2DRQA

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263g mutant
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
379
structure length
377
Chain Sequence
KTTEGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSGSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xylanase Y
publication title Structural explanation for the acquisition of glycosynthase activity
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase
total genus 152
structure length 377
sequence length 379
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2drqA01
3S4CA 1FO3A 4L0GA 2D8LA 3W5MA 3PMMA 2EADA 3QFZA 3T33A 1VD5A 4TF4A 4WVCA 4Z4JA 3GT5A 3WIWA 3QT3A 4ZG8A 3W7SA 2F6DA 4DODA 5MEHA 1FCEA 4KTRA 1L2AA 3A3VA 1IS9A 1IA7A 4KTPA 2DRSA 3WKGA 1UT9A 3W7WA 3AFJA 1CEMA 3RX5A 1G9JA 3S4AA 4DOEA 2DRRA 3GLYA 1L1YA 3ON6A 1AGMA 1LF6A 3X17A 2FV1A 1TF4A 3W7UA 1XWQA 1V5CA 3RX7A 3QXFA 4WVBA 1WZZA 3EQAA 3S4DA 5GW7A 1KKTA 1ULVA 2FBAA 3ANIA 3S4BA 2CQSA 3H3KA 2NVPA 3QDEA 5CD2A 2RI9A 1AYXA 2VN4A 2JJBA 3QSPA 1G87A 1UG9A 1WU6A 3QXQA 3EZ8A 1XWTA 1KREA 2ZBLA 1KFGA 3E6UA 4AYQA 1KSDA 3P2CA 1H54A 1IA6A 4AYOA 1GLMA 2FV0A 2Z07A 4CE7A 3WC3A 2EABA 3WKHA 3VW5A 4CJ1A 1F9OA 1H13A 1KRFA 1X9DA 3QRYA 4Z4LA 2RI8A 1HCUA 1F9DA 1LF9A 3QFYA 5KKBA 1H14A 2CQTA 2JF4A 1FAEA 1DL2A 1CLCA 3ANKA 3ACSA 2XFGA 3QT9A 2ZZRA 3WIRA 1NXCA 3D3IA 1G9GA 2YIKA 4XUVA 3WKFA 1V5DA 2WYNA 1G6IA 4TXTA 3VXDA 3WIQA 5CA3A 1FBOA 1FMIA 3TF4A 4FUSA 4WU0A 4JJJA 4EL8A 3WUXA 5M7IA 3W7TA 4J5TA 1GAHA 3ANJA 3WKIA 1V7VA 5M7YA 4AYPA 1KWFA 3QG0A 2AHFA 5GY3A 1NC5A 3H2WA 3RX8A 3H7LA 3QPFA 2GZ6A 2JG0A 2EAEA 2D5JA 1RQ5A 3K11A 2VN7A 3RENA 2OKXA 1H12A 2AHGA 1V7XA 5E2JA 1FBWA 1FO2A 2DRQA 5DGRA 4AYRA 5DGQA 4ZH5A 2RGKA 2QNOA 2B4FA 1GAIA 3ACTA 1GA2A 3QWTA 4WVAA 3RSYA 1DOGA 1V7WA 2EACA 4CJ0A 4Q2BA 1WU5A 4Q88A 4L6XA 2GH4A 2P0VA 1JS4A 3CIHA 3GZKA 3W5NA 2A8ZA 1KS8A 3RRSA 5CZLA 2AFAA 1XW2A 1KSCA 2DROA 1K72A 1FP3A 3E73A 2FUZA 1WU4A 3W7XA
chains in the Genus database with same CATH superfamily
3N0FA 1N22A 3DSWB 2PN5A 3DSTB 1N21A 5JMDA 3QT3A 2IEJB 1HV6A 4DODA 1GXOA 3E34B 5MEHA 3M77A 4QT9A 1F9GA 3WKGA 3AFJA 1CEMA 3RX5A 3S4AA 2DRRA 1C82A 1SA4B 4LIXA 3X17A 3EU8A 1TF4A 3RX7A 3QXFA 3OEDA 3S4DA 1N4RB 2F0YB 3ANIA 3G4FA 3C72B 3QDEA 5CD2A 2ZIRB 1KZOB 1UG9A 1KREA 3E6UA 3LZ9A 1H54A 1H36A 3WC3A 2XWJB 1HMUA 3WKHA 3VW5A 1D8DB 3M78A 4GTTB 1D8EB 3OXUA 1UMPA 1TN6B 2RI8A 3PZ2B 1LF9A 3QFYA 2BRPA 4GTOB 2JF4A 1FAEA 3SDRA 3WIRA 2ONHA 1KZPB 1NXCA 3D3IA 2WYNA 1G6IA 5IKAA 5CA3A 3Q75B 4FUSA 3M7CA 2ZISB 3Q7FB 1KWFA 5GY3A 3SDUA 3H7LA 3PZ1B 3E37B 1W3YA 1N7QA 5E2JA 3HXDB 4M76A 1O5MB 1HZFA 4OJZA 2QNOA 1OJNA 4ZRQA 1O6QA 2X03A 4Q88A 4CJ0A 1WU5A 3NFVA 2P0VA 1N23A 1JS4A 2NOJA 3GZKA 2FUTA 3RRSA 1XW2A 3A0OA 1K72A 1FO2A 1X81B 3S4CA 1FO3A 4EHMB 5IK0A 2WINB 1RWGA 2BB5A 1QBQB 1HMWA 2EADA 3Q7AB 4WVCA 3SDVA 3DSSB 4GTMB 1N7RA 2WY8A 5GZKA 1GSZA 1TNYB 2F6DA 3HXEB 1H3AA 1FCEA 3HXFB 4KTRA 1L2AA 1JCSB 2DRSA 4YCRA 1NL4B 4V1RA 1I8QA 1LF6A 2BRVX 1O6HA 2FV1A 1V5CA 3M74A 1NI1B 5FO8B 3EQAA 1KKTA 3S4BA 3RJ3A 3D5SA 1LXKA 1O1RB 5IM1A 2Q1FA 3QXQA 2ZBLA 4AYQA 4MMIA 1KSDA 3SDTA 2BB6A 2Z07A 4CE7A 1LD7B 1LD8B 1FPPB 2EABA 3PYBA 3P5RA 2WIIB 4RNQA 3KSLB 3M73A 2ONGA 4MU9A 1JCRB 4Z4LA 5C05A 4D4CA 1RWFA 1R76A 4OK4A 1F9DA 1TNOB 2CQTA 5AGDA 3G4DA 3SAEA 1DL2A 1CLCA 1RW9A 1EGUA 3PZ4B 4MBGB 4D4AA 1LXMA 2V3PA 3WIQA 1LOHA 1FBOA 3P5PA 1QAZA 4EL8A 3WUXA 3W7TA 3DPYB 3WKIA 3DSVB 2E22A 2AHFA 3VSNA 2GZ6A 1N9AB 3E33B 3SFXB 2D5JA 1HXGA 2VN7A 3RENA 2OKXA 1F1SA 2WY7A 1FBWA 3M01A 2H6HB 4L9PB 1GAIA 3ACTA 1TN8B 1HM2A 5ILKA 4WVAA 3RSYA 4GTQB 1X1HA 3E32B 5EATA 3CIHA 3DSXB 2A8ZA 1KS8A 1N4QB 1TNBB 1KSCA 3Q78B 2DROA 1FP3A 1N7NA 4NEIA 3K7XA 1HN0A 3E7JA 1N94B 2GOXA 3W5MA 3QFZA 5IKHA 3T33A 4D4BA 3WIWA 4ZG8A 1S64B 1N7PA 1HX9A 4ZRPA 4FJQA 3A3VA 4KTPA 1X1JA 1UT9A 4OK2A 3GLYA 2XQWA 1H3BA 3ON6A 4KKJA 3W7UA 4ZH1A 1XWQA 2BRWA 2BBCA 1O6RA 1WZZA 4BOJA 1RWAA 1ULVA 2CQSA 3H3KA 1N4SB 4FXGB 5FOBB 4F13A 2JJBA 3QSPA 1GXNA 3E80A 5IL3A 5IK6A 2B39A 3P2CA 1X1IA 5EASA 3SQCA 5DHIA 4KKIA 1N24A 3M7EA 4YDOB 5ILDA 2WDAA 3PYAA 4CJ1A 1KRFA 3QRYA 1OJMA 4D4DA 1HXAA 1HCUA 1FT2B 1TN7B 1CB8A 1S63B 4FNVA 4GTRB 1N4PB 5FO7B 4E1YA 5FO9B 5ILZA 1N7OA 3ACSA 3ANKA 1H39A 2XFGA 2ZZRA 3Q79B 1G9GA 1JCQB 2PMVA 3WKFA 1V5DA 3CU7A 1FMIA 5M7IA 4GAXA 2XWBB 1J0NA 1O79A 2WCOA 1MZCB 2E24A 5M7YA 1QSJA 4AYPA 4YDEB 3H2WA 3RX8A 3D5RA 3S9VA 2JG0A 4D94A 3EU5B 1RQ5A 2H6FB 1H12A 4AYRA 4FXKB 1H3CA 5DGRA 2V8JA 1DCEB 3QWTA 3HXCB 1DOGA 2EACA 2I07B 2GH4A 3DSUB 1GXMA 3N0GA 3W5NA 2AFAA 1HXCA 2A73B 3E73A 1GHQA 3NNBA 3W7XA 4L0GA 2D8LA 3M02A 3PMMA 1VD5A 2FUQA 4TF4A 3M71A 4Z4JA 1SA5B 3GT5A 1OJPA 2G0DA 3W7SA 5ILYA 4BOKA 4LNVA 3M72A 3SDQA 1IS9A 1IA7A 3W7WA 1N1ZA 4DOEA 1G9JA 1RWCA 5ILHA 1L1YA 1AGMA 4WVBA 5GW7A 2FBAA 5EAUA 2NVPA 2V8KA 2RI9A 1AYXA 2VN4A 3AFLA 1G87A 2H6GB 3KLSA 3G6JB 1WU6A 3EZ8A 3EUVB 1XWTA 4GTPB 1KFGA 3KSQB 3M00A 1IA6A 4GL3A 4AYOA 1GLMA 1RWHA 2FV0A 1C3DA 5ILJA 1O1SB 4F10A 2V8IA 4C1SA 4ONTA 4LNBB 1LTXB 4DI5A 1F9OA 1H13A 3HXBB 1QQFA 1X9DA 4GTVB 4V1SA 1H37A 5KKBA 1H14A 3VSMA 5ILIA 2V3NA 3DRAB 3E30B 3M7BA 3QT9A 4OZVA 1O1TB 1HM3A 2YIKA 1W6KA 1J0MA 4XUVA 3VXDA 4GTSB 3TF4A 2H6IB 3Q73B 4WU0A 4JJJA 1TNUB 1N95B 3M7LA 4J5TA 2BEDB 1GAHA 1TNZB 3ANJA 1V7VA 1W6JA 2SQCA 3QG0A 5JPMB 2G02A 1NC5A 4LNGB 3QPFA 4OZWA 2EAEA 5IL8A 3K11A 3SFYB 1FT1B 1OJOA 5DHKA 2AHGA 3PZ3B 1V7XA 1N1BA 2DRQA 5DGQA 2J5CA 4ZH5A 2RGKA 5JMFA 2B4FA 5JPNB 4MMHA 1GA2A 3KQ4A 1V7WA 1N20A 4Q2BA 4L6XA 1H35A 1SQCA 3M76A 2R2LB 3M75A 5CZLA 4TXTA 2FUZA 1WU4A 5IK9A
chains in the Genus database with same CATH topology
3DSWB 2PN5A 3DSTB 3QT3A 2IEJB 4DODA 1GXOA 3E34B 5MEHA 3M77A 4QT9A 3WKGA 3AFJA 1CEMA 3RX5A 3S4AA 2DRRA 1SA4B 4LIXA 3X17A 3EU8A 1TF4A 3RX7A 3QXFA 3OEDA 3S4DA 1N4RB 2F0YB 3ANIA 3C72B 3QDEA 5CD2A 2ZIRB 1KZOB 1UG9A 1KREA 3E6UA 1H54A 1H36A 3WC3A 2XWJB 3WKHA 3VW5A 1D8DB 3M78A 4GTTB 1D8EB 3OXUA 1UMPA 1TN6B 2RI8A 3PZ2B 1LF9A 3QFYA 4GTOB 2JF4A 1FAEA 3SDRA 3WIRA 1KZPB 1NXCA 3D3IA 2WYNA 1G6IA 5CA3A 3Q75B 4FUSA 3M7CA 2ZISB 3Q7FB 1KWFA 5GY3A 3SDUA 3H7LA 3PZ1B 3E37B 5E2JA 3HXDB 4M76A 1O5MB 1HZFA 2QNOA 4ZRQA 1O6QA 4Q88A 4CJ0A 1WU5A 2P0VA 1JS4A 2NOJA 3GZKA 3RRSA 1XW2A 1K72A 1FO2A 1X81B 3S4CA 1FO3A 4EHMB 2WINB 2BB5A 1QBQB 2EADA 3Q7AB 4WVCA 3SDVA 3DSSB 4GTMB 5GZKA 2WY8A 1GSZA 1TNYB 2F6DA 3HXEB 1H3AA 1FCEA 3HXFB 4KTRA 1L2AA 1JCSB 2DRSA 4YCRA 1NL4B 4V1RA 1LF6A 1O6HA 2FV1A 1V5CA 3M74A 1NI1B 5FO8B 3EQAA 1KKTA 3S4BA 3RJ3A 3D5SA 1O1RB 3QXQA 2ZBLA 4AYQA 1KSDA 3SDTA 2BB6A 2Z07A 4CE7A 1LD7B 1LD8B 1FPPB 2EABA 3PYBA 3P5RA 2WIIB 3KSLB 3M73A 4MU9A 1JCRB 4Z4LA 4D4CA 1R76A 1F9DA 1TNOB 2CQTA 5AGDA 3SAEA 1DL2A 1CLCA 3PZ4B 4MBGB 4D4AA 2V3PA 3WIQA 1FBOA 3P5PA 4EL8A 3WUXA 3W7TA 3DPYB 3WKIA 3DSVB 2AHFA 2GZ6A 1N9AB 3E33B 3SFXB 2D5JA 2VN7A 3RENA 2OKXA 2WY7A 1FBWA 2H6HB 4L9PB 1GAIA 3ACTA 1TN8B 4WVAA 3RSYA 4GTQB 3E32B 3CIHA 3DSXB 2A8ZA 1KS8A 1N4QB 1TNBB 1KSCA 3Q78B 2DROA 1FP3A 3K7XA 1N94B 2GOXA 3W5MA 3QFZA 3T33A 4D4BA 3WIWA 4ZG8A 1S64B 4ZRPA 3A3VA 4KTPA 1UT9A 3GLYA 2XQWA 1H3BA 3ON6A 4KKJA 3W7UA 4ZH1A 1XWQA 2BBCA 1O6RA 1WZZA 4BOJA 1ULVA 2CQSA 3H3KA 1N4SB 4FXGB 5FOBB 2JJBA 3QSPA 1GXNA 2B39A 3P2CA 3SQCA 4KKIA 3M7EA 4YDOB 3PYAA 4CJ1A 1KRFA 3QRYA 4D4DA 1HCUA 1FT2B 1TN7B 1S63B 4GTRB 1N4PB 5FO7B 5FO9B 3ACSA 3ANKA 1H39A 2XFGA 2ZZRA 3Q79B 1G9GA 1JCQB 2PMVA 3WKFA 1V5DA 3CU7A 1FMIA 5M7IA 2XWBB 1O79A 1MZCB 5M7YA 1QSJA 4AYPA 4YDEB 3H2WA 3RX8A 3D5RA 3S9VA 2JG0A 4D94A 3EU5B 1RQ5A 2H6FB 1H12A 4AYRA 4FXKB 1H3CA 5DGRA 2V8JA 1DCEB 3QWTA 3HXCB 1DOGA 2EACA 2I07B 2GH4A 3DSUB 1GXMA 3W5NA 2AFAA 2A73B 3E73A 1GHQA 3W7XA 4L0GA 2D8LA 3PMMA 1VD5A 4TF4A 3M71A 4Z4JA 1SA5B 3GT5A 2G0DA 3W7SA 4BOKA 4LNVA 3M72A 3SDQA 1IS9A 1IA7A 3W7WA 4DOEA 1G9JA 1L1YA 1AGMA 4WVBA 5GW7A 2FBAA 2NVPA 2V8KA 2RI9A 1AYXA 2VN4A 1G87A 2H6GB 3KLSA 3G6JB 1WU6A 3EZ8A 3EUVB 1XWTA 4GTPB 1KFGA 3KSQB 4GL3A 1IA6A 4AYOA 1GLMA 2FV0A 1C3DA 1O1SB 2V8IA 4C1SA 4ONTA 4LNBB 1LTXB 1F9OA 1H13A 3HXBB 1QQFA 1X9DA 4GTVB 4V1SA 1H37A 5KKBA 1H14A 2V3NA 3DRAB 3E30B 3M7BA 3QT9A 1O1TB 2YIKA 1W6KA 4XUVA 3VXDA 4GTSB 3TF4A 2H6IB 3Q73B 4WU0A 4JJJA 1TNUB 1N95B 3M7LA 4J5TA 2BEDB 1GAHA 1TNZB 3ANJA 1V7VA 1W6JA 2SQCA 3QG0A 5JPMB 2G02A 1NC5A 4LNGB 3QPFA 2EAEA 3K11A 3SFYB 1FT1B 3PZ3B 2AHGA 1V7XA 2DRQA 5DGQA 4ZH5A 2RGKA 2B4FA 5JPNB 1GA2A 3KQ4A 1V7WA 4Q2BA 4L6XA 1H35A 1SQCA 3M76A 2R2LB 3M75A 5CZLA 4TXTA 2FUZA 1WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S4C A;  1FO3 A;  4L0G A;  2D8L A;  3W5M A;  3PMM A;  2EAD A;  3QFZ A;  3T33 A;  1VD5 A;  4TF4 A;  4WVC A;  4Z4J A;  3GT5 A;  3WIW A;  3QT3 A;  4ZG8 A;  3W7S A;  2F6D A;  4DOD A;  5MEH A;  1FCE A;  4KTR A;  1L2A A;  3A3V A;  1IS9 A;  1IA7 A;  4KTP A;  2DRS A;  3WKG A;  1UT9 A;  3W7W A;  3AFJ A;  1CEM A;  3RX5 A;  1G9J A;  3S4A A;  4DOE A;  2DRR A;  3GLY A;  1L1Y A;  3ON6 A;  1AGM A;  1LF6 A;  3X17 A;  2FV1 A;  1TF4 A;  3W7U A;  1XWQ A;  1V5C A;  3RX7 A;  3QXF A;  4WVB A;  1WZZ A;  3EQA A;  3S4D A;  5GW7 A;  1KKT A;  1ULV A;  2FBA A;  3ANI A;  3S4B A;  2CQS A;  3H3K A;  2NVP A;  3QDE A;  5CD2 A;  2RI9 A;  1AYX A;  2VN4 A;  2JJB A;  3QSP A;  1G87 A;  1UG9 A;  1WU6 A;  3QXQ A;  3EZ8 A;  1XWT A;  1KRE A;  2ZBL A;  1KFG A;  3E6U A;  4AYQ A;  1KSD A;  3P2C A;  1H54 A;  1IA6 A;  4AYO A;  1GLM A;  2FV0 A;  2Z07 A;  4CE7 A;  3WC3 A;  2EAB A;  3WKH A;  3VW5 A;  4CJ1 A;  1F9O A;  1H13 A;  1KRF A;  1X9D A;  3QRY A;  4Z4L A;  2RI8 A;  1HCU A;  1F9D A;  1LF9 A;  3QFY A;  5KKB A;  1H14 A;  2CQT A;  2JF4 A;  1FAE A;  1DL2 A;  1CLC A;  3ANK A;  3ACS A;  2XFG A;  3QT9 A;  2ZZR A;  3WIR A;  1NXC A;  3D3I A;  1G9G A;  2YIK A;  4XUV A;  3WKF A;  1V5D A;  2WYN A;  1G6I A;  4TXT A;  3VXD A;  3WIQ A;  5CA3 A;  1FBO A;  1FMI A;  3TF4 A;  4FUS A;  4WU0 A;  4JJJ A;  4EL8 A;  3WUX A;  5M7I A;  3W7T A;  4J5T A;  1GAH A;  3ANJ A;  3WKI A;  1V7V A;  5M7Y A;  4AYP A;  1KWF A;  3QG0 A;  2AHF A;  5GY3 A;  1NC5 A;  3H2W A;  3RX8 A;  3H7L A;  3QPF A;  2GZ6 A;  2JG0 A;  2EAE A;  2D5J A;  1RQ5 A;  3K11 A;  2VN7 A;  3REN A;  2OKX A;  1H12 A;  2AHG A;  1V7X A;  5E2J A;  1FBW A;  1FO2 A;  2DRQ A;  5DGR A;  4AYR A;  5DGQ A;  4ZH5 A;  2RGK A;  2QNO A;  2B4F A;  1GAI A;  3ACT A;  1GA2 A;  3QWT A;  4WVA A;  3RSY A;  1DOG A;  1V7W A;  2EAC A;  4CJ0 A;  4Q2B A;  1WU5 A;  4Q88 A;  4L6X A;  2GH4 A;  2P0V A;  1JS4 A;  3CIH A;  3GZK A;  3W5N A;  2A8Z A;  1KS8 A;  3RRS A;  5CZL A;  2AFA A;  1XW2 A;  1KSC A;  2DRO A;  1K72 A;  1FP3 A;  3E73 A;  2FUZ A;  1WU4 A;  3W7X A; 
#chains in the Genus database with same CATH topology
 3N0F A;  1N22 A;  3DSW B;  2PN5 A;  3DST B;  1N21 A;  5JMD A;  3QT3 A;  2IEJ B;  1HV6 A;  4DOD A;  1GXO A;  3E34 B;  5MEH A;  3M77 A;  4QT9 A;  1F9G A;  3WKG A;  3AFJ A;  1CEM A;  3RX5 A;  3S4A A;  2DRR A;  1C82 A;  1SA4 B;  4LIX A;  3X17 A;  3EU8 A;  1TF4 A;  3RX7 A;  3QXF A;  3OED A;  3S4D A;  1N4R B;  2F0Y B;  3ANI A;  3G4F A;  3C72 B;  3QDE A;  5CD2 A;  2ZIR B;  1KZO B;  1UG9 A;  1KRE A;  3E6U A;  3LZ9 A;  1H54 A;  1H36 A;  3WC3 A;  2XWJ B;  1HMU A;  3WKH A;  3VW5 A;  1D8D B;  3M78 A;  4GTT B;  1D8E B;  3OXU A;  1UMP A;  1TN6 B;  2RI8 A;  3PZ2 B;  1LF9 A;  3QFY A;  2BRP A;  4GTO B;  2JF4 A;  1FAE A;  3SDR A;  3WIR A;  2ONH A;  1KZP B;  1NXC A;  3D3I A;  2WYN A;  1G6I A;  5IKA A;  5CA3 A;  3Q75 B;  4FUS A;  3M7C A;  2ZIS B;  3Q7F B;  1KWF A;  5GY3 A;  3SDU A;  3H7L A;  3PZ1 B;  3E37 B;  1W3Y A;  1N7Q A;  5E2J A;  3HXD B;  4M76 A;  1O5M B;  1HZF A;  4OJZ A;  2QNO A;  1OJN A;  4ZRQ A;  1O6Q A;  2X03 A;  4Q88 A;  4CJ0 A;  1WU5 A;  3NFV A;  2P0V A;  1N23 A;  1JS4 A;  2NOJ A;  3GZK A;  2FUT A;  3RRS A;  1XW2 A;  3A0O A;  1K72 A;  1FO2 A;  1X81 B;  3S4C A;  1FO3 A;  4EHM B;  5IK0 A;  2WIN B;  1RWG A;  2BB5 A;  1QBQ B;  1HMW A;  2EAD A;  3Q7A B;  4WVC A;  3SDV A;  3DSS B;  4GTM B;  1N7R A;  2WY8 A;  5GZK A;  1GSZ A;  1TNY B;  2F6D A;  3HXE B;  1H3A A;  1FCE A;  3HXF B;  4KTR A;  1L2A A;  1JCS B;  2DRS A;  4YCR A;  1NL4 B;  4V1R A;  1I8Q A;  1LF6 A;  2BRV X;  1O6H A;  2FV1 A;  1V5C A;  3M74 A;  1NI1 B;  5FO8 B;  3EQA A;  1KKT A;  3S4B A;  3RJ3 A;  3D5S A;  1LXK A;  1O1R B;  5IM1 A;  2Q1F A;  3QXQ A;  2ZBL A;  4AYQ A;  4MMI A;  1KSD A;  3SDT A;  2BB6 A;  2Z07 A;  4CE7 A;  1LD7 B;  1LD8 B;  1FPP B;  2EAB A;  3PYB A;  3P5R A;  2WII B;  4RNQ A;  3KSL B;  3M73 A;  2ONG A;  4MU9 A;  1JCR B;  4Z4L A;  5C05 A;  4D4C A;  1RWF A;  1R76 A;  4OK4 A;  1F9D A;  1TNO B;  2CQT A;  5AGD A;  3G4D A;  3SAE A;  1DL2 A;  1CLC A;  1RW9 A;  1EGU A;  3PZ4 B;  4MBG B;  4D4A A;  1LXM A;  2V3P A;  3WIQ A;  1LOH A;  1FBO A;  3P5P A;  1QAZ A;  4EL8 A;  3WUX A;  3W7T A;  3DPY B;  3WKI A;  3DSV B;  2E22 A;  2AHF A;  3VSN A;  2GZ6 A;  1N9A B;  3E33 B;  3SFX B;  2D5J A;  1HXG A;  2VN7 A;  3REN A;  2OKX A;  1F1S A;  2WY7 A;  1FBW A;  3M01 A;  2H6H B;  4L9P B;  1GAI A;  3ACT A;  1TN8 B;  1HM2 A;  5ILK A;  4WVA A;  3RSY A;  4GTQ B;  1X1H A;  3E32 B;  5EAT A;  3CIH A;  3DSX B;  2A8Z A;  1KS8 A;  1N4Q B;  1TNB B;  1KSC A;  3Q78 B;  2DRO A;  1FP3 A;  1N7N A;  4NEI A;  3K7X A;  1HN0 A;  3E7J A;  1N94 B;  2GOX A;  3W5M A;  3QFZ A;  5IKH A;  3T33 A;  4D4B A;  3WIW A;  4ZG8 A;  1S64 B;  1N7P A;  1HX9 A;  4ZRP A;  4FJQ A;  3A3V A;  4KTP A;  1X1J A;  1UT9 A;  4OK2 A;  3GLY A;  2XQW A;  1H3B A;  3ON6 A;  4KKJ A;  3W7U A;  4ZH1 A;  1XWQ A;  2BRW A;  2BBC A;  1O6R A;  1WZZ A;  4BOJ A;  1RWA A;  1ULV A;  2CQS A;  3H3K A;  1N4S B;  4FXG B;  5FOB B;  4F13 A;  2JJB A;  3QSP A;  1GXN A;  3E80 A;  5IL3 A;  5IK6 A;  2B39 A;  3P2C A;  1X1I A;  5EAS A;  3SQC A;  5DHI A;  4KKI A;  1N24 A;  3M7E A;  4YDO B;  5ILD A;  2WDA A;  3PYA A;  4CJ1 A;  1KRF A;  3QRY A;  1OJM A;  4D4D A;  1HXA A;  1HCU A;  1FT2 B;  1TN7 B;  1CB8 A;  1S63 B;  4FNV A;  4GTR B;  1N4P B;  5FO7 B;  4E1Y A;  5FO9 B;  5ILZ A;  1N7O A;  3ACS A;  3ANK A;  1H39 A;  2XFG A;  2ZZR A;  3Q79 B;  1G9G A;  1JCQ B;  2PMV A;  3WKF A;  1V5D A;  3CU7 A;  1FMI A;  5M7I A;  4GAX A;  2XWB B;  1J0N A;  1O79 A;  2WCO A;  1MZC B;  2E24 A;  5M7Y A;  1QSJ A;  4AYP A;  4YDE B;  3H2W A;  3RX8 A;  3D5R A;  3S9V A;  2JG0 A;  4D94 A;  3EU5 B;  1RQ5 A;  2H6F B;  1H12 A;  4AYR A;  4FXK B;  1H3C A;  5DGR A;  2V8J A;  1DCE B;  3QWT A;  3HXC B;  1DOG A;  2EAC A;  2I07 B;  2GH4 A;  3DSU B;  1GXM A;  3N0G A;  3W5N A;  2AFA A;  1HXC A;  2A73 B;  3E73 A;  1GHQ A;  3NNB A;  3W7X A;  4L0G A;  2D8L A;  3M02 A;  3PMM A;  1VD5 A;  2FUQ A;  4TF4 A;  3M71 A;  4Z4J A;  1SA5 B;  3GT5 A;  1OJP A;  2G0D A;  3W7S A;  5ILY A;  4BOK A;  4LNV A;  3M72 A;  3SDQ A;  1IS9 A;  1IA7 A;  3W7W A;  1N1Z A;  4DOE A;  1G9J A;  1RWC A;  5ILH A;  1L1Y A;  1AGM A;  4WVB A;  5GW7 A;  2FBA A;  5EAU A;  2NVP A;  2V8K A;  2RI9 A;  1AYX A;  2VN4 A;  3AFL A;  1G87 A;  2H6G B;  3KLS A;  3G6J B;  1WU6 A;  3EZ8 A;  3EUV B;  1XWT A;  4GTP B;  1KFG A;  3KSQ B;  3M00 A;  1IA6 A;  4GL3 A;  4AYO A;  1GLM A;  1RWH A;  2FV0 A;  1C3D A;  5ILJ A;  1O1S B;  4F10 A;  2V8I A;  4C1S A;  4ONT A;  4LNB B;  1LTX B;  4DI5 A;  1F9O A;  1H13 A;  3HXB B;  1QQF A;  1X9D A;  4GTV B;  4V1S A;  1H37 A;  5KKB A;  1H14 A;  3VSM A;  5ILI A;  2V3N A;  3DRA B;  3E30 B;  3M7B A;  3QT9 A;  4OZV A;  1O1T B;  1HM3 A;  2YIK A;  1W6K A;  1J0M A;  4XUV A;  3VXD A;  4GTS B;  3TF4 A;  2H6I B;  3Q73 B;  4WU0 A;  4JJJ A;  1TNU B;  1N95 B;  3M7L A;  4J5T A;  2BED B;  1GAH A;  1TNZ B;  3ANJ A;  1V7V A;  1W6J A;  2SQC A;  3QG0 A;  5JPM B;  2G02 A;  1NC5 A;  4LNG B;  3QPF A;  4OZW A;  2EAE A;  5IL8 A;  3K11 A;  3SFY B;  1FT1 B;  1OJO A;  5DHK A;  2AHG A;  3PZ3 B;  1V7X A;  1N1B A;  2DRQ A;  5DGQ A;  2J5C A;  4ZH5 A;  2RGK A;  5JMF A;  2B4F A;  5JPN B;  4MMH A;  1GA2 A;  3KQ4 A;  1V7W A;  1N20 A;  4Q2B A;  4L6X A;  1H35 A;  1SQC A;  3M76 A;  2R2L B;  3M75 A;  5CZL A;  4TXT A;  2FUZ A;  1WU4 A;  5IK9 A; 
#chains in the Genus database with same CATH homology
 3DSW B;  2PN5 A;  3DST B;  3QT3 A;  2IEJ B;  4DOD A;  1GXO A;  3E34 B;  5MEH A;  3M77 A;  4QT9 A;  3WKG A;  3AFJ A;  1CEM A;  3RX5 A;  3S4A A;  2DRR A;  1SA4 B;  4LIX A;  3X17 A;  3EU8 A;  1TF4 A;  3RX7 A;  3QXF A;  3OED A;  3S4D A;  1N4R B;  2F0Y B;  3ANI A;  3C72 B;  3QDE A;  5CD2 A;  2ZIR B;  1KZO B;  1UG9 A;  1KRE A;  3E6U A;  1H54 A;  1H36 A;  3WC3 A;  2XWJ B;  3WKH A;  3VW5 A;  1D8D B;  3M78 A;  4GTT B;  1D8E B;  3OXU A;  1UMP A;  1TN6 B;  2RI8 A;  3PZ2 B;  1LF9 A;  3QFY A;  4GTO B;  2JF4 A;  1FAE A;  3SDR A;  3WIR A;  1KZP B;  1NXC A;  3D3I A;  2WYN A;  1G6I A;  5CA3 A;  3Q75 B;  4FUS A;  3M7C A;  2ZIS B;  3Q7F B;  1KWF A;  5GY3 A;  3SDU A;  3H7L A;  3PZ1 B;  3E37 B;  5E2J A;  3HXD B;  4M76 A;  1O5M B;  1HZF A;  2QNO A;  4ZRQ A;  1O6Q A;  4Q88 A;  4CJ0 A;  1WU5 A;  2P0V A;  1JS4 A;  2NOJ A;  3GZK A;  3RRS A;  1XW2 A;  1K72 A;  1FO2 A;  1X81 B;  3S4C A;  1FO3 A;  4EHM B;  2WIN B;  2BB5 A;  1QBQ B;  2EAD A;  3Q7A B;  4WVC A;  3SDV A;  3DSS B;  4GTM B;  5GZK A;  2WY8 A;  1GSZ A;  1TNY B;  2F6D A;  3HXE B;  1H3A A;  1FCE A;  3HXF B;  4KTR A;  1L2A A;  1JCS B;  2DRS A;  4YCR A;  1NL4 B;  4V1R A;  1LF6 A;  1O6H A;  2FV1 A;  1V5C A;  3M74 A;  1NI1 B;  5FO8 B;  3EQA A;  1KKT A;  3S4B A;  3RJ3 A;  3D5S A;  1O1R B;  3QXQ A;  2ZBL A;  4AYQ A;  1KSD A;  3SDT A;  2BB6 A;  2Z07 A;  4CE7 A;  1LD7 B;  1LD8 B;  1FPP B;  2EAB A;  3PYB A;  3P5R A;  2WII B;  3KSL B;  3M73 A;  4MU9 A;  1JCR B;  4Z4L A;  4D4C A;  1R76 A;  1F9D A;  1TNO B;  2CQT A;  5AGD A;  3SAE A;  1DL2 A;  1CLC A;  3PZ4 B;  4MBG B;  4D4A A;  2V3P A;  3WIQ A;  1FBO A;  3P5P A;  4EL8 A;  3WUX A;  3W7T A;  3DPY B;  3WKI A;  3DSV B;  2AHF A;  2GZ6 A;  1N9A B;  3E33 B;  3SFX B;  2D5J A;  2VN7 A;  3REN A;  2OKX A;  2WY7 A;  1FBW A;  2H6H B;  4L9P B;  1GAI A;  3ACT A;  1TN8 B;  4WVA A;  3RSY A;  4GTQ B;  3E32 B;  3CIH A;  3DSX B;  2A8Z A;  1KS8 A;  1N4Q B;  1TNB B;  1KSC A;  3Q78 B;  2DRO A;  1FP3 A;  3K7X A;  1N94 B;  2GOX A;  3W5M A;  3QFZ A;  3T33 A;  4D4B A;  3WIW A;  4ZG8 A;  1S64 B;  4ZRP A;  3A3V A;  4KTP A;  1UT9 A;  3GLY A;  2XQW A;  1H3B A;  3ON6 A;  4KKJ A;  3W7U A;  4ZH1 A;  1XWQ A;  2BBC A;  1O6R A;  1WZZ A;  4BOJ A;  1ULV A;  2CQS A;  3H3K A;  1N4S B;  4FXG B;  5FOB B;  2JJB A;  3QSP A;  1GXN A;  2B39 A;  3P2C A;  3SQC A;  4KKI A;  3M7E A;  4YDO B;  3PYA A;  4CJ1 A;  1KRF A;  3QRY A;  4D4D A;  1HCU A;  1FT2 B;  1TN7 B;  1S63 B;  4GTR B;  1N4P B;  5FO7 B;  5FO9 B;  3ACS A;  3ANK A;  1H39 A;  2XFG A;  2ZZR A;  3Q79 B;  1G9G A;  1JCQ B;  2PMV A;  3WKF A;  1V5D A;  3CU7 A;  1FMI A;  5M7I A;  2XWB B;  1O79 A;  1MZC B;  5M7Y A;  1QSJ A;  4AYP A;  4YDE B;  3H2W A;  3RX8 A;  3D5R A;  3S9V A;  2JG0 A;  4D94 A;  3EU5 B;  1RQ5 A;  2H6F B;  1H12 A;  4AYR A;  4FXK B;  1H3C A;  5DGR A;  2V8J A;  1DCE B;  3QWT A;  3HXC B;  1DOG A;  2EAC A;  2I07 B;  2GH4 A;  3DSU B;  1GXM A;  3W5N A;  2AFA A;  2A73 B;  3E73 A;  1GHQ A;  3W7X A;  4L0G A;  2D8L A;  3PMM A;  1VD5 A;  4TF4 A;  3M71 A;  4Z4J A;  1SA5 B;  3GT5 A;  2G0D A;  3W7S A;  4BOK A;  4LNV A;  3M72 A;  3SDQ A;  1IS9 A;  1IA7 A;  3W7W A;  4DOE A;  1G9J A;  1L1Y A;  1AGM A;  4WVB A;  5GW7 A;  2FBA A;  2NVP A;  2V8K A;  2RI9 A;  1AYX A;  2VN4 A;  1G87 A;  2H6G B;  3KLS A;  3G6J B;  1WU6 A;  3EZ8 A;  3EUV B;  1XWT A;  4GTP B;  1KFG A;  3KSQ B;  4GL3 A;  1IA6 A;  4AYO A;  1GLM A;  2FV0 A;  1C3D A;  1O1S B;  2V8I A;  4C1S A;  4ONT A;  4LNB B;  1LTX B;  1F9O A;  1H13 A;  3HXB B;  1QQF A;  1X9D A;  4GTV B;  4V1S A;  1H37 A;  5KKB A;  1H14 A;  2V3N A;  3DRA B;  3E30 B;  3M7B A;  3QT9 A;  1O1T B;  2YIK A;  1W6K A;  4XUV A;  3VXD A;  4GTS B;  3TF4 A;  2H6I B;  3Q73 B;  4WU0 A;  4JJJ A;  1TNU B;  1N95 B;  3M7L A;  4J5T A;  2BED B;  1GAH A;  1TNZ B;  3ANJ A;  1V7V A;  1W6J A;  2SQC A;  3QG0 A;  5JPM B;  2G02 A;  1NC5 A;  4LNG B;  3QPF A;  2EAE A;  3K11 A;  3SFY B;  1FT1 B;  3PZ3 B;  2AHG A;  1V7X A;  2DRQ A;  5DGQ A;  4ZH5 A;  2RGK A;  2B4F A;  5JPN B;  1GA2 A;  3KQ4 A;  1V7W A;  4Q2B A;  4L6X A;  1H35 A;  1SQC A;  3M76 A;  2R2L B;  3M75 A;  5CZL A;  4TXT A;  2FUZ A;  1WU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...