3DSXB

Crystal structure of rabggtase(delta lrr; delta ig)in complex with di-prenylated peptide ser-cys(gg)-ser-cys(gg) derivated from rab7
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
327
structure length
325
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSKDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Structures of RabGGTase-substrate/product complexes provide insights into the evolution of protein prenylation
pubmed doi rcsb
source organism Rattus norvegicus
total genus 120
structure length 325
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3dsxB00
4EHMB 1O1SB 1NL4B 1TN6B 5FO8B 2BB6A 1QQFA 1TNOB 2NOJA 2PMVA 2V8JA 3K7XA 1N4SB 2V3NA 1N4PB 1TNZB 2IEJB 4LNGB 4YDOB 5JPNB 3PZ1B 3KLSA 2BB5A 1GXOA 4ONTA 2ZIRB 3E37B 1N9AB 1W6JA 2WIIB 3E30B 3KSLB 4D4BA 1S64B 2PN5A 1D8EB 3PZ4B 4D4AA 3OXUA 3D5RA 5FO9B 5FOBB 3RJ3A 3G6JB 1D8DB 4GTTB 1H35A 1O1TB 1GXMA 1H39A 1O6QA 3D5SA 3Q7FB 1O6RA 1JCSB 2ZISB 4YDEB 3Q73B 2R2LB 4BOKA 1QBQB 1O1RB 4ZH1A 2A73B 1TN8B 1GSZA 1FT1B 1W6KA 2H6FB 3DRAB 3SFXB 4MBGB 3DSVB 1N4QB 1X81B 1DCEB 1JCRB 1H3BA 2WINB 4GTMB 4GTRB 2B39A 3OEDA 1N95B 4GTQB 2V8KA 1TNBB 1NI1B 3DPYB 1JCQB 3DSTB 1N94B 1UMPA 4GTVB 3DSUB 1KZPB 4ZRQA 1C3DA 1H36A 2G02A 2BBCA 4FXGB 3Q79B 1TN7B 4C1SA 1H37A 3E33B 1R76A 3DSXB 5AGDA 3HXDB 1LD8B 4KKIA 4GTSB 3KQ4A 3C72B 2H6GB 2WY7A 3Q78B 3HXEB 1QSJA 3DSSB 1FT2B 2V8IA 4GTPB 5JPMB 1SA4B 4ZRPA 4V1SA 1O6HA 3HXFB 2XWJB 2G0DA 3Q75B 2I07B 1O5MB 1HZFA 4GTOB 1FPPB 3SFYB 4D94A 1GHQA 2SQCA 1KZOB 3E34B 3PZ3B 4MU9A 1O79A 1N4RB 4D4CA 4D4DA 2V3PA 1SA5B 3HXBB 1TNYB 2WY8A 4V1RA 1SQCA 3EUVB 3Q7AB 3CU7A 1MZCB 4FXKB 3HXCB 1TNUB 1S63B 1H3CA 3DSWB 1H3AA 2H6IB 4LNBB 3SQCA 3PZ2B 4KKJA 1GXNA 1LTXB 3EU5B 2GOXA 1LD7B 3KSQB 2F0YB 4L9PB 2H6HB 3E32B 2XQWA 2XWBB 5FO7B 2BEDB 4LNVA 4M76A 4BOJA
chains in the Genus database with same CATH superfamily
4EHMB 1OJNA 3M76A 3N0GA 1H54A 4F10A 3M7EA 3SDQA 3AFJA 2EACA 2PMVA 1N7PA 2V3NA 1RWCA 2IEJB 5C05A 1N22A 5CA3A 5GY3A 3PZ1B 1WZZA 2BB5A 1W6JA 4GL3A 4D4BA 1S64B 2E22A 4D4AA 1GAIA 3D5RA 1D8DB 1O1TB 1GXMA 1HX9A 1V5DA 2P0VA 5IM1A 1GLMA 2B4FA 1JCSB 4KTPA 2RI9A 3QPFA 4MMIA 3QT3A 3Q73B 1FP3A 1GA2A 5IL8A 1QBQB 3E6UA 3RX7A 1TN8B 1GSZA 3EU8A 5CZLA 2H6FB 1N1BA 1KSDA 3WUXA 2D8LA 4OK2A 1L2AA 2GH4A 1DCEB 1H3BA 4WU0A 1QAZA 4Q88A 2BRPA 2DROA 2V8KA 1N1ZA 1KRFA 3SDTA 1K72A 1LXMA 4GTVB 1KZPB 4ZRQA 1H36A 4GAXA 3Q79B 1ULVA 1F9GA 3E33B 1R76A 3M7BA 1LXKA 4TXTA 2FUZA 3M72A 1FMIA 1WU4A 4GTSB 4AYOA 3QT9A 3N0FA 2D5JA 3W5NA 1QSJA 1H12A 3DSSB 2ONGA 3CIHA 4GTPB 3QXQA 2I07B 1GHQA 1KZOB 3S4BA 3ANIA 4ZG8A 4AYRA 1O79A 2FV0A 3RX5A 3M75A 1V7XA 1XWQA 1HXCA 3M74A 5ILHA 3Q7AB 3GLYA 4WVBA 1TNUB 2NVPA 1H3AA 2JF4A 1RWAA 1X1JA 5ILJA 3PZ2B 3QSPA 3RRSA 4KKJA 1GXNA 2GOXA 3KSQB 4L9PB 3NFVA 5M7YA 3VXDA 1FO2A 1G9GA 2XWBB 2DRQA 5CD2A 5ILZA 5ILKA 5IKHA 3WIQA 2WYNA 4FNVA 3RENA 5IK6A 5FO8B 2BB6A 2BRVX 1DL2A 1OJPA 3ANKA 1WU5A 1GXOA 4WVAA 3E37B 3KSLB 3PMMA 5JMFA 1D8EB 3GZKA 3OXUA 3RJ3A 4GTTB 5ILYA 3G4DA 3VSMA 1FCEA 3P2CA 4OZWA 2A8ZA 5ILIA 1C82A 1J0MA 1RWGA 2CQSA 3SDRA 1FT1B 5M7IA 4QT9A 3DRAB 1N7RA 3SFXB 4MBGB 3QWTA 1X81B 1N21A 2WINB 1TF4A 4GTRB 3OEDA 4GTQB 1OJMA 3DPYB 4FUSA 4XUVA 4L6XA 3DSUB 2FBAA 1C3DA 1FO3A 3S4CA 2G02A 2GZ6A 5EASA 3K11A 4FXGB 1EGUA 1N20A 1J0NA 5AGDA 1V7VA 1HN0A 1N7NA 3KQ4A 1FBOA 1AGMA 2H6GB 3A0OA 3HXEB 1KWFA 2YIKA 3W7WA 2F6DA 1G87A 4V1SA 1O6HA 2ZZRA 2XWJB 3X17A 1UG9A 1CB8A 1KS8A 1FPPB 4MMHA 3SFYB 4F13A 4D94A 3M71A 5E2JA 1N4RB 4FJQA 5MEHA 2XFGA 4TF4A 3WC3A 1SA5B 4NEIA 3M78A 4AYPA 3EUVB 3CU7A 5DGRA 2FUQA 3RSYA 3H7LA 1LF9A 3SAEA 1S63B 2BRWA 4AYQA 1KREA 3WKIA 5EAUA 2H6IB 3H3KA 3AFLA 1W3YA 1IS9A 2E24A 2AFAA 1HMWA 2BEDB 4LNVA 1RWHA 4DI5A 4BOJA 3S4AA 1O1SB 2OKXA 5KKBA 2QNOA 2WDAA 3SDUA 2VN4A 2DRSA 1IA7A 1QQFA 1TNOB 2NOJA 2V8JA 1TNZB 3W7XA 1FAEA 3M73A 3E30B 3W5MA 1F1SA 3A3VA 3QFYA 5FO9B 2X03A 3EQAA 5GZKA 1H35A 3P5PA 1H39A 1CLCA 1O6QA 3WIRA 1XWTA 3M01A 5JMDA 3Q7FB 3ANJA 4YDEB 1KFGA 1X1IA 4CJ1A 2R2LB 4ZH1A 1OJOA 1LOHA 2Q1FA 3ACTA 5IK0A 3DSVB 1GAHA 1NXCA 4Q2BA 1JCRB 5ILDA 2B39A 1N95B 3VW5A 4JJJA 1RWFA 1TNBB 1JCQB 1N94B 5GW7A 1UMPA 1KKTA 3G4FA 4DOEA 3P5RA 4C1SA 1TN7B 2JJBA 1H37A 3DSXB 1L1YA 4KKIA 4ZH5A 3RX8A 1N24A 1RQ5A 3WKFA 2RI8A 5IL3A 1VD5A 3QRYA 1G9JA 2EADA 2AHGA 1HXAA 1X1HA 2V8IA 4ZRPA 5DHKA 3VSNA 3QG0A 1XW2A 3Q75B 1HZFA 4GTOB 2FV1A 1NC5A 3PZ3B 4MU9A 3QFZA 1X9DA 2V3PA 1G6IA 3M7CA 1TNYB 3QXFA 5EATA 1MZCB 2J5CA 4L0GA 3DSWB 5IKAA 3SQCA 3ON6A 1LD7B 2F0YB 2H6HB 3W7SA 4Z4LA 4OK4A 2WCOA 5FO7B 4M76A 4WVCA 2EAEA 3S9VA 3M02A 1NL4B 1TN6B 1HMUA 1UT9A 2ONHA 3K7XA 3M77A 1N4SB 4YDOB 1N4PB 4LNGB 5JPNB 3KLSA 4E1YA 4ONTA 1H13A 2ZIRB 1N9AB 1JS4A 2WIIB 3LZ9A 2PN5A 3PZ4B 5FOBB 3G6JB 1RW9A 4YCRA 4Z4JA 3SDVA 1H14A 3D5SA 1O6RA 2ZISB 3EZ8A 2ZBLA 5IK9A 4BOKA 1O1RB 1V5CA 4J5TA 1AYXA 2A73B 1LF6A 1W6KA 1HM2A 1HCUA 1N4QB 3GT5A 4GTMB 1IA6A 1I8QA 3QDEA 4DODA 3M7LA 1NI1B 2FUTA 3DSTB 3E7JA 2RGKA 5DHIA 3D3IA 3NNBA 1CEMA 2BBCA 3WKHA 3W7TA 3HXDB 3H2WA 1LD8B 4CE7A 2Z07A 3C72B 3E80A 1KSCA 2WY7A 3Q78B 1WU6A 1V7WA 3M00A 1N23A 1FT2B 3PYBA 5JPMB 1SA4B 1HV6A 3W7UA 1F9DA 3HXFB 4OZVA 2G0DA 1O5MB 4LIXA 3PYAA 1HXGA 2SQCA 2EABA 3E34B 4KTRA 4D4CA 4OJZA 3WKGA 4D4DA 1F9OA 3HXBB 4CJ0A 2WY8A 3E73A 4V1RA 3T33A 4EL8A 1SQCA 1DOGA 4FXKB 4RNQA 3HXCB 3S4DA 1H3CA 1N7QA 3WIWA 2AHFA 1HM3A 3ACSA 3TF4A 4LNBB 1N7OA 2JG0A 1LTXB 3EU5B 1FBWA 2VN7A 3E32B 2XQWA 5DGQA 2CQTA 2DRRA
chains in the Genus database with same CATH topology
4EHMB 3M76A 1H54A 3M7EA 3SDQA 3AFJA 2EACA 2PMVA 2V3NA 2IEJB 5CA3A 5GY3A 3PZ1B 1WZZA 2BB5A 1W6JA 4GL3A 4D4BA 1S64B 4D4AA 1GAIA 3D5RA 1D8DB 1O1TB 1GXMA 1V5DA 2P0VA 1GLMA 2B4FA 1JCSB 4KTPA 2RI9A 3QPFA 3QT3A 3Q73B 1FP3A 1GA2A 1QBQB 3E6UA 3RX7A 1TN8B 1GSZA 3EU8A 5CZLA 2H6FB 1KSDA 3WUXA 2D8LA 1L2AA 2GH4A 1DCEB 1H3BA 4WU0A 4Q88A 2DROA 2V8KA 1KRFA 3SDTA 1K72A 4GTVB 1KZPB 4ZRQA 1H36A 3Q79B 1ULVA 3E33B 1R76A 3M7BA 4TXTA 2FUZA 3M72A 1FMIA 1WU4A 4GTSB 4AYOA 3QT9A 2D5JA 3W5NA 1QSJA 1H12A 3DSSB 3CIHA 4GTPB 3QXQA 2I07B 1GHQA 1KZOB 3S4BA 3ANIA 4ZG8A 4AYRA 1O79A 2FV0A 3RX5A 3M75A 1V7XA 1XWQA 3M74A 3Q7AB 3GLYA 4WVBA 1TNUB 2NVPA 1H3AA 2JF4A 3PZ2B 3QSPA 3RRSA 4KKJA 1GXNA 2GOXA 3KSQB 4L9PB 5M7YA 3VXDA 1FO2A 1G9GA 2XWBB 2DRQA 5CD2A 3WIQA 2WYNA 3RENA 5FO8B 2BB6A 1DL2A 3ANKA 1WU5A 1GXOA 4WVAA 3E37B 3KSLB 3PMMA 1D8EB 3GZKA 3OXUA 3RJ3A 4GTTB 1FCEA 3P2CA 2A8ZA 2CQSA 3SDRA 1FT1B 5M7IA 4QT9A 3DRAB 3SFXB 4MBGB 3QWTA 1X81B 2WINB 1TF4A 4GTRB 3OEDA 4GTQB 3DPYB 4FUSA 4XUVA 4L6XA 3DSUB 2FBAA 1C3DA 1FO3A 3S4CA 2G02A 2GZ6A 3K11A 4FXGB 5AGDA 1V7VA 3KQ4A 1FBOA 1AGMA 2H6GB 3HXEB 1KWFA 2YIKA 3W7WA 2F6DA 1G87A 4V1SA 1O6HA 2ZZRA 2XWJB 3X17A 1UG9A 1KS8A 1FPPB 3SFYB 4D94A 3M71A 5E2JA 1N4RB 5MEHA 2XFGA 4TF4A 3WC3A 1SA5B 3M78A 4AYPA 3EUVB 3CU7A 5DGRA 3RSYA 3H7LA 1LF9A 3SAEA 1S63B 4AYQA 1KREA 3WKIA 2H6IB 3H3KA 1IS9A 2AFAA 2BEDB 4LNVA 4BOJA 3S4AA 1O1SB 2OKXA 5KKBA 2QNOA 3SDUA 2VN4A 2DRSA 1IA7A 1QQFA 1TNOB 2NOJA 2V8JA 1TNZB 3W7XA 1FAEA 3M73A 3E30B 3W5MA 3A3VA 3QFYA 5FO9B 3EQAA 5GZKA 1H35A 3P5PA 1H39A 1CLCA 1O6QA 3WIRA 1XWTA 3Q7FB 3ANJA 4YDEB 1KFGA 4CJ1A 2R2LB 4ZH1A 3ACTA 3DSVB 1GAHA 1NXCA 4Q2BA 1JCRB 2B39A 1N95B 3VW5A 4JJJA 1TNBB 1JCQB 1N94B 5GW7A 1UMPA 1KKTA 4DOEA 3P5RA 4C1SA 1TN7B 2JJBA 1H37A 3DSXB 1L1YA 4KKIA 4ZH5A 3RX8A 1RQ5A 3WKFA 2RI8A 1VD5A 3QRYA 1G9JA 2EADA 2AHGA 2V8IA 4ZRPA 3QG0A 1XW2A 3Q75B 1HZFA 4GTOB 2FV1A 1NC5A 3PZ3B 4MU9A 3QFZA 1X9DA 2V3PA 1G6IA 3M7CA 1TNYB 3QXFA 1MZCB 4L0GA 3DSWB 3SQCA 3ON6A 1LD7B 2F0YB 2H6HB 3W7SA 4Z4LA 5FO7B 4M76A 4WVCA 2EAEA 3S9VA 1NL4B 1TN6B 1UT9A 3K7XA 3M77A 1N4SB 4YDOB 1N4PB 4LNGB 5JPNB 3KLSA 4ONTA 1H13A 2ZIRB 1N9AB 1JS4A 2WIIB 2PN5A 3PZ4B 5FOBB 3G6JB 4YCRA 4Z4JA 3SDVA 1H14A 3D5SA 1O6RA 2ZISB 3EZ8A 2ZBLA 4BOKA 1O1RB 1V5CA 4J5TA 1AYXA 2A73B 1LF6A 1W6KA 1HCUA 1N4QB 3GT5A 4GTMB 1IA6A 3QDEA 4DODA 3M7LA 1NI1B 3DSTB 2RGKA 3D3IA 1CEMA 2BBCA 3WKHA 3W7TA 3HXDB 3H2WA 1LD8B 4CE7A 2Z07A 3C72B 1KSCA 2WY7A 3Q78B 1WU6A 1V7WA 1FT2B 3PYBA 5JPMB 1SA4B 3W7UA 1F9DA 3HXFB 2G0DA 1O5MB 4LIXA 3PYAA 2SQCA 2EABA 3E34B 4KTRA 4D4CA 4D4DA 3WKGA 1F9OA 3HXBB 4CJ0A 2WY8A 3E73A 4V1RA 3T33A 4EL8A 1SQCA 1DOGA 4FXKB 3HXCB 3S4DA 1H3CA 3WIWA 2AHFA 3ACSA 3TF4A 4LNBB 2JG0A 1LTXB 3EU5B 1FBWA 2VN7A 3E32B 2XQWA 5DGQA 2CQTA 2DRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EHM B;  1O1S B;  1NL4 B;  1TN6 B;  5FO8 B;  2BB6 A;  1QQF A;  1TNO B;  2NOJ A;  2PMV A;  2V8J A;  3K7X A;  1N4S B;  2V3N A;  1N4P B;  1TNZ B;  2IEJ B;  4LNG B;  4YDO B;  5JPN B;  3PZ1 B;  3KLS A;  2BB5 A;  1GXO A;  4ONT A;  2ZIR B;  3E37 B;  1N9A B;  1W6J A;  2WII B;  3E30 B;  3KSL B;  4D4B A;  1S64 B;  2PN5 A;  1D8E B;  3PZ4 B;  4D4A A;  3OXU A;  3D5R A;  5FO9 B;  5FOB B;  3RJ3 A;  3G6J B;  1D8D B;  4GTT B;  1H35 A;  1O1T B;  1GXM A;  1H39 A;  1O6Q A;  3D5S A;  3Q7F B;  1O6R A;  1JCS B;  2ZIS B;  4YDE B;  3Q73 B;  2R2L B;  4BOK A;  1QBQ B;  1O1R B;  4ZH1 A;  2A73 B;  1TN8 B;  1GSZ A;  1FT1 B;  1W6K A;  2H6F B;  3DRA B;  3SFX B;  4MBG B;  3DSV B;  1N4Q B;  1X81 B;  1DCE B;  1JCR B;  1H3B A;  2WIN B;  4GTM B;  4GTR B;  2B39 A;  3OED A;  1N95 B;  4GTQ B;  2V8K A;  1TNB B;  1NI1 B;  3DPY B;  1JCQ B;  3DST B;  1N94 B;  1UMP A;  4GTV B;  3DSU B;  1KZP B;  4ZRQ A;  1C3D A;  1H36 A;  2G02 A;  2BBC A;  4FXG B;  3Q79 B;  1TN7 B;  4C1S A;  1H37 A;  3E33 B;  1R76 A;  3DSX B;  5AGD A;  3HXD B;  1LD8 B;  4KKI A;  4GTS B;  3KQ4 A;  3C72 B;  2H6G B;  2WY7 A;  3Q78 B;  3HXE B;  1QSJ A;  3DSS B;  1FT2 B;  2V8I A;  4GTP B;  5JPM B;  1SA4 B;  4ZRP A;  4V1S A;  1O6H A;  3HXF B;  2XWJ B;  2G0D A;  3Q75 B;  2I07 B;  1O5M B;  1HZF A;  4GTO B;  1FPP B;  3SFY B;  4D94 A;  1GHQ A;  2SQC A;  1KZO B;  3E34 B;  3PZ3 B;  4MU9 A;  1O79 A;  1N4R B;  4D4C A;  4D4D A;  2V3P A;  1SA5 B;  3HXB B;  1TNY B;  2WY8 A;  4V1R A;  1SQC A;  3EUV B;  3Q7A B;  3CU7 A;  1MZC B;  4FXK B;  3HXC B;  1TNU B;  1S63 B;  1H3C A;  3DSW B;  1H3A A;  2H6I B;  4LNB B;  3SQC A;  3PZ2 B;  4KKJ A;  1GXN A;  1LTX B;  3EU5 B;  2GOX A;  1LD7 B;  3KSQ B;  2F0Y B;  4L9P B;  2H6H B;  3E32 B;  2XQW A;  2XWB B;  5FO7 B;  2BED B;  4LNV A;  4M76 A;  4BOJ A; 
#chains in the Genus database with same CATH topology
 4EHM B;  1OJN A;  3M76 A;  3N0G A;  1H54 A;  4F10 A;  3M7E A;  3SDQ A;  3AFJ A;  2EAC A;  2PMV A;  1N7P A;  2V3N A;  1RWC A;  2IEJ B;  5C05 A;  1N22 A;  5CA3 A;  5GY3 A;  3PZ1 B;  1WZZ A;  2BB5 A;  1W6J A;  4GL3 A;  4D4B A;  1S64 B;  2E22 A;  4D4A A;  1GAI A;  3D5R A;  1D8D B;  1O1T B;  1GXM A;  1HX9 A;  1V5D A;  2P0V A;  5IM1 A;  1GLM A;  2B4F A;  1JCS B;  4KTP A;  2RI9 A;  3QPF A;  4MMI A;  3QT3 A;  3Q73 B;  1FP3 A;  1GA2 A;  5IL8 A;  1QBQ B;  3E6U A;  3RX7 A;  1TN8 B;  1GSZ A;  3EU8 A;  5CZL A;  2H6F B;  1N1B A;  1KSD A;  3WUX A;  2D8L A;  4OK2 A;  1L2A A;  2GH4 A;  1DCE B;  1H3B A;  4WU0 A;  1QAZ A;  4Q88 A;  2BRP A;  2DRO A;  2V8K A;  1N1Z A;  1KRF A;  3SDT A;  1K72 A;  1LXM A;  4GTV B;  1KZP B;  4ZRQ A;  1H36 A;  4GAX A;  3Q79 B;  1ULV A;  1F9G A;  3E33 B;  1R76 A;  3M7B A;  1LXK A;  4TXT A;  2FUZ A;  3M72 A;  1FMI A;  1WU4 A;  4GTS B;  4AYO A;  3QT9 A;  3N0F A;  2D5J A;  3W5N A;  1QSJ A;  1H12 A;  3DSS B;  2ONG A;  3CIH A;  4GTP B;  3QXQ A;  2I07 B;  1GHQ A;  1KZO B;  3S4B A;  3ANI A;  4ZG8 A;  4AYR A;  1O79 A;  2FV0 A;  3RX5 A;  3M75 A;  1V7X A;  1XWQ A;  1HXC A;  3M74 A;  5ILH A;  3Q7A B;  3GLY A;  4WVB A;  1TNU B;  2NVP A;  1H3A A;  2JF4 A;  1RWA A;  1X1J A;  5ILJ A;  3PZ2 B;  3QSP A;  3RRS A;  4KKJ A;  1GXN A;  2GOX A;  3KSQ B;  4L9P B;  3NFV A;  5M7Y A;  3VXD A;  1FO2 A;  1G9G A;  2XWB B;  2DRQ A;  5CD2 A;  5ILZ A;  5ILK A;  5IKH A;  3WIQ A;  2WYN A;  4FNV A;  3REN A;  5IK6 A;  5FO8 B;  2BB6 A;  2BRV X;  1DL2 A;  1OJP A;  3ANK A;  1WU5 A;  1GXO A;  4WVA A;  3E37 B;  3KSL B;  3PMM A;  5JMF A;  1D8E B;  3GZK A;  3OXU A;  3RJ3 A;  4GTT B;  5ILY A;  3G4D A;  3VSM A;  1FCE A;  3P2C A;  4OZW A;  2A8Z A;  5ILI A;  1C82 A;  1J0M A;  1RWG A;  2CQS A;  3SDR A;  1FT1 B;  5M7I A;  4QT9 A;  3DRA B;  1N7R A;  3SFX B;  4MBG B;  3QWT A;  1X81 B;  1N21 A;  2WIN B;  1TF4 A;  4GTR B;  3OED A;  4GTQ B;  1OJM A;  3DPY B;  4FUS A;  4XUV A;  4L6X A;  3DSU B;  2FBA A;  1C3D A;  1FO3 A;  3S4C A;  2G02 A;  2GZ6 A;  5EAS A;  3K11 A;  4FXG B;  1EGU A;  1N20 A;  1J0N A;  5AGD A;  1V7V A;  1HN0 A;  1N7N A;  3KQ4 A;  1FBO A;  1AGM A;  2H6G B;  3A0O A;  3HXE B;  1KWF A;  2YIK A;  3W7W A;  2F6D A;  1G87 A;  4V1S A;  1O6H A;  2ZZR A;  2XWJ B;  3X17 A;  1UG9 A;  1CB8 A;  1KS8 A;  1FPP B;  4MMH A;  3SFY B;  4F13 A;  4D94 A;  3M71 A;  5E2J A;  1N4R B;  4FJQ A;  5MEH A;  2XFG A;  4TF4 A;  3WC3 A;  1SA5 B;  4NEI A;  3M78 A;  4AYP A;  3EUV B;  3CU7 A;  5DGR A;  2FUQ A;  3RSY A;  3H7L A;  1LF9 A;  3SAE A;  1S63 B;  2BRW A;  4AYQ A;  1KRE A;  3WKI A;  5EAU A;  2H6I B;  3H3K A;  3AFL A;  1W3Y A;  1IS9 A;  2E24 A;  2AFA A;  1HMW A;  2BED B;  4LNV A;  1RWH A;  4DI5 A;  4BOJ A;  3S4A A;  1O1S B;  2OKX A;  5KKB A;  2QNO A;  2WDA A;  3SDU A;  2VN4 A;  2DRS A;  1IA7 A;  1QQF A;  1TNO B;  2NOJ A;  2V8J A;  1TNZ B;  3W7X A;  1FAE A;  3M73 A;  3E30 B;  3W5M A;  1F1S A;  3A3V A;  3QFY A;  5FO9 B;  2X03 A;  3EQA A;  5GZK A;  1H35 A;  3P5P A;  1H39 A;  1CLC A;  1O6Q A;  3WIR A;  1XWT A;  3M01 A;  5JMD A;  3Q7F B;  3ANJ A;  4YDE B;  1KFG A;  1X1I A;  4CJ1 A;  2R2L B;  4ZH1 A;  1OJO A;  1LOH A;  2Q1F A;  3ACT A;  5IK0 A;  3DSV B;  1GAH A;  1NXC A;  4Q2B A;  1JCR B;  5ILD A;  2B39 A;  1N95 B;  3VW5 A;  4JJJ A;  1RWF A;  1TNB B;  1JCQ B;  1N94 B;  5GW7 A;  1UMP A;  1KKT A;  3G4F A;  4DOE A;  3P5R A;  4C1S A;  1TN7 B;  2JJB A;  1H37 A;  3DSX B;  1L1Y A;  4KKI A;  4ZH5 A;  3RX8 A;  1N24 A;  1RQ5 A;  3WKF A;  2RI8 A;  5IL3 A;  1VD5 A;  3QRY A;  1G9J A;  2EAD A;  2AHG A;  1HXA A;  1X1H A;  2V8I A;  4ZRP A;  5DHK A;  3VSN A;  3QG0 A;  1XW2 A;  3Q75 B;  1HZF A;  4GTO B;  2FV1 A;  1NC5 A;  3PZ3 B;  4MU9 A;  3QFZ A;  1X9D A;  2V3P A;  1G6I A;  3M7C A;  1TNY B;  3QXF A;  5EAT A;  1MZC B;  2J5C A;  4L0G A;  3DSW B;  5IKA A;  3SQC A;  3ON6 A;  1LD7 B;  2F0Y B;  2H6H B;  3W7S A;  4Z4L A;  4OK4 A;  2WCO A;  5FO7 B;  4M76 A;  4WVC A;  2EAE A;  3S9V A;  3M02 A;  1NL4 B;  1TN6 B;  1HMU A;  1UT9 A;  2ONH A;  3K7X A;  3M77 A;  1N4S B;  4YDO B;  1N4P B;  4LNG B;  5JPN B;  3KLS A;  4E1Y A;  4ONT A;  1H13 A;  2ZIR B;  1N9A B;  1JS4 A;  2WII B;  3LZ9 A;  2PN5 A;  3PZ4 B;  5FOB B;  3G6J B;  1RW9 A;  4YCR A;  4Z4J A;  3SDV A;  1H14 A;  3D5S A;  1O6R A;  2ZIS B;  3EZ8 A;  2ZBL A;  5IK9 A;  4BOK A;  1O1R B;  1V5C A;  4J5T A;  1AYX A;  2A73 B;  1LF6 A;  1W6K A;  1HM2 A;  1HCU A;  1N4Q B;  3GT5 A;  4GTM B;  1IA6 A;  1I8Q A;  3QDE A;  4DOD A;  3M7L A;  1NI1 B;  2FUT A;  3DST B;  3E7J A;  2RGK A;  5DHI A;  3D3I A;  3NNB A;  1CEM A;  2BBC A;  3WKH A;  3W7T A;  3HXD B;  3H2W A;  1LD8 B;  4CE7 A;  2Z07 A;  3C72 B;  3E80 A;  1KSC A;  2WY7 A;  3Q78 B;  1WU6 A;  1V7W A;  3M00 A;  1N23 A;  1FT2 B;  3PYB A;  5JPM B;  1SA4 B;  1HV6 A;  3W7U A;  1F9D A;  3HXF B;  4OZV A;  2G0D A;  1O5M B;  4LIX A;  3PYA A;  1HXG A;  2SQC A;  2EAB A;  3E34 B;  4KTR A;  4D4C A;  4OJZ A;  3WKG A;  4D4D A;  1F9O A;  3HXB B;  4CJ0 A;  2WY8 A;  3E73 A;  4V1R A;  3T33 A;  4EL8 A;  1SQC A;  1DOG A;  4FXK B;  4RNQ A;  3HXC B;  3S4D A;  1H3C A;  1N7Q A;  3WIW A;  2AHF A;  1HM3 A;  3ACS A;  3TF4 A;  4LNB B;  1N7O A;  2JG0 A;  1LTX B;  3EU5 B;  1FBW A;  2VN7 A;  3E32 B;  2XQW A;  5DGQ A;  2CQT A;  2DRR A; 
#chains in the Genus database with same CATH homology
 4EHM B;  3M76 A;  1H54 A;  3M7E A;  3SDQ A;  3AFJ A;  2EAC A;  2PMV A;  2V3N A;  2IEJ B;  5CA3 A;  5GY3 A;  3PZ1 B;  1WZZ A;  2BB5 A;  1W6J A;  4GL3 A;  4D4B A;  1S64 B;  4D4A A;  1GAI A;  3D5R A;  1D8D B;  1O1T B;  1GXM A;  1V5D A;  2P0V A;  1GLM A;  2B4F A;  1JCS B;  4KTP A;  2RI9 A;  3QPF A;  3QT3 A;  3Q73 B;  1FP3 A;  1GA2 A;  1QBQ B;  3E6U A;  3RX7 A;  1TN8 B;  1GSZ A;  3EU8 A;  5CZL A;  2H6F B;  1KSD A;  3WUX A;  2D8L A;  1L2A A;  2GH4 A;  1DCE B;  1H3B A;  4WU0 A;  4Q88 A;  2DRO A;  2V8K A;  1KRF A;  3SDT A;  1K72 A;  4GTV B;  1KZP B;  4ZRQ A;  1H36 A;  3Q79 B;  1ULV A;  3E33 B;  1R76 A;  3M7B A;  4TXT A;  2FUZ A;  3M72 A;  1FMI A;  1WU4 A;  4GTS B;  4AYO A;  3QT9 A;  2D5J A;  3W5N A;  1QSJ A;  1H12 A;  3DSS B;  3CIH A;  4GTP B;  3QXQ A;  2I07 B;  1GHQ A;  1KZO B;  3S4B A;  3ANI A;  4ZG8 A;  4AYR A;  1O79 A;  2FV0 A;  3RX5 A;  3M75 A;  1V7X A;  1XWQ A;  3M74 A;  3Q7A B;  3GLY A;  4WVB A;  1TNU B;  2NVP A;  1H3A A;  2JF4 A;  3PZ2 B;  3QSP A;  3RRS A;  4KKJ A;  1GXN A;  2GOX A;  3KSQ B;  4L9P B;  5M7Y A;  3VXD A;  1FO2 A;  1G9G A;  2XWB B;  2DRQ A;  5CD2 A;  3WIQ A;  2WYN A;  3REN A;  5FO8 B;  2BB6 A;  1DL2 A;  3ANK A;  1WU5 A;  1GXO A;  4WVA A;  3E37 B;  3KSL B;  3PMM A;  1D8E B;  3GZK A;  3OXU A;  3RJ3 A;  4GTT B;  1FCE A;  3P2C A;  2A8Z A;  2CQS A;  3SDR A;  1FT1 B;  5M7I A;  4QT9 A;  3DRA B;  3SFX B;  4MBG B;  3QWT A;  1X81 B;  2WIN B;  1TF4 A;  4GTR B;  3OED A;  4GTQ B;  3DPY B;  4FUS A;  4XUV A;  4L6X A;  3DSU B;  2FBA A;  1C3D A;  1FO3 A;  3S4C A;  2G02 A;  2GZ6 A;  3K11 A;  4FXG B;  5AGD A;  1V7V A;  3KQ4 A;  1FBO A;  1AGM A;  2H6G B;  3HXE B;  1KWF A;  2YIK A;  3W7W A;  2F6D A;  1G87 A;  4V1S A;  1O6H A;  2ZZR A;  2XWJ B;  3X17 A;  1UG9 A;  1KS8 A;  1FPP B;  3SFY B;  4D94 A;  3M71 A;  5E2J A;  1N4R B;  5MEH A;  2XFG A;  4TF4 A;  3WC3 A;  1SA5 B;  3M78 A;  4AYP A;  3EUV B;  3CU7 A;  5DGR A;  3RSY A;  3H7L A;  1LF9 A;  3SAE A;  1S63 B;  4AYQ A;  1KRE A;  3WKI A;  2H6I B;  3H3K A;  1IS9 A;  2AFA A;  2BED B;  4LNV A;  4BOJ A;  3S4A A;  1O1S B;  2OKX A;  5KKB A;  2QNO A;  3SDU A;  2VN4 A;  2DRS A;  1IA7 A;  1QQF A;  1TNO B;  2NOJ A;  2V8J A;  1TNZ B;  3W7X A;  1FAE A;  3M73 A;  3E30 B;  3W5M A;  3A3V A;  3QFY A;  5FO9 B;  3EQA A;  5GZK A;  1H35 A;  3P5P A;  1H39 A;  1CLC A;  1O6Q A;  3WIR A;  1XWT A;  3Q7F B;  3ANJ A;  4YDE B;  1KFG A;  4CJ1 A;  2R2L B;  4ZH1 A;  3ACT A;  3DSV B;  1GAH A;  1NXC A;  4Q2B A;  1JCR B;  2B39 A;  1N95 B;  3VW5 A;  4JJJ A;  1TNB B;  1JCQ B;  1N94 B;  5GW7 A;  1UMP A;  1KKT A;  4DOE A;  3P5R A;  4C1S A;  1TN7 B;  2JJB A;  1H37 A;  3DSX B;  1L1Y A;  4KKI A;  4ZH5 A;  3RX8 A;  1RQ5 A;  3WKF A;  2RI8 A;  1VD5 A;  3QRY A;  1G9J A;  2EAD A;  2AHG A;  2V8I A;  4ZRP A;  3QG0 A;  1XW2 A;  3Q75 B;  1HZF A;  4GTO B;  2FV1 A;  1NC5 A;  3PZ3 B;  4MU9 A;  3QFZ A;  1X9D A;  2V3P A;  1G6I A;  3M7C A;  1TNY B;  3QXF A;  1MZC B;  4L0G A;  3DSW B;  3SQC A;  3ON6 A;  1LD7 B;  2F0Y B;  2H6H B;  3W7S A;  4Z4L A;  5FO7 B;  4M76 A;  4WVC A;  2EAE A;  3S9V A;  1NL4 B;  1TN6 B;  1UT9 A;  3K7X A;  3M77 A;  1N4S B;  4YDO B;  1N4P B;  4LNG B;  5JPN B;  3KLS A;  4ONT A;  1H13 A;  2ZIR B;  1N9A B;  1JS4 A;  2WII B;  2PN5 A;  3PZ4 B;  5FOB B;  3G6J B;  4YCR A;  4Z4J A;  3SDV A;  1H14 A;  3D5S A;  1O6R A;  2ZIS B;  3EZ8 A;  2ZBL A;  4BOK A;  1O1R B;  1V5C A;  4J5T A;  1AYX A;  2A73 B;  1LF6 A;  1W6K A;  1HCU A;  1N4Q B;  3GT5 A;  4GTM B;  1IA6 A;  3QDE A;  4DOD A;  3M7L A;  1NI1 B;  3DST B;  2RGK A;  3D3I A;  1CEM A;  2BBC A;  3WKH A;  3W7T A;  3HXD B;  3H2W A;  1LD8 B;  4CE7 A;  2Z07 A;  3C72 B;  1KSC A;  2WY7 A;  3Q78 B;  1WU6 A;  1V7W A;  1FT2 B;  3PYB A;  5JPM B;  1SA4 B;  3W7U A;  1F9D A;  3HXF B;  2G0D A;  1O5M B;  4LIX A;  3PYA A;  2SQC A;  2EAB A;  3E34 B;  4KTR A;  4D4C A;  4D4D A;  3WKG A;  1F9O A;  3HXB B;  4CJ0 A;  2WY8 A;  3E73 A;  4V1R A;  3T33 A;  4EL8 A;  1SQC A;  1DOG A;  4FXK B;  3HXC B;  3S4D A;  1H3C A;  3WIW A;  2AHF A;  3ACS A;  3TF4 A;  4LNB B;  2JG0 A;  1LTX B;  3EU5 B;  1FBW A;  2VN7 A;  3E32 B;  2XQW A;  5DGQ A;  2CQT A;  2DRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...