5B 1TNUB 3W7XA 2GH4A 1H3BA 1HN0A 4DODA 4ZH5A 2B4FA 1HM3A 5IM1A 3WKGA 3SDTA 3GZKA 4YDOB 2BBCA 2CQSA 3ON6A 3OEDA 1LD8B 1QSJA 1FAEA 1RWHA 3W5MA 1NXCA 3D3IA 1KREA 1O6RA 1V5DA 5FO7B 3E73A 4CJ1A 4WVAA 5E2JA 3QT3A 3DSVB 5EASA 3C72B 4AYQA 4ZH1A 3CIHA 1G6IA 4D4BA 3W7WA 3SQCA 1J0MA 3HXFB 2WINB 3A0OA 1TN8B 2D8LA 1TNZB 1RWGA 5ILJA 2JG0A 4TF4A 1N22A 3RX7A 5JPMB 1H36A 3E7JA 3K11A 1IS9A 1N4PB 3QXFA 5JPNB 4ONTA 3DPYB 3HXCB 4MMIA 3W5NA 5M7IA 1FCEA 3GLYA 3Q73B 1OJOA 2V3NA 2H6IB 3E37B 1N7NA 1CB8A 3DSXB 4WVBA 1FPPB 1OJPA 2FBAA 1NC5A 3M71A 1W3YA 3QT9A 1FO2A 5ILKA 1MZCB 3P2CA 3HXDB 1L2AA 2ZISB 1GXMA 1O1SB 1N1BA 5ILZA 1UG9A 4Z4LA 5DHIA 3WKIA 4J5TA 4DI5A 3DRAB 3GT5A 4LNBB 1O6QA 1KFGA 2P0VA 4FUSA 2ZZRA 3EU8A 4AYOA 3QG0A 1J0NA 2GOXA 1HCUA 3EUVB 1N20A 4GAXA 4GTPB 3QXQA 1KS8A 4OZVA 2X03A 4D94A 4V1RA 1KZPB 1G87A 1WU4A 4KTPA 1F9DA 1N4QB 1AGMA 3M73A 3WC3A 4L9PB 1L1YA 4EHMB 5GZKA 1DOGA 3QRYA 1H3AA 3ACTA 2G02A 1UMPA 1O79A 1H54A 1JCQB 4F10A 3M01A 1FT1B 5IKHA 4D4AA 2BRPA 2DRSA 4V1SA 2G0DA 3G6JB 3M00A 5CD2A 3M7EA 1FO3A 2WCOA 5IK6A 2V8KA 2QNOA 4ZRQA 1HX9A 2EABA 5CZLA 2EADA 1N1ZA 2Q1FA 3E32B 4MU9A 3M7LA 2D5JA 4GTVB 1SA5B 1V7VA 2FV1A 3D5RA 3KQ4A 3VXDA 5CA3A 3LZ9A 1GAHA 2V3PA 1X1JA 3WUXA 1TNBB 1C82A 2GZ6A 3E34B 1X81B 3E6UA 3QWTA 1KZOB 1EGUA 1N7PA 2IEJB 4GTMB 1N23A 4E1YA 1V7WA 1W6JA 3DSUB 3HXBB 3Q78B 3PZ1B 4OJZA 4L0GA 1HM2A 2BB5A 3PYBA 1X1HA 3PZ4B 4RNQA 3QPFA 1R76A 1FBOA 1GSZA 4GTTB 5JMDA 5DHKA 1LF9A 3Q75B 4WVCA 3E30B 2XFGA 4YDEB 5GY3A 3VSMA 1N4SB 2FV0A 4BOKA 3CU7A 1N7OA 3W7SA 3NFVA 1D8EB 4Z4JA 1FMIA 3H2WA 1OJMA 3M7BA 1KWFA 3M75A 1S64B 4MMHA 4DOEA 2E22A 4FXGB 1UT9A 1QAZA 5FOBB 3NNBA 1LXKA 2BB6A 2Z07A 3E33B 4FXKB 1H3CA 2RGKA 3T33A 4F13A 2WDAA 3K7XA 3WIRA 1F1SA 5ILIA 4CE7A 1RWFA 1F9OA 1G9JA 3H3KA 2EACA 2AHFA 1H14A 2DROA 3M77A 1TN6B 1SQCA 1H35A 3RRSA 4ZG8A 1GHQA 1RWCA 5IK9A 5FO8B 3M7CA 3QDEA 4ZRPA 3WIQA 1XWQA 3Q7AB 1WU5A 4AYPA 3DSSB 5EAUA 1H12A 4OK4A 1V7XA 2RI8A 4BOJA 4CJ0A 4OK2A 3WKHA 4JJJA 2V8IA 1DCEB 2AHGA 2A8ZA 3W7UA 2V8JA 1KRFA 3VSNA 3AFJA 3PZ2B 2DRRA 1X9DA 3S4BA 4KKIA 3QFYA 2BEDB 3QFZA 1JCSB 3OXUA 5DGRA 1VD5A 4L6XA 5IL8A 2RI9A 1LOHA 5FO9B 1NL4B 2F0YB 3PYAA 4FJQA 2XQWA 5ILHA 1O1RB 1GAIA 2WIIB 2NVPA 5M7YA 1ULVA 1HXGA 4YCRA 2XWBB 3RX5A 1FP3A 1FBWA 1RQ5A 1LD7B 2ZBLA 1N94B 1RW9A 3SFYB 1GXOA 2WY7A 3ANKA 1LF6A 4AYRA 1F9GA 2WY8A 1TN7B 5AGDA 2PN5A 3DSTB 4GTSB 1GLMA 1TF4A 3H7LA 1QQFA 1FT2B 1N95B 3D5SA 1HMUA 5DGQA 5ILYA 2XWJB 4GTQB 2FUZA 4TXTA 5GW7A 1GXNA 4LIXA 3M76A 2SQCA 3G4FA 4WU0A 1I8QA 3W7TA 1X1IA 2WYNA 4GTOB 2NOJA 2B39A 3SDUA 2BRVX 1KSCA
chains in the Genus database with same CATH topology
1JS4A 3KSLB 2OKXA 3Q79B 3WKFA 1CEMA 4QT9A 2H6FB 4Q88A 3P5RA 3M74A 1N9AB 3EQAA 1IA6A 1TNOB 1O5MB 1H37A 2JJBA 3RJ3A 3RENA 1AYXA 3ANJA 3ACSA 2H6GB 1N4RB 4LNGB 3WIWA 2I07B 4GTRB 2A73B 1TNYB 1H13A 1WZZA 3SAEA 3RSYA 4D4DA 1H39A 2ZIRB 3Q7FB 2DRQA 4D4CA 3VW5A 3P5PA 1K72A 1CLCA 3QSPA 1KSDA 3M78A 3SDRA 1G9GA 1D8DB 5MEHA 1DL2A 1C3DA 3A3VA 1XWTA 2F6DA 2VN7A 4KKJA 3PMMA 1WU6A 3EZ8A 4C1SA 1W6KA 3M72A 4Q2BA 3S4DA 1O1TB 3DSWB 3S4CA 2AFAA 4MBGB 2EAEA 2CQTA 3ANIA 3SFXB 3S9VA 3RX8A 2H6HB 2PMVA 2JF4A 1JCRB 4XUVA 4GL3A 1LTXB 1QBQB 4KTRA 3HXEB 3PZ3B 1NI1B 1KKTA 4M76A 2YIKA 3S4AA 3SDVA 1GA2A 3KSQB 1HZFA 2VN4A 3TF4A 1S63B 1IA7A 1V5CA 3KLSA 3SDQA 2R2LB 5KKBA 3X17A 4EL8A 1XW2A 4LNVA 1SA4B 1O6HA 3EU5B 1TNUB 3W7XA 2GH4A 1H3BA 4DODA 4ZH5A 2B4FA 3WKGA 3SDTA 3GZKA 4YDOB 2BBCA 2CQSA 3ON6A 3OEDA 1LD8B 1QSJA 1FAEA 3W5MA 1NXCA 3D3IA 1KREA 1O6RA 1V5DA 5FO7B 3E73A 4CJ1A 4WVAA 5E2JA 3QT3A 3DSVB 3C72B 4AYQA 4ZH1A 3CIHA 1G6IA 4D4BA 3W7WA 3SQCA 3HXFB 2WINB 1TN8B 2D8LA 1TNZB 2JG0A 4TF4A 3RX7A 5JPMB 1H36A 3K11A 1IS9A 1N4PB 3QXFA 5JPNB 4ONTA 3DPYB 3HXCB 3W5NA 5M7IA 1FCEA 3GLYA 3Q73B 2V3NA 2H6IB 3E37B 3DSXB 4WVBA 1FPPB 2FBAA 1NC5A 3M71A 3QT9A 1FO2A 1MZCB 3P2CA 3HXDB 1L2AA 2ZISB 1GXMA 1O1SB 1UG9A 4Z4LA 3WKIA 4J5TA 3DRAB 3GT5A 4LNBB 4FUSA 1O6QA 1KFGA 2P0VA 2ZZRA 3EU8A 4AYOA 3QG0A 2GOXA 1HCUA 3EUVB 4GTPB 3QXQA 1KS8A 4D94A 4V1RA 1KZPB 1G87A 1WU4A 4KTPA 1F9DA 1N4QB 1AGMA 3M73A 3WC3A 4L9PB 1L1YA 4EHMB 5GZKA 1DOGA 3QRYA 1H3AA 3ACTA 2G02A 1UMPA 1O79A 1H54A 1JCQB 1FT1B 4D4AA 2DRSA 4V1SA 2G0DA 3G6JB 5CD2A 3M7EA 1FO3A 2V8KA 2QNOA 4ZRQA 2EABA 5CZLA 2EADA 3E32B 4MU9A 3M7LA 2D5JA 4GTVB 1SA5B 1V7VA 2FV1A 3D5RA 3KQ4A 3VXDA 5CA3A 1GAHA 2V3PA 3WUXA 1TNBB 2GZ6A 3E34B 1X81B 3E6UA 3QWTA 1KZOB 2IEJB 4GTMB 1V7WA 1W6JA 3DSUB 3HXBB 3Q78B 3PZ1B 4L0GA 2BB5A 3PYBA 3PZ4B 3QPFA 1R76A 1FBOA 1GSZA 4GTTB 1LF9A 3Q75B 4WVCA 3E30B 2XFGA 4YDEB 5GY3A 1N4SB 2FV0A 4BOKA 3CU7A 3W7SA 1D8EB 4Z4JA 1FMIA 3H2WA 3M7BA 1KWFA 3M75A 1S64B 4DOEA 4FXGB 1UT9A 5FOBB 2BB6A 2Z07A 3E33B 4FXKB 1H3CA 2RGKA 3T33A 3K7XA 3WIRA 4CE7A 1F9OA 1G9JA 3H3KA 2EACA 2AHFA 1H14A 2DROA 3M77A 1TN6B 1SQCA 1H35A 3RRSA 4ZG8A 1GHQA 5FO8B 3M7CA 3QDEA 4ZRPA 3WIQA 1XWQA 3Q7AB 1WU5A 4AYPA 3DSSB 1H12A 1V7XA 2RI8A 4BOJA 4CJ0A 3WKHA 4JJJA 2V8IA 1DCEB 2AHGA 2A8ZA 3W7UA 2V8JA 1KRFA 3AFJA 3PZ2B 2DRRA 1X9DA 3S4BA 4KKIA 3QFYA 2BEDB 3QFZA 1JCSB 3OXUA 5DGRA 1VD5A 4L6XA 2RI9A 5FO9B 1NL4B 2F0YB 3PYAA 2XQWA 1O1RB 1GAIA 2WIIB 2NVPA 5M7YA 1ULVA 4YCRA 2XWBB 3RX5A 1FP3A 1FBWA 1RQ5A 1LD7B 2ZBLA 1N94B 3SFYB 1GXOA 2WY7A 3ANKA 1LF6A 4AYRA 2WY8A 1TN7B 5AGDA 2PN5A 3DSTB 4GTSB 1GLMA 1TF4A 3H7LA 1QQFA 1FT2B 1N95B 3D5SA 5DGQA 2XWJB 4GTQB 2FUZA 4TXTA 5GW7A 1GXNA 4LIXA 3M76A 2SQCA 4WU0A 3W7TA 2WYNA 4GTOB 2NOJA 2B39A 3SDUA 1KSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WU4 A;  1JS4 A;  4KTP A;  1F9D A;  5KKB A;  2OKX A;  1AGM A;  2Z07 A;  3WKF A;  1CEM A;  3X17 A;  1XW2 A;  4EL8 A;  3WC3 A;  2RGK A;  1L1Y A;  3T33 A;  4Q88 A;  1DOG A;  3QRY A;  3WIR A;  3ACT A;  3W7X A;  2GH4 A;  1H54 A;  4DOD A;  4CE7 A;  4ZH5 A;  1F9O A;  1G9J A;  3H3K A;  2B4F A;  3EQA A;  1IA6 A;  2EAC A;  2AHF A;  1H14 A;  2DRO A;  3WKG A;  2DRS A;  3GZK A;  3RRS A;  2JJB A;  5CD2 A;  4ZG8 A;  3REN A;  1AYX A;  1FO3 A;  3ANJ A;  2CQS A;  3ACS A;  3ON6 A;  3QDE A;  3WIQ A;  1XWQ A;  4AYP A;  1WU5 A;  2QNO A;  1H12 A;  2EAB A;  5CZL A;  3WIW A;  1V7X A;  1FAE A;  2EAD A;  1H13 A;  2RI8 A;  4CJ0 A;  3W5M A;  1NXC A;  3WKH A;  3D3I A;  4JJJ A;  1WZZ A;  1KRE A;  1V5D A;  3RSY A;  2AHG A;  2D5J A;  2A8Z A;  2DRQ A;  3E73 A;  4CJ1 A;  3W7U A;  4WVA A;  3VW5 A;  5E2J A;  3QT3 A;  1KRF A;  1V7V A;  1K72 A;  2FV1 A;  4AYQ A;  3VXD A;  1CLC A;  3CIH A;  5CA3 A;  1G6I A;  1GAH A;  3AFJ A;  1KSD A;  2DRR A;  1X9D A;  1G9G A;  3QSP A;  3S4B A;  3W7W A;  2D8L A;  3WUX A;  3QFY A;  5MEH A;  2GZ6 A;  2JG0 A;  4TF4 A;  1DL2 A;  3QFZ A;  3RX7 A;  3E6U A;  3QWT A;  3A3V A;  5DGR A;  3K11 A;  1VD5 A;  4L6X A;  2RI9 A;  1IS9 A;  1XWT A;  2F6D A;  3QXF A;  2VN7 A;  3PMM A;  3W5N A;  1GAI A;  1WU6 A;  1FCE A;  3GLY A;  5M7I A;  1V7W A;  2NVP A;  5M7Y A;  3EZ8 A;  1ULV A;  3RX5 A;  1FP3 A;  4Q2B A;  1FBW A;  1RQ5 A;  4WVB A;  2ZBL A;  4L0G A;  3S4D A;  3S4C A;  2AFA A;  2FBA A;  2EAE A;  2CQT A;  1NC5 A;  3ANI A;  3QT9 A;  1FO2 A;  3QPF A;  3ANK A;  1FBO A;  3P2C A;  3RX8 A;  4AYR A;  1L2A A;  1LF6 A;  1LF9 A;  4WVC A;  2JF4 A;  2XFG A;  1GLM A;  4XUV A;  1TF4 A;  1UG9 A;  3H7L A;  4Z4L A;  3WKI A;  4J5T A;  4KTR A;  5GY3 A;  3GT5 A;  5DGQ A;  4FUS A;  1KFG A;  2P0V A;  2ZZR A;  4AYO A;  2FUZ A;  1KKT A;  3QG0 A;  4TXT A;  2FV0 A;  5GW7 A;  2YIK A;  3S4A A;  1HCU A;  4WU0 A;  3W7S A;  1GA2 A;  3QXQ A;  4Z4J A;  1FMI A;  3H2W A;  1KS8 A;  3W7T A;  1KWF A;  2VN4 A;  2WYN A;  3TF4 A;  1IA7 A;  1V5C A;  4DOE A;  1UT9 A;  1KSC A;  1G87 A; 
#chains in the Genus database with same CATH topology
 1HMW A;  3AFL A;  1JS4 A;  3N0F A;  3N0G A;  3KSL B;  2OKX A;  3Q79 B;  3WKF A;  5EAT A;  1CEM A;  4QT9 A;  3G4D A;  2H6F B;  4Q88 A;  3P5R A;  5IL3 A;  3M74 A;  1N9A B;  1N24 A;  2E24 A;  3EQA A;  1IA6 A;  1TNO B;  3M02 A;  1O5M B;  5IK0 A;  1H37 A;  2JJB A;  1HXA A;  3RJ3 A;  3REN A;  1AYX A;  3ANJ A;  3ACS A;  1LXM A;  2H6G B;  1N4R B;  4LNG B;  3E80 A;  3WIW A;  2I07 B;  4GTR B;  2A73 B;  1TNY B;  1H13 A;  5C05 A;  1WZZ A;  3SAE A;  3RSY A;  4D4D A;  1N7R A;  1H39 A;  2ZIR B;  3Q7F B;  2DRQ A;  4D4C A;  3VW5 A;  3P5P A;  1K72 A;  1CLC A;  3QSP A;  1KSD A;  3M78 A;  3SDR A;  1G9G A;  5ILD A;  1D8D B;  1OJN A;  5MEH A;  4NEI A;  1DL2 A;  1C3D A;  1RWA A;  2FUT A;  3A3V A;  1HV6 A;  4FNV A;  1XWT A;  1N21 A;  2F6D A;  2J5C A;  4OZW A;  2VN7 A;  4KKJ A;  3PMM A;  1WU6 A;  2BRW A;  3EZ8 A;  4C1S A;  1W6K A;  3M72 A;  4Q2B A;  3S4D A;  1O1T B;  3DSW B;  3S4C A;  2AFA A;  4MBG B;  2EAE A;  2CQT A;  3ANI A;  2FUQ A;  3SFX B;  3S9V A;  3RX8 A;  2H6H B;  2PMV A;  2JF4 A;  2ONG A;  1JCR B;  4XUV A;  4GL3 A;  1LTX B;  1N7Q A;  1QBQ B;  4KTR A;  3HXE B;  3PZ3 B;  1NI1 B;  1KKT A;  5IKA A;  4M76 A;  2YIK A;  2ONH A;  3S4A A;  3SDV A;  1GA2 A;  3KSQ B;  1HZF A;  2VN4 A;  3TF4 A;  1S63 B;  1IA7 A;  1V5C A;  5JMF A;  3KLS A;  3SDQ A;  2R2L B;  5KKB A;  3X17 A;  1HXC A;  4EL8 A;  1XW2 A;  4LNV A;  1SA4 B;  1O6H A;  3EU5 B;  1TNU B;  3W7X A;  2GH4 A;  1H3B A;  1HN0 A;  4DOD A;  4ZH5 A;  2B4F A;  1HM3 A;  5IM1 A;  3WKG A;  3SDT A;  3GZK A;  4YDO B;  2BBC A;  2CQS A;  3ON6 A;  3OED A;  1LD8 B;  1QSJ A;  1FAE A;  1RWH A;  3W5M A;  1NXC A;  3D3I A;  1KRE A;  1O6R A;  1V5D A;  5FO7 B;  3E73 A;  4CJ1 A;  4WVA A;  5E2J A;  3QT3 A;  3DSV B;  5EAS A;  3C72 B;  4AYQ A;  4ZH1 A;  3CIH A;  1G6I A;  4D4B A;  3W7W A;  3SQC A;  1J0M A;  3HXF B;  2WIN B;  3A0O A;  1TN8 B;  2D8L A;  1TNZ B;  1RWG A;  5ILJ A;  2JG0 A;  4TF4 A;  1N22 A;  3RX7 A;  5JPM B;  1H36 A;  3E7J A;  3K11 A;  1IS9 A;  1N4P B;  3QXF A;  5JPN B;  4ONT A;  3DPY B;  3HXC B;  4MMI A;  3W5N A;  5M7I A;  1FCE A;  3GLY A;  3Q73 B;  1OJO A;  2V3N A;  2H6I B;  3E37 B;  1N7N A;  1CB8 A;  3DSX B;  4WVB A;  1FPP B;  1OJP A;  2FBA A;  1NC5 A;  3M71 A;  1W3Y A;  3QT9 A;  1FO2 A;  5ILK A;  1MZC B;  3P2C A;  3HXD B;  1L2A A;  2ZIS B;  1GXM A;  1O1S B;  1N1B A;  5ILZ A;  1UG9 A;  4Z4L A;  5DHI A;  3WKI A;  4J5T A;  4DI5 A;  3DRA B;  3GT5 A;  4LNB B;  1O6Q A;  1KFG A;  2P0V A;  4FUS A;  2ZZR A;  3EU8 A;  4AYO A;  3QG0 A;  1J0N A;  2GOX A;  1HCU A;  3EUV B;  1N20 A;  4GAX A;  4GTP B;  3QXQ A;  1KS8 A;  4OZV A;  2X03 A;  4D94 A;  4V1R A;  1KZP B;  1G87 A;  1WU4 A;  4KTP A;  1F9D A;  1N4Q B;  1AGM A;  3M73 A;  3WC3 A;  4L9P B;  1L1Y A;  4EHM B;  5GZK A;  1DOG A;  3QRY A;  1H3A A;  3ACT A;  2G02 A;  1UMP A;  1O79 A;  1H54 A;  1JCQ B;  4F10 A;  3M01 A;  1FT1 B;  5IKH A;  4D4A A;  2BRP A;  2DRS A;  4V1S A;  2G0D A;  3G6J B;  3M00 A;  5CD2 A;  3M7E A;  1FO3 A;  2WCO A;  5IK6 A;  2V8K A;  2QNO A;  4ZRQ A;  1HX9 A;  2EAB A;  5CZL A;  2EAD A;  1N1Z A;  2Q1F A;  3E32 B;  4MU9 A;  3M7L A;  2D5J A;  4GTV B;  1SA5 B;  1V7V A;  2FV1 A;  3D5R A;  3KQ4 A;  3VXD A;  5CA3 A;  3LZ9 A;  1GAH A;  2V3P A;  1X1J A;  3WUX A;  1TNB B;  1C82 A;  2GZ6 A;  3E34 B;  1X81 B;  3E6U A;  3QWT A;  1KZO B;  1EGU A;  1N7P A;  2IEJ B;  4GTM B;  1N23 A;  4E1Y A;  1V7W A;  1W6J A;  3DSU B;  3HXB B;  3Q78 B;  3PZ1 B;  4OJZ A;  4L0G A;  1HM2 A;  2BB5 A;  3PYB A;  1X1H A;  3PZ4 B;  4RNQ A;  3QPF A;  1R76 A;  1FBO A;  1GSZ A;  4GTT B;  5JMD A;  5DHK A;  1LF9 A;  3Q75 B;  4WVC A;  3E30 B;  2XFG A;  4YDE B;  5GY3 A;  3VSM A;  1N4S B;  2FV0 A;  4BOK A;  3CU7 A;  1N7O A;  3W7S A;  3NFV A;  1D8E B;  4Z4J A;  1FMI A;  3H2W A;  1OJM A;  3M7B A;  1KWF A;  3M75 A;  1S64 B;  4MMH A;  4DOE A;  2E22 A;  4FXG B;  1UT9 A;  1QAZ A;  5FOB B;  3NNB A;  1LXK A;  2BB6 A;  2Z07 A;  3E33 B;  4FXK B;  1H3C A;  2RGK A;  3T33 A;  4F13 A;  2WDA A;  3K7X A;  3WIR A;  1F1S A;  5ILI A;  4CE7 A;  1RWF A;  1F9O A;  1G9J A;  3H3K A;  2EAC A;  2AHF A;  1H14 A;  2DRO A;  3M77 A;  1TN6 B;  1SQC A;  1H35 A;  3RRS A;  4ZG8 A;  1GHQ A;  1RWC A;  5IK9 A;  5FO8 B;  3M7C A;  3QDE A;  4ZRP A;  3WIQ A;  1XWQ A;  3Q7A B;  1WU5 A;  4AYP A;  3DSS B;  5EAU A;  1H12 A;  4OK4 A;  1V7X A;  2RI8 A;  4BOJ A;  4CJ0 A;  4OK2 A;  3WKH A;  4JJJ A;  2V8I A;  1DCE B;  2AHG A;  2A8Z A;  3W7U A;  2V8J A;  1KRF A;  3VSN A;  3AFJ A;  3PZ2 B;  2DRR A;  1X9D A;  3S4B A;  4KKI A;  3QFY A;  2BED B;  3QFZ A;  1JCS B;  3OXU A;  5DGR A;  1VD5 A;  4L6X A;  5IL8 A;  2RI9 A;  1LOH A;  5FO9 B;  1NL4 B;  2F0Y B;  3PYA A;  4FJQ A;  2XQW A;  5ILH A;  1O1R B;  1GAI A;  2WII B;  2NVP A;  5M7Y A;  1ULV A;  1HXG A;  4YCR A;  2XWB B;  3RX5 A;  1FP3 A;  1FBW A;  1RQ5 A;  1LD7 B;  2ZBL A;  1N94 B;  1RW9 A;  3SFY B;  1GXO A;  2WY7 A;  3ANK A;  1LF6 A;  4AYR A;  1F9G A;  2WY8 A;  1TN7 B;  5AGD A;  2PN5 A;  3DST B;  4GTS B;  1GLM A;  1TF4 A;  3H7L A;  1QQF A;  1FT2 B;  1N95 B;  3D5S A;  1HMU A;  5DGQ A;  5ILY A;  2XWJ B;  4GTQ B;  2FUZ A;  4TXT A;  5GW7 A;  1GXN A;  4LIX A;  3M76 A;  2SQC A;  3G4F A;  4WU0 A;  1I8Q A;  3W7T A;  1X1I A;  2WYN A;  4GTO B;  2NOJ A;  2B39 A;  3SDU A;  2BRV X;  1KSC A; 
#chains in the Genus database with same CATH homology
 1JS4 A;  3KSL B;  2OKX A;  3Q79 B;  3WKF A;  1CEM A;  4QT9 A;  2H6F B;  4Q88 A;  3P5R A;  3M74 A;  1N9A B;  3EQA A;  1IA6 A;  1TNO B;  1O5M B;  1H37 A;  2JJB A;  3RJ3 A;  3REN A;  1AYX A;  3ANJ A;  3ACS A;  2H6G B;  1N4R B;  4LNG B;  3WIW A;  2I07 B;  4GTR B;  2A73 B;  1TNY B;  1H13 A;  1WZZ A;  3SAE A;  3RSY A;  4D4D A;  1H39 A;  2ZIR B;  3Q7F B;  2DRQ A;  4D4C A;  3VW5 A;  3P5P A;  1K72 A;  1CLC A;  3QSP A;  1KSD A;  3M78 A;  3SDR A;  1G9G A;  1D8D B;  5MEH A;  1DL2 A;  1C3D A;  3A3V A;  1XWT A;  2F6D A;  2VN7 A;  4KKJ A;  3PMM A;  1WU6 A;  3EZ8 A;  4C1S A;  1W6K A;  3M72 A;  4Q2B A;  3S4D A;  1O1T B;  3DSW B;  3S4C A;  2AFA A;  4MBG B;  2EAE A;  2CQT A;  3ANI A;  3SFX B;  3S9V A;  3RX8 A;  2H6H B;  2PMV A;  2JF4 A;  1JCR B;  4XUV A;  4GL3 A;  1LTX B;  1QBQ B;  4KTR A;  3HXE B;  3PZ3 B;  1NI1 B;  1KKT A;  4M76 A;  2YIK A;  3S4A A;  3SDV A;  1GA2 A;  3KSQ B;  1HZF A;  2VN4 A;  3TF4 A;  1S63 B;  1IA7 A;  1V5C A;  3KLS A;  3SDQ A;  2R2L B;  5KKB A;  3X17 A;  4EL8 A;  1XW2 A;  4LNV A;  1SA4 B;  1O6H A;  3EU5 B;  1TNU B;  3W7X A;  2GH4 A;  1H3B A;  4DOD A;  4ZH5 A;  2B4F A;  3WKG A;  3SDT A;  3GZK A;  4YDO B;  2BBC A;  2CQS A;  3ON6 A;  3OED A;  1LD8 B;  1QSJ A;  1FAE A;  3W5M A;  1NXC A;  3D3I A;  1KRE A;  1O6R A;  1V5D A;  5FO7 B;  3E73 A;  4CJ1 A;  4WVA A;  5E2J A;  3QT3 A;  3DSV B;  3C72 B;  4AYQ A;  4ZH1 A;  3CIH A;  1G6I A;  4D4B A;  3W7W A;  3SQC A;  3HXF B;  2WIN B;  1TN8 B;  2D8L A;  1TNZ B;  2JG0 A;  4TF4 A;  3RX7 A;  5JPM B;  1H36 A;  3K11 A;  1IS9 A;  1N4P B;  3QXF A;  5JPN B;  4ONT A;  3DPY B;  3HXC B;  3W5N A;  5M7I A;  1FCE A;  3GLY A;  3Q73 B;  2V3N A;  2H6I B;  3E37 B;  3DSX B;  4WVB A;  1FPP B;  2FBA A;  1NC5 A;  3M71 A;  3QT9 A;  1FO2 A;  1MZC B;  3P2C A;  3HXD B;  1L2A A;  2ZIS B;  1GXM A;  1O1S B;  1UG9 A;  4Z4L A;  3WKI A;  4J5T A;  3DRA B;  3GT5 A;  4LNB B;  4FUS A;  1O6Q A;  1KFG A;  2P0V A;  2ZZR A;  3EU8 A;  4AYO A;  3QG0 A;  2GOX A;  1HCU A;  3EUV B;  4GTP B;  3QXQ A;  1KS8 A;  4D94 A;  4V1R A;  1KZP B;  1G87 A;  1WU4 A;  4KTP A;  1F9D A;  1N4Q B;  1AGM A;  3M73 A;  3WC3 A;  4L9P B;  1L1Y A;  4EHM B;  5GZK A;  1DOG A;  3QRY A;  1H3A A;  3ACT A;  2G02 A;  1UMP A;  1O79 A;  1H54 A;  1JCQ B;  1FT1 B;  4D4A A;  2DRS A;  4V1S A;  2G0D A;  3G6J B;  5CD2 A;  3M7E A;  1FO3 A;  2V8K A;  2QNO A;  4ZRQ A;  2EAB A;  5CZL A;  2EAD A;  3E32 B;  4MU9 A;  3M7L A;  2D5J A;  4GTV B;  1SA5 B;  1V7V A;  2FV1 A;  3D5R A;  3KQ4 A;  3VXD A;  5CA3 A;  1GAH A;  2V3P A;  3WUX A;  1TNB B;  2GZ6 A;  3E34 B;  1X81 B;  3E6U A;  3QWT A;  1KZO B;  2IEJ B;  4GTM B;  1V7W A;  1W6J A;  3DSU B;  3HXB B;  3Q78 B;  3PZ1 B;  4L0G A;  2BB5 A;  3PYB A;  3PZ4 B;  3QPF A;  1R76 A;  1FBO A;  1GSZ A;  4GTT B;  1LF9 A;  3Q75 B;  4WVC A;  3E30 B;  2XFG A;  4YDE B;  5GY3 A;  1N4S B;  2FV0 A;  4BOK A;  3CU7 A;  3W7S A;  1D8E B;  4Z4J A;  1FMI A;  3H2W A;  3M7B A;  1KWF A;  3M75 A;  1S64 B;  4DOE A;  4FXG B;  1UT9 A;  5FOB B;  2BB6 A;  2Z07 A;  3E33 B;  4FXK B;  1H3C A;  2RGK A;  3T33 A;  3K7X A;  3WIR A;  4CE7 A;  1F9O A;  1G9J A;  3H3K A;  2EAC A;  2AHF A;  1H14 A;  2DRO A;  3M77 A;  1TN6 B;  1SQC A;  1H35 A;  3RRS A;  4ZG8 A;  1GHQ A;  5FO8 B;  3M7C A;  3QDE A;  4ZRP A;  3WIQ A;  1XWQ A;  3Q7A B;  1WU5 A;  4AYP A;  3DSS B;  1H12 A;  1V7X A;  2RI8 A;  4BOJ A;  4CJ0 A;  3WKH A;  4JJJ A;  2V8I A;  1DCE B;  2AHG A;  2A8Z A;  3W7U A;  2V8J A;  1KRF A;  3AFJ A;  3PZ2 B;  2DRR A;  1X9D A;  3S4B A;  4KKI A;  3QFY A;  2BED B;  3QFZ A;  1JCS B;  3OXU A;  5DGR A;  1VD5 A;  4L6X A;  2RI9 A;  5FO9 B;  1NL4 B;  2F0Y B;  3PYA A;  2XQW A;  1O1R B;  1GAI A;  2WII B;  2NVP A;  5M7Y A;  1ULV A;  4YCR A;  2XWB B;  3RX5 A;  1FP3 A;  1FBW A;  1RQ5 A;  1LD7 B;  2ZBL A;  1N94 B;  3SFY B;  1GXO A;  2WY7 A;  3ANK A;  1LF6 A;  4AYR A;  2WY8 A;  1TN7 B;  5AGD A;  2PN5 A;  3DST B;  4GTS B;  1GLM A;  1TF4 A;  3H7L A;  1QQF A;  1FT2 B;  1N95 B;  3D5S A;  5DGQ A;  2XWJ B;  4GTQ B;  2FUZ A;  4TXT A;  5GW7 A;  1GXN A;  4LIX A;  3M76 A;  2SQC A;  4WU0 A;  3W7T A;  2WYN A;  4GTO B;  2NOJ A;  2B39 A;  3SDU A;  1KSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...