2DRQA

Crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263g mutant
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
379
structure length
377
Chain Sequence
KTTEGAFYTREYRNLFKEFGYSEAEIQERVKDTWEQLFGDNPKIYYEVGDDLGYLLDTGNLDVRTEGMSYGMMMAVQMDRKDIFDRIWNWTMKNMYMTEGVHAGYFAWSCQPDGTKNSWGPAPDGEEYFALALFFASHRWGDGDEQPFNYSEQARKLLHTCVHNGEGGPGHPMWNRDNKLIKFIPEVEFSDPSYHLPHFYELFSLWANEEDRVFWKEAAEASREYLKIACHPETGLAPEYAYYDGTPNDEKGYGHFFSGSYRVAANIGLDAEWFGGSEWSAEEINKIQAFFADKEPEDYRRYKIDGEPFEEKSLHPVGLIATNAMGSLASVDGPYAKANVDLFWNTPVRTGNRRYYDNCLYLFAMLALSGNFKIWFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xylanase Y
publication title Structural explanation for the acquisition of glycosynthase activity
pubmed doi rcsb
source organism Bacillus halodurans
total genus 152
structure length 377
sequence length 379
ec nomenclature ec 3.2.1.156: Oligosaccharide reducing-end xylanase.
pdb deposition date 2006-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01270 Glyco_hydro_8 Glycosyl hydrolases family 8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2drqA01
3ACSA 1G9GA 1KSCA 4Q88A 1XWTA 3WKHA 3W7SA 3H2WA 1HCUA 2RI8A 3X17A 5M7IA 3GT5A 3QXQA 1ULVA 1IA6A 2JF4A 3A3VA 4KTRA 2OKXA 1DOGA 1GA2A 1FP3A 3WUXA 1G87A 3P2CA 3QPFA 4Z4LA 3E6UA 3W7TA 3T33A 3RX7A 3ON6A 2DROA 3W7WA 4Z4JA 1CEMA 3EZ8A 3VXDA 3CIHA 2EACA 3S4BA 1V7XA 3S4DA 3WIQA 2CQSA 1WZZA 1CLCA 1L1YA 3QWTA 5CA3A 1NXCA 2VN7A 4XUVA 4CJ0A 2AHFA 2WYNA 1H13A 4DODA 1F9OA 2ZBLA 5MEHA 4DOEA 1GLMA 5M7YA 4AYPA 1AYXA 1XWQA 3WKGA 1LF9A 1G6IA 2VN4A 1IA7A 1TF4A 1H12A 4FUSA 1KSDA 2DRQA 5KKBA 3WC3A 4AYRA 1FAEA 1FBWA 2Z07A 3W5NA 2D5JA 4EL8A 3AFJA 2AHGA 3WIRA 1WU4A 2ZZRA 3W5MA 1FBOA 3EQAA 5CD2A 3QT3A 2RGKA 5CZLA 1V7WA 3VW5A 2GH4A 4TF4A 3W7UA 1JS4A 3PMMA 1WU5A 3RX5A 2GZ6A 2FUZA 3H7LA 3K11A 5GY3A 1V5CA 3RX8A 2AFAA 1UG9A 2DRRA 3QFZA 5E2JA 4Q2BA 1V5DA 4KTPA 3S4AA 2JJBA 3TF4A 3QXFA 4WU0A 4WVAA 2P0VA 3WIWA 4ZH5A 1H14A 1UT9A 2XFGA 3RENA 3E73A 3QSPA 2NVPA 1KKTA 2A8ZA 3QDEA 1L2AA 2JG0A 2FV1A 1IS9A 3W7XA 1F9DA 4AYOA 1DL2A 3GZKA 3S4CA 3ANKA 4WVBA 1V7VA 3RRSA 1NC5A 2CQTA 2DRSA 4L6XA 5GW7A 4AYQA 4WVCA 4ZG8A 2D8LA 2FV0A 2RI9A 1KWFA 3WKIA 1K72A 4CJ1A 4TXTA 3H3KA 1AGMA 1VD5A 1FO3A 2EAEA 1LF6A 3RSYA 1KRFA 3ANJA 4L0GA 1RQ5A 3QRYA 1KS8A 2FBAA 2EABA 3WKFA 1G9JA 4JJJA 3QG0A 1FCEA 1GAIA 2QNOA 5DGQA 5DGRA 1X9DA 1XW2A 2YIKA 1GAHA 3ANIA 3ACTA 3D3IA 2EADA 4J5TA 1H54A 1FMIA 3QFYA 2F6DA 1KFGA 3QT9A 2B4FA 1FO2A 1KREA 4CE7A 3GLYA 1WU6A
chains in the Genus database with same CATH superfamily
3SAEA 5ILDA 3H2WA 1HCUA 1LXMA 3HXBB 1I8QA 2I07B 2OKXA 4Z4LA 1C82A 3T33A 3E34B 1FT1B 5EASA 3EU5B 3S4BA 3WIQA 1HXAA 1L1YA 2BRWA 3N0FA 4MBGB 1HXGA 2BRVX 4CJ0A 4DODA 2WYNA 3SDTA 1GLMA 5GZKA 4AYPA 1TNZB 2GOXA 3D5SA 1LF9A 3RJ3A 1N22A 4DI5A 1KSDA 3WC3A 1FBWA 2XWJB 2Z07A 4MU9A 3VSMA 1WU4A 1LTXB 2R2LB 4GAXA 3EQAA 3M76A 2RGKA 5EAUA 2ONGA 1V7WA 3RX5A 2GZ6A 5IK6A 1TNOB 2AFAA 3PZ1B 2DRRA 4Q2BA 1H3BA 4KTPA 3TF4A 2JJBA 2G02A 4C1SA 2NVPA 1L2AA 4FJQA 1O1RB 1HMWA 1FPPB 3HXEB 1V7VA 3SQCA 4EHMB 3VSNA 1N1ZA 1HXCA 1O5MB 4AYQA 1KZOB 1KZPB 3E7JA 4ZG8A 2RI9A 3WKIA 1JCRB 3M74A 3M72A 1N7PA 1LF6A 3EUVB 5JMFA 1DCEB 1GSZA 1FT2B 1O1SB 1KS8A 1RQ5A 5ILHA 3WKFA 5IM1A 1G9JA 1HM3A 3QG0A 1FCEA 2BB6A 1TN8B 2SQCA 4D4AA 1F9GA 2EADA 1HX9A 1HM2A 1H54A 2BEDB 1FO2A 1KREA 1H3AA 4CE7A 2WIIB 5JPNB 4FNVA 4Q88A 1N1BA 1J0NA 3Q7AB 3SDQA 3C72B 3QXQA 5IL3A 1C3DA 1HN0A 4FXKB 1S64B 3N0GA 4KTRA 5IK9A 1HV6A 2WDAA 1FP3A 5ILIA 3E6UA 3E80A 1TN6B 5FO9B 1CB8A 3AFLA 3HXDB 4GTPB 5IKHA 3W7WA 3G4FA 1MZCB 3M73A 4YCRA 5JMDA 4RNQA 3S4DA 1N24A 1N94B 5CA3A 4OJZA 3E30B 2VN7A 5MEHA 5FO7B 2AHFA 1F9OA 1XWQA 3NFVA 5EATA 4V1SA 2VN4A 1IA7A 2PN5A 2DRQA 1D8DB 1FAEA 3W5NA 4EL8A 2H6GB 2ZZRA 1EGUA 5AGDA 5IL8A 3QT3A 3OXUA 4TF4A 3DRAB 1O6RA 1WU5A 5GY3A 1UG9A 1V5DA 4MMIA 2P0VA 1H14A 1GXMA 1TNUB 1X1HA 2H6HB 3RENA 3QDEA 3P5PA 4GTVB 1DL2A 3ANKA 1OJMA 1NC5A 2CQTA 4L6XA 3DPYB 4ONTA 4CJ1A 1N4QB 2EAEA 1W6KA 3PZ3B 2EABA 4JJJA 1X1JA 4F13A 1HZFA 2H6FB 4KKIA 1XW2A 3SFXB 1GAHA 4LNVA 4OZWA 3M01A 1NL4B 2F6DA 5C05A 3QT9A 3ACSA 1G9GA 1XWTA 2RI8A 1N4SB 4GL3A 1IA6A 2JF4A 4OK4A 4D94A 3DSXB 4GTOB 4LNGB 1OJOA 1DOGA 3WUXA 1OJPA 1G87A 3M02A 1N7NA 1O6QA 3ON6A 4M76A 1GHQA 3S9VA 2DROA 3M78A 3Q7FB 1W6JA 4Z4JA 1CEMA 1GXOA 3EZ8A 4YDEB 2WY7A 3Q73B 3CU7A 1V7XA 1GXNA 3E32B 1X81B 1TN7B 1H13A 2ZBLA 1SA5B 5M7YA 4E1YA 1AYXA 2J5CA 3WKGA 5ILYA 1LD7B 1O79A 3Q79B 3HXCB 4FUSA 1RW9A 1H39A 5KKBA 4AYRA 2E24A 2D5JA 3AFJA 5ILZA 1N4PB 3W5MA 1LOHA 1FBOA 1RWGA 4KKJA 3P5RA 5CD2A 1N23A 5CZLA 2GH4A 1JS4A 3PYBA 1QBQB 1N21A 4FXGB 3SFYB 2FUZA 3H7LA 1H37A 5DHIA 3QXFA 4WU0A 4WVAA 1TNYB 1QQFA 4ZH5A 3SDVA 1R76A 2XFGA 2V3PA 5IKAA 4LNBB 5JPMB 2A8ZA 2XQWA 2ZIRB 2FV1A 1IS9A 1N7RA 3W7XA 1F9DA 2ZISB 3GZKA 1RWHA 3S4CA 1QSJA 4AYOA 4WVBA 1N7QA 3DSWB 2BBCA 3RRSA 1OJNA 3DSUB 2DRSA 5GW7A 4WVCA 2D8LA 2FV0A 1KWFA 4GTSB 3E33B 1LXKA 3PZ4B 1TNBB 2BB5A 4TXTA 3DSVB 1FO3A 5ILKA 1KRFA 3ANJA 4L0GA 3KQ4A 5FO8B 1N20A 4D4BA 1GAIA 3K7XA 1RWAA 5DGQA 1N7OA 2YIKA 3KSQB 2FUTA 3ACTA 2ONHA 4QT9A 3D3IA 3PYAA 4F10A 1RWCA 3KSLB 1N9AB 1FMIA 1QAZA 2F0YB 1N4RB 2V8IA 1KFGA 2G0DA 2PMVA 4OK2A 3SDUA 3GLYA 1WU6A 3NNBA 3W7SA 1KSCA 3WKHA 1F1SA 4LIXA 3X17A 5M7IA 1NI1B 3GT5A 1ULVA 3M7CA 3M7EA 1H3CA 3A3VA 1GA2A 2BRPA 3QPFA 3P2CA 3W7TA 2FUQA 3RX7A 5ILJA 5DHKA 1X1IA 2WCOA 3SDRA 2IEJB 4BOKA 4GTTB 5FOBB 3VXDA 3CIHA 3Q78B 2XWBB 2EACA 2WY8A 4ZRQA 3HXFB 2CQSA 3A0OA 4GTRB 1CLCA 1WZZA 3M77A 3QWTA 2NOJA 1NXCA 4XUVA 4DOEA 4ZRPA 3M7LA 3M00A 1HMUA 1G6IA 4V1RA 1TF4A 1JCQB 1H12A 2Q1FA 3M7BA 1O1TB 5IK0A 3WIRA 2AHGA 2V3NA 2V8JA 3E37B 1J0MA 3VW5A 3W7UA 3LZ9A 3M75A 2B39A 1SA4B 1UMPA 3PMMA 2WINB 3DSSB 3DSTB 3K11A 1V5CA 3RX8A 1JCSB 3EU8A 3QFZA 3S4AA 5E2JA 2E22A 3WIWA 1UT9A 4NEIA 3E73A 4MMHA 4D4DA 3QSPA 1KKTA 3OEDA 1W3YA 4GTMB 2JG0A 4OZVA 3PZ2B 4D4CA 4YDOB 4BOJA 1N95B 1H36A 1K72A 3H3KA 1AGMA 1VD5A 1O6HA 3Q75B 4L9PB 3RSYA 3QRYA 2FBAA 2V8KA 1H35A 3G6JB 3D5RA 2QNOA 1RWFA 4GTQB 5DGRA 3M71A 1X9DA 2A73B 3ANIA 3G4DA 2H6IB 1D8EB 1S63B 2X03A 1SQCA 3KLSA 4J5TA 1LD8B 3QFYA 4ZH1A 2B4FA
chains in the Genus database with same CATH topology
3SAEA 3H2WA 1HCUA 3HXBB 2I07B 2OKXA 4Z4LA 3T33A 3E34B 1FT1B 3EU5B 3S4BA 3WIQA 1L1YA 4MBGB 4CJ0A 4DODA 2WYNA 3SDTA 1GLMA 5GZKA 4AYPA 1TNZB 2GOXA 3D5SA 1LF9A 3RJ3A 1KSDA 3WC3A 1FBWA 2XWJB 2Z07A 4MU9A 1WU4A 1LTXB 2R2LB 3EQAA 3M76A 2RGKA 1V7WA 3RX5A 2GZ6A 1TNOB 2AFAA 3PZ1B 2DRRA 4Q2BA 1H3BA 4KTPA 3TF4A 2JJBA 2G02A 4C1SA 2NVPA 1L2AA 1O1RB 1FPPB 3HXEB 1V7VA 3SQCA 4EHMB 1O5MB 4AYQA 1KZOB 1KZPB 4ZG8A 2RI9A 3WKIA 1JCRB 3M74A 3M72A 1LF6A 3EUVB 1DCEB 1GSZA 1FT2B 1O1SB 1KS8A 1RQ5A 3WKFA 1G9JA 3QG0A 1FCEA 2BB6A 1TN8B 2SQCA 4D4AA 2EADA 1H54A 2BEDB 1FO2A 1H3AA 1KREA 4CE7A 2WIIB 5JPNB 4Q88A 3Q7AB 3SDQA 3C72B 3QXQA 1C3DA 4FXKB 1S64B 4KTRA 1FP3A 3E6UA 1TN6B 5FO9B 3HXDB 4GTPB 3W7WA 1MZCB 3M73A 4YCRA 3S4DA 1N94B 5CA3A 3E30B 2VN7A 5MEHA 5FO7B 2AHFA 1F9OA 1XWQA 4V1SA 2VN4A 1IA7A 2PN5A 2DRQA 1D8DB 1FAEA 3W5NA 4EL8A 2H6GB 2ZZRA 5AGDA 3QT3A 3OXUA 4TF4A 3DRAB 1O6RA 1WU5A 5GY3A 1UG9A 1V5DA 2P0VA 1H14A 1GXMA 1TNUB 2H6HB 3RENA 3QDEA 3P5PA 4GTVB 1DL2A 3ANKA 1NC5A 2CQTA 4L6XA 3DPYB 4ONTA 4CJ1A 1N4QB 2EAEA 1W6KA 3PZ3B 2EABA 4JJJA 1HZFA 2H6FB 4KKIA 1XW2A 3SFXB 1GAHA 4LNVA 1NL4B 2F6DA 3QT9A 3ACSA 1G9GA 1XWTA 2RI8A 1N4SB 4GL3A 1IA6A 2JF4A 4D94A 3DSXB 4GTOB 4LNGB 1DOGA 3WUXA 1G87A 1O6QA 3ON6A 4M76A 1GHQA 3S9VA 2DROA 3M78A 3Q7FB 1W6JA 4Z4JA 1CEMA 1GXOA 3EZ8A 4YDEB 2WY7A 3Q73B 3CU7A 1V7XA 1GXNA 3E32B 1X81B 1TN7B 1H13A 2ZBLA 1SA5B 5M7YA 1AYXA 3WKGA 1LD7B 1O79A 3Q79B 3HXCB 4FUSA 1H39A 5KKBA 4AYRA 2D5JA 3AFJA 1N4PB 3W5MA 1FBOA 4KKJA 3P5RA 5CD2A 5CZLA 2GH4A 1JS4A 3PYBA 1QBQB 4FXGB 3SFYB 2FUZA 3H7LA 1H37A 3QXFA 4WU0A 4WVAA 1TNYB 1QQFA 4ZH5A 3SDVA 1R76A 2XFGA 2V3PA 4LNBB 5JPMB 2A8ZA 2XQWA 2ZIRB 2FV1A 1IS9A 3W7XA 1F9DA 2ZISB 3GZKA 3S4CA 4AYOA 1QSJA 4WVBA 3DSWB 2BBCA 3RRSA 3DSUB 2DRSA 5GW7A 4WVCA 2D8LA 2FV0A 1KWFA 4GTSB 3E33B 3PZ4B 1TNBB 2BB5A 4TXTA 3DSVB 1FO3A 1KRFA 3ANJA 4L0GA 3KQ4A 5FO8B 4D4BA 1GAIA 3K7XA 5DGQA 2YIKA 3KSQB 3ACTA 4QT9A 3D3IA 3PYAA 3KSLB 1N9AB 1FMIA 2F0YB 1N4RB 2V8IA 1KFGA 2G0DA 2PMVA 3SDUA 3GLYA 1WU6A 3W7SA 1KSCA 3WKHA 4LIXA 3X17A 5M7IA 1NI1B 3GT5A 1ULVA 3M7CA 3M7EA 1H3CA 3A3VA 1GA2A 3QPFA 3P2CA 3W7TA 3RX7A 3SDRA 2IEJB 4BOKA 4GTTB 5FOBB 3VXDA 3CIHA 3Q78B 2XWBB 2EACA 2WY8A 4ZRQA 3HXFB 2CQSA 4GTRB 1CLCA 1WZZA 3M77A 3QWTA 2NOJA 1NXCA 4XUVA 4DOEA 4ZRPA 3M7LA 1G6IA 4V1RA 1TF4A 1JCQB 1H12A 3M7BA 1O1TB 3WIRA 2AHGA 2V3NA 2V8JA 3E37B 3VW5A 3W7UA 3M75A 2B39A 1SA4B 1UMPA 3PMMA 2WINB 3DSSB 3DSTB 3K11A 1V5CA 3RX8A 1JCSB 3EU8A 3QFZA 3S4AA 5E2JA 3WIWA 1UT9A 3E73A 4D4DA 3QSPA 1KKTA 3OEDA 4GTMB 2JG0A 3PZ2B 4D4CA 4YDOB 4BOJA 1N95B 1H36A 1K72A 3H3KA 1AGMA 1VD5A 1O6HA 3Q75B 4L9PB 3RSYA 3QRYA 2FBAA 2V8KA 1H35A 3G6JB 3D5RA 2QNOA 4GTQB 5DGRA 3M71A 1X9DA 2A73B 3ANIA 2H6IB 1D8EB 1S63B 1SQCA 3KLSA 4J5TA 1LD8B 3QFYA 4ZH1A 2B4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ACS A;  1G9G A;  1KSC A;  4Q88 A;  1XWT A;  3WKH A;  3W7S A;  3H2W A;  1HCU A;  2RI8 A;  3X17 A;  5M7I A;  3GT5 A;  3QXQ A;  1ULV A;  1IA6 A;  2JF4 A;  3A3V A;  4KTR A;  2OKX A;  1DOG A;  1GA2 A;  1FP3 A;  3WUX A;  1G87 A;  3P2C A;  3QPF A;  4Z4L A;  3E6U A;  3W7T A;  3T33 A;  3RX7 A;  3ON6 A;  2DRO A;  3W7W A;  4Z4J A;  1CEM A;  3EZ8 A;  3VXD A;  3CIH A;  2EAC A;  3S4B A;  1V7X A;  3S4D A;  3WIQ A;  2CQS A;  1WZZ A;  1CLC A;  1L1Y A;  3QWT A;  5CA3 A;  1NXC A;  2VN7 A;  4XUV A;  4CJ0 A;  2AHF A;  2WYN A;  1H13 A;  4DOD A;  1F9O A;  2ZBL A;  5MEH A;  4DOE A;  1GLM A;  5M7Y A;  4AYP A;  1AYX A;  1XWQ A;  3WKG A;  1LF9 A;  1G6I A;  2VN4 A;  1IA7 A;  1TF4 A;  1H12 A;  4FUS A;  1KSD A;  2DRQ A;  5KKB A;  3WC3 A;  4AYR A;  1FAE A;  1FBW A;  2Z07 A;  3W5N A;  2D5J A;  4EL8 A;  3AFJ A;  2AHG A;  3WIR A;  1WU4 A;  2ZZR A;  3W5M A;  1FBO A;  3EQA A;  5CD2 A;  3QT3 A;  2RGK A;  5CZL A;  1V7W A;  3VW5 A;  2GH4 A;  4TF4 A;  3W7U A;  1JS4 A;  3PMM A;  1WU5 A;  3RX5 A;  2GZ6 A;  2FUZ A;  3H7L A;  3K11 A;  5GY3 A;  1V5C A;  3RX8 A;  2AFA A;  1UG9 A;  2DRR A;  3QFZ A;  5E2J A;  4Q2B A;  1V5D A;  4KTP A;  3S4A A;  2JJB A;  3TF4 A;  3QXF A;  4WU0 A;  4WVA A;  2P0V A;  3WIW A;  4ZH5 A;  1H14 A;  1UT9 A;  2XFG A;  3REN A;  3E73 A;  3QSP A;  2NVP A;  1KKT A;  2A8Z A;  3QDE A;  1L2A A;  2JG0 A;  2FV1 A;  1IS9 A;  3W7X A;  1F9D A;  4AYO A;  1DL2 A;  3GZK A;  3S4C A;  3ANK A;  4WVB A;  1V7V A;  3RRS A;  1NC5 A;  2CQT A;  2DRS A;  4L6X A;  5GW7 A;  4AYQ A;  4WVC A;  4ZG8 A;  2D8L A;  2FV0 A;  2RI9 A;  1KWF A;  3WKI A;  1K72 A;  4CJ1 A;  4TXT A;  3H3K A;  1AGM A;  1VD5 A;  1FO3 A;  2EAE A;  1LF6 A;  3RSY A;  1KRF A;  3ANJ A;  4L0G A;  1RQ5 A;  3QRY A;  1KS8 A;  2FBA A;  2EAB A;  3WKF A;  1G9J A;  4JJJ A;  3QG0 A;  1FCE A;  1GAI A;  2QNO A;  5DGQ A;  5DGR A;  1X9D A;  1XW2 A;  2YIK A;  1GAH A;  3ANI A;  3ACT A;  3D3I A;  2EAD A;  4J5T A;  1H54 A;  1FMI A;  3QFY A;  2F6D A;  1KFG A;  3QT9 A;  2B4F A;  1FO2 A;  1KRE A;  4CE7 A;  3GLY A;  1WU6 A; 
#chains in the Genus database with same CATH topology
 3SAE A;  5ILD A;  3H2W A;  1HCU A;  1LXM A;  3HXB B;  1I8Q A;  2I07 B;  2OKX A;  4Z4L A;  1C82 A;  3T33 A;  3E34 B;  1FT1 B;  5EAS A;  3EU5 B;  3S4B A;  3WIQ A;  1HXA A;  1L1Y A;  2BRW A;  3N0F A;  4MBG B;  1HXG A;  2BRV X;  4CJ0 A;  4DOD A;  2WYN A;  3SDT A;  1GLM A;  5GZK A;  4AYP A;  1TNZ B;  2GOX A;  3D5S A;  1LF9 A;  3RJ3 A;  1N22 A;  4DI5 A;  1KSD A;  3WC3 A;  1FBW A;  2XWJ B;  2Z07 A;  4MU9 A;  3VSM A;  1WU4 A;  1LTX B;  2R2L B;  4GAX A;  3EQA A;  3M76 A;  2RGK A;  5EAU A;  2ONG A;  1V7W A;  3RX5 A;  2GZ6 A;  5IK6 A;  1TNO B;  2AFA A;  3PZ1 B;  2DRR A;  4Q2B A;  1H3B A;  4KTP A;  3TF4 A;  2JJB A;  2G02 A;  4C1S A;  2NVP A;  1L2A A;  4FJQ A;  1O1R B;  1HMW A;  1FPP B;  3HXE B;  1V7V A;  3SQC A;  4EHM B;  3VSN A;  1N1Z A;  1HXC A;  1O5M B;  4AYQ A;  1KZO B;  1KZP B;  3E7J A;  4ZG8 A;  2RI9 A;  3WKI A;  1JCR B;  3M74 A;  3M72 A;  1N7P A;  1LF6 A;  3EUV B;  5JMF A;  1DCE B;  1GSZ A;  1FT2 B;  1O1S B;  1KS8 A;  1RQ5 A;  5ILH A;  3WKF A;  5IM1 A;  1G9J A;  1HM3 A;  3QG0 A;  1FCE A;  2BB6 A;  1TN8 B;  2SQC A;  4D4A A;  1F9G A;  2EAD A;  1HX9 A;  1HM2 A;  1H54 A;  2BED B;  1FO2 A;  1KRE A;  1H3A A;  4CE7 A;  2WII B;  5JPN B;  4FNV A;  4Q88 A;  1N1B A;  1J0N A;  3Q7A B;  3SDQ A;  3C72 B;  3QXQ A;  5IL3 A;  1C3D A;  1HN0 A;  4FXK B;  1S64 B;  3N0G A;  4KTR A;  5IK9 A;  1HV6 A;  2WDA A;  1FP3 A;  5ILI A;  3E6U A;  3E80 A;  1TN6 B;  5FO9 B;  1CB8 A;  3AFL A;  3HXD B;  4GTP B;  5IKH A;  3W7W A;  3G4F A;  1MZC B;  3M73 A;  4YCR A;  5JMD A;  4RNQ A;  3S4D A;  1N24 A;  1N94 B;  5CA3 A;  4OJZ A;  3E30 B;  2VN7 A;  5MEH A;  5FO7 B;  2AHF A;  1F9O A;  1XWQ A;  3NFV A;  5EAT A;  4V1S A;  2VN4 A;  1IA7 A;  2PN5 A;  2DRQ A;  1D8D B;  1FAE A;  3W5N A;  4EL8 A;  2H6G B;  2ZZR A;  1EGU A;  5AGD A;  5IL8 A;  3QT3 A;  3OXU A;  4TF4 A;  3DRA B;  1O6R A;  1WU5 A;  5GY3 A;  1UG9 A;  1V5D A;  4MMI A;  2P0V A;  1H14 A;  1GXM A;  1TNU B;  1X1H A;  2H6H B;  3REN A;  3QDE A;  3P5P A;  4GTV B;  1DL2 A;  3ANK A;  1OJM A;  1NC5 A;  2CQT A;  4L6X A;  3DPY B;  4ONT A;  4CJ1 A;  1N4Q B;  2EAE A;  1W6K A;  3PZ3 B;  2EAB A;  4JJJ A;  1X1J A;  4F13 A;  1HZF A;  2H6F B;  4KKI A;  1XW2 A;  3SFX B;  1GAH A;  4LNV A;  4OZW A;  3M01 A;  1NL4 B;  2F6D A;  5C05 A;  3QT9 A;  3ACS A;  1G9G A;  1XWT A;  2RI8 A;  1N4S B;  4GL3 A;  1IA6 A;  2JF4 A;  4OK4 A;  4D94 A;  3DSX B;  4GTO B;  4LNG B;  1OJO A;  1DOG A;  3WUX A;  1OJP A;  1G87 A;  3M02 A;  1N7N A;  1O6Q A;  3ON6 A;  4M76 A;  1GHQ A;  3S9V A;  2DRO A;  3M78 A;  3Q7F B;  1W6J A;  4Z4J A;  1CEM A;  1GXO A;  3EZ8 A;  4YDE B;  2WY7 A;  3Q73 B;  3CU7 A;  1V7X A;  1GXN A;  3E32 B;  1X81 B;  1TN7 B;  1H13 A;  2ZBL A;  1SA5 B;  5M7Y A;  4E1Y A;  1AYX A;  2J5C A;  3WKG A;  5ILY A;  1LD7 B;  1O79 A;  3Q79 B;  3HXC B;  4FUS A;  1RW9 A;  1H39 A;  5KKB A;  4AYR A;  2E24 A;  2D5J A;  3AFJ A;  5ILZ A;  1N4P B;  3W5M A;  1LOH A;  1FBO A;  1RWG A;  4KKJ A;  3P5R A;  5CD2 A;  1N23 A;  5CZL A;  2GH4 A;  1JS4 A;  3PYB A;  1QBQ B;  1N21 A;  4FXG B;  3SFY B;  2FUZ A;  3H7L A;  1H37 A;  5DHI A;  3QXF A;  4WU0 A;  4WVA A;  1TNY B;  1QQF A;  4ZH5 A;  3SDV A;  1R76 A;  2XFG A;  2V3P A;  5IKA A;  4LNB B;  5JPM B;  2A8Z A;  2XQW A;  2ZIR B;  2FV1 A;  1IS9 A;  1N7R A;  3W7X A;  1F9D A;  2ZIS B;  3GZK A;  1RWH A;  3S4C A;  1QSJ A;  4AYO A;  4WVB A;  1N7Q A;  3DSW B;  2BBC A;  3RRS A;  1OJN A;  3DSU B;  2DRS A;  5GW7 A;  4WVC A;  2D8L A;  2FV0 A;  1KWF A;  4GTS B;  3E33 B;  1LXK A;  3PZ4 B;  1TNB B;  2BB5 A;  4TXT A;  3DSV B;  1FO3 A;  5ILK A;  1KRF A;  3ANJ A;  4L0G A;  3KQ4 A;  5FO8 B;  1N20 A;  4D4B A;  1GAI A;  3K7X A;  1RWA A;  5DGQ A;  1N7O A;  2YIK A;  3KSQ B;  2FUT A;  3ACT A;  2ONH A;  4QT9 A;  3D3I A;  3PYA A;  4F10 A;  1RWC A;  3KSL B;  1N9A B;  1FMI A;  1QAZ A;  2F0Y B;  1N4R B;  2V8I A;  1KFG A;  2G0D A;  2PMV A;  4OK2 A;  3SDU A;  3GLY A;  1WU6 A;  3NNB A;  3W7S A;  1KSC A;  3WKH A;  1F1S A;  4LIX A;  3X17 A;  5M7I A;  1NI1 B;  3GT5 A;  1ULV A;  3M7C A;  3M7E A;  1H3C A;  3A3V A;  1GA2 A;  2BRP A;  3QPF A;  3P2C A;  3W7T A;  2FUQ A;  3RX7 A;  5ILJ A;  5DHK A;  1X1I A;  2WCO A;  3SDR A;  2IEJ B;  4BOK A;  4GTT B;  5FOB B;  3VXD A;  3CIH A;  3Q78 B;  2XWB B;  2EAC A;  2WY8 A;  4ZRQ A;  3HXF B;  2CQS A;  3A0O A;  4GTR B;  1CLC A;  1WZZ A;  3M77 A;  3QWT A;  2NOJ A;  1NXC A;  4XUV A;  4DOE A;  4ZRP A;  3M7L A;  3M00 A;  1HMU A;  1G6I A;  4V1R A;  1TF4 A;  1JCQ B;  1H12 A;  2Q1F A;  3M7B A;  1O1T B;  5IK0 A;  3WIR A;  2AHG A;  2V3N A;  2V8J A;  3E37 B;  1J0M A;  3VW5 A;  3W7U A;  3LZ9 A;  3M75 A;  2B39 A;  1SA4 B;  1UMP A;  3PMM A;  2WIN B;  3DSS B;  3DST B;  3K11 A;  1V5C A;  3RX8 A;  1JCS B;  3EU8 A;  3QFZ A;  3S4A A;  5E2J A;  2E22 A;  3WIW A;  1UT9 A;  4NEI A;  3E73 A;  4MMH A;  4D4D A;  3QSP A;  1KKT A;  3OED A;  1W3Y A;  4GTM B;  2JG0 A;  4OZV A;  3PZ2 B;  4D4C A;  4YDO B;  4BOJ A;  1N95 B;  1H36 A;  1K72 A;  3H3K A;  1AGM A;  1VD5 A;  1O6H A;  3Q75 B;  4L9P B;  3RSY A;  3QRY A;  2FBA A;  2V8K A;  1H35 A;  3G6J B;  3D5R A;  2QNO A;  1RWF A;  4GTQ B;  5DGR A;  3M71 A;  1X9D A;  2A73 B;  3ANI A;  3G4D A;  2H6I B;  1D8E B;  1S63 B;  2X03 A;  1SQC A;  3KLS A;  4J5T A;  1LD8 B;  3QFY A;  4ZH1 A;  2B4F A; 
#chains in the Genus database with same CATH homology
 3SAE A;  3H2W A;  1HCU A;  3HXB B;  2I07 B;  2OKX A;  4Z4L A;  3T33 A;  3E34 B;  1FT1 B;  3EU5 B;  3S4B A;  3WIQ A;  1L1Y A;  4MBG B;  4CJ0 A;  4DOD A;  2WYN A;  3SDT A;  1GLM A;  5GZK A;  4AYP A;  1TNZ B;  2GOX A;  3D5S A;  1LF9 A;  3RJ3 A;  1KSD A;  3WC3 A;  1FBW A;  2XWJ B;  2Z07 A;  4MU9 A;  1WU4 A;  1LTX B;  2R2L B;  3EQA A;  3M76 A;  2RGK A;  1V7W A;  3RX5 A;  2GZ6 A;  1TNO B;  2AFA A;  3PZ1 B;  2DRR A;  4Q2B A;  1H3B A;  4KTP A;  3TF4 A;  2JJB A;  2G02 A;  4C1S A;  2NVP A;  1L2A A;  1O1R B;  1FPP B;  3HXE B;  1V7V A;  3SQC A;  4EHM B;  1O5M B;  4AYQ A;  1KZO B;  1KZP B;  4ZG8 A;  2RI9 A;  3WKI A;  1JCR B;  3M74 A;  3M72 A;  1LF6 A;  3EUV B;  1DCE B;  1GSZ A;  1FT2 B;  1O1S B;  1KS8 A;  1RQ5 A;  3WKF A;  1G9J A;  3QG0 A;  1FCE A;  2BB6 A;  1TN8 B;  2SQC A;  4D4A A;  2EAD A;  1H54 A;  2BED B;  1FO2 A;  1H3A A;  1KRE A;  4CE7 A;  2WII B;  5JPN B;  4Q88 A;  3Q7A B;  3SDQ A;  3C72 B;  3QXQ A;  1C3D A;  4FXK B;  1S64 B;  4KTR A;  1FP3 A;  3E6U A;  1TN6 B;  5FO9 B;  3HXD B;  4GTP B;  3W7W A;  1MZC B;  3M73 A;  4YCR A;  3S4D A;  1N94 B;  5CA3 A;  3E30 B;  2VN7 A;  5MEH A;  5FO7 B;  2AHF A;  1F9O A;  1XWQ A;  4V1S A;  2VN4 A;  1IA7 A;  2PN5 A;  2DRQ A;  1D8D B;  1FAE A;  3W5N A;  4EL8 A;  2H6G B;  2ZZR A;  5AGD A;  3QT3 A;  3OXU A;  4TF4 A;  3DRA B;  1O6R A;  1WU5 A;  5GY3 A;  1UG9 A;  1V5D A;  2P0V A;  1H14 A;  1GXM A;  1TNU B;  2H6H B;  3REN A;  3QDE A;  3P5P A;  4GTV B;  1DL2 A;  3ANK A;  1NC5 A;  2CQT A;  4L6X A;  3DPY B;  4ONT A;  4CJ1 A;  1N4Q B;  2EAE A;  1W6K A;  3PZ3 B;  2EAB A;  4JJJ A;  1HZF A;  2H6F B;  4KKI A;  1XW2 A;  3SFX B;  1GAH A;  4LNV A;  1NL4 B;  2F6D A;  3QT9 A;  3ACS A;  1G9G A;  1XWT A;  2RI8 A;  1N4S B;  4GL3 A;  1IA6 A;  2JF4 A;  4D94 A;  3DSX B;  4GTO B;  4LNG B;  1DOG A;  3WUX A;  1G87 A;  1O6Q A;  3ON6 A;  4M76 A;  1GHQ A;  3S9V A;  2DRO A;  3M78 A;  3Q7F B;  1W6J A;  4Z4J A;  1CEM A;  1GXO A;  3EZ8 A;  4YDE B;  2WY7 A;  3Q73 B;  3CU7 A;  1V7X A;  1GXN A;  3E32 B;  1X81 B;  1TN7 B;  1H13 A;  2ZBL A;  1SA5 B;  5M7Y A;  1AYX A;  3WKG A;  1LD7 B;  1O79 A;  3Q79 B;  3HXC B;  4FUS A;  1H39 A;  5KKB A;  4AYR A;  2D5J A;  3AFJ A;  1N4P B;  3W5M A;  1FBO A;  4KKJ A;  3P5R A;  5CD2 A;  5CZL A;  2GH4 A;  1JS4 A;  3PYB A;  1QBQ B;  4FXG B;  3SFY B;  2FUZ A;  3H7L A;  1H37 A;  3QXF A;  4WU0 A;  4WVA A;  1TNY B;  1QQF A;  4ZH5 A;  3SDV A;  1R76 A;  2XFG A;  2V3P A;  4LNB B;  5JPM B;  2A8Z A;  2XQW A;  2ZIR B;  2FV1 A;  1IS9 A;  3W7X A;  1F9D A;  2ZIS B;  3GZK A;  3S4C A;  4AYO A;  1QSJ A;  4WVB A;  3DSW B;  2BBC A;  3RRS A;  3DSU B;  2DRS A;  5GW7 A;  4WVC A;  2D8L A;  2FV0 A;  1KWF A;  4GTS B;  3E33 B;  3PZ4 B;  1TNB B;  2BB5 A;  4TXT A;  3DSV B;  1FO3 A;  1KRF A;  3ANJ A;  4L0G A;  3KQ4 A;  5FO8 B;  4D4B A;  1GAI A;  3K7X A;  5DGQ A;  2YIK A;  3KSQ B;  3ACT A;  4QT9 A;  3D3I A;  3PYA A;  3KSL B;  1N9A B;  1FMI A;  2F0Y B;  1N4R B;  2V8I A;  1KFG A;  2G0D A;  2PMV A;  3SDU A;  3GLY A;  1WU6 A;  3W7S A;  1KSC A;  3WKH A;  4LIX A;  3X17 A;  5M7I A;  1NI1 B;  3GT5 A;  1ULV A;  3M7C A;  3M7E A;  1H3C A;  3A3V A;  1GA2 A;  3QPF A;  3P2C A;  3W7T A;  3RX7 A;  3SDR A;  2IEJ B;  4BOK A;  4GTT B;  5FOB B;  3VXD A;  3CIH A;  3Q78 B;  2XWB B;  2EAC A;  2WY8 A;  4ZRQ A;  3HXF B;  2CQS A;  4GTR B;  1CLC A;  1WZZ A;  3M77 A;  3QWT A;  2NOJ A;  1NXC A;  4XUV A;  4DOE A;  4ZRP A;  3M7L A;  1G6I A;  4V1R A;  1TF4 A;  1JCQ B;  1H12 A;  3M7B A;  1O1T B;  3WIR A;  2AHG A;  2V3N A;  2V8J A;  3E37 B;  3VW5 A;  3W7U A;  3M75 A;  2B39 A;  1SA4 B;  1UMP A;  3PMM A;  2WIN B;  3DSS B;  3DST B;  3K11 A;  1V5C A;  3RX8 A;  1JCS B;  3EU8 A;  3QFZ A;  3S4A A;  5E2J A;  3WIW A;  1UT9 A;  3E73 A;  4D4D A;  3QSP A;  1KKT A;  3OED A;  4GTM B;  2JG0 A;  3PZ2 B;  4D4C A;  4YDO B;  4BOJ A;  1N95 B;  1H36 A;  1K72 A;  3H3K A;  1AGM A;  1VD5 A;  1O6H A;  3Q75 B;  4L9P B;  3RSY A;  3QRY A;  2FBA A;  2V8K A;  1H35 A;  3G6J B;  3D5R A;  2QNO A;  4GTQ B;  5DGR A;  3M71 A;  1X9D A;  2A73 B;  3ANI A;  2H6I B;  1D8E B;  1S63 B;  1SQC A;  3KLS A;  4J5T A;  1LD8 B;  3QFY A;  4ZH1 A;  2B4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...