3E6UA

Crystal structure of human lancl1
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
409
structure length
409
Chain Sequence
HHHHSMDIEFMAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LanC-like protein 1
publication title Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
pubmed doi rcsb
source organism Homo sapiens
total genus 147
structure length 409
sequence length 409
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2008-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05147 LANC_like Lanthionine synthetase C-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3e6uA00
1CEMA 3S4BA 1VD5A 1FO3A 1WZZA 1NC5A 2B4FA 2RGKA 4J5TA 3WKIA 1FBOA 4L6XA 1KS8A 2QNOA 3QT3A 1HCUA 2EAEA 3QPFA 3QFZA 2RI8A 1GAIA 2FUZA 2AHGA 3QRYA 2EACA 4WU0A 2EABA 3W7SA 4KTPA 1UG9A 2CQTA 3WIRA 2DRQA 1L2AA 3W7UA 5E2JA 2DRSA 1KSCA 1LF9A 2JF4A 2P0VA 3VXDA 3X17A 2GZ6A 4WVAA 4CE7A 4Z4LA 3T33A 3ON6A 1AYXA 1V7XA 2EADA 5GY3A 2Z07A 1FMIA 3RSYA 2FBAA 3W5MA 1L1YA 3D3IA 3ANJA 4JJJA 4Q88A 3WIQA 1G9GA 3VW5A 5CA3A 2D5JA 2VN7A 1WU6A 3K11A 3CIHA 3QSPA 1DL2A 2FV0A 4ZH5A 1KREA 3H7LA 3RENA 4AYRA 1IA7A 4CJ0A 3W7XA 1GAHA 1TF4A 1GA2A 1KKTA 3GT5A 1FCEA 3QXFA 4TXTA 1IA6A 2ZBLA 1FAEA 3PMMA 3ACTA 4Z4JA 2FV1A 3WC3A 3W5NA 3QWTA 1F9DA 1WU5A 4EL8A 4CJ1A 2A8ZA 1X9DA 2OKXA 2VN4A 2AFAA 3RX5A 1DOGA 3RRSA 4XUVA 3RX8A 3W7WA 4AYQA 1V7VA 2D8LA 3GZKA 4ZG8A 5DGQA 1H13A 5GW7A 1AGMA 1H54A 1F9OA 5DGRA 5M7YA 3WUXA 1KRFA 4FUSA 3WIWA 5M7IA 3S4CA 3QDEA 1XW2A 3AFJA 3ANKA 4Q2BA 2WYNA 2JJBA 3QFYA 2NVPA 1K72A 1H12A 2DROA 1XWTA 1JS4A 1IS9A 2GH4A 3S4AA 1CLCA 1ULVA 5KKBA 2AHFA 1G9JA 3GLYA 4WVBA 1V7WA 1XWQA 2DRRA 3E73A 4AYOA 3QG0A 4L0GA 2ZZRA 1KWFA 2F6DA 1KFGA 3H2WA 3EQAA 3WKHA 4KTRA 1GLMA 1KSDA 2YIKA 4TF4A 5CD2A 2XFGA 4DOEA 3WKFA 4DODA 3S4DA 3EZ8A 4AYPA 3RX7A 2RI9A 3W7TA 1H14A 1FP3A 4WVCA 1LF6A 5MEHA 3E6UA 1FO2A 3H3KA 3P2CA 1NXCA 1UT9A 1G87A 3TF4A 2JG0A 1FBWA 1RQ5A 1G6IA 1WU4A 2CQSA 5CZLA 3ACSA 3QT9A 3QXQA 1V5DA 3ANIA 3WKGA 1V5CA 3A3VA
chains in the Genus database with same CATH superfamily
1FO3A 1WZZA 3G6JB 2RGKA 3VSMA 2QNOA 1HCUA 1HXCA 1FT2B 1OJPA 4ZRPA 1TN7B 5IKAA 5JMDA 3DSSB 2H6IB 3Q79B 2CQTA 3E34B 2DRSA 2JF4A 2GZ6A 4LIXA 3M76A 4OJZA 3ON6A 2EADA 5GY3A 2BRWA 3G4FA 2GOXA 1H3AA 4ZRQA 3W5MA 4GTMB 1N9AB 4JJJA 3Q75B 1C3DA 3DSTB 1LD7B 5CA3A 2VN7A 3SFYB 1O6RA 3PYAA 1N22A 4NEIA 2ONHA 1TN8B 3SAEA 5DHKA 3N0GA 1UMPA 2G0DA 4ZH1A 3W7XA 1N4PB 4YDOB 3GT5A 1X1IA 3PMMA 1QAZA 3KSQB 1HXGA 4EL8A 3M72A 1X9DA 3RX5A 1DOGA 3RRSA 1GSZA 2NOJA 2J5CA 4RNQA 1JCSB 4GTSB 1GHQA 5M7YA 1KRFA 3PZ1B 1XW2A 4Q2BA 2WYNA 1N4SB 5AGDA 2NVPA 5IK6A 1C82A 3S4AA 1G9JA 1J0NA 5EASA 3DRAB 1XWQA 1N1ZA 3E73A 4AYOA 2I07B 2ZZRA 1KWFA 3M75A 5DHIA 1KFGA 4MU9A 4DODA 3Q7AB 3EZ8A 3RX7A 2BRPA 2RI9A 3W7TA 1N4RB 3M77A 4LNGB 5IL8A 2A73B 1H3BA 5IKHA 1LF6A 3AFLA 2BBCA 1H36A 1R76A 3N0FA 3LZ9A 2JG0A 1FBWA 1OJMA 3E32B 1N24A 3ANIA 5ILIA 2H6FB 1V5CA 4LNVA 1VD5A 3M01A 2B4FA 1NC5A 4MMIA 3QT3A 4OK2A 2EAEA 1H35A 1TNUB 1RWGA 1LOHA 1HX9A 2FUZA 5FO8B 3NNBA 1JCQB 4FXGB 2EABA 3W7SA 1UG9A 1HZFA 1D8DB 5E2JA 4GAXA 1KZOB 1J0MA 3VXDA 3X17A 5FOBB 4GTRB 1N4QB 4MBGB 4CE7A 1H3CA 1V7XA 3RSYA 2FBAA 4KKIA 2V3PA 3M71A 3PYBA 1L1YA 3D3IA 3ANJA 3K7XA 4Q88A 1G9GA 3C72B 2D5JA 1TNBB 2R2LB 4YCRA 2WY8A 3CIHA 1DL2A 2FV0A 4ZH5A 5JMFA 3DPYB 3H7LA 1TF4A 1GA2A 2H6HB 2B39A 1RWAA 1OJOA 2WCOA 2ZBLA 3QWTA 1F9DA 3SDTA 4CJ1A 2A8ZA 4D4AA 2VN4A 2AFAA 5EATA 3M02A 1X1JA 4XUVA 1HXAA 2WIIB 3W7WA 5ILHA 1H37A 1H13A 3PZ3B 1NL4B 5DGRA 1F9OA 2WY7A 1GXOA 3M73A 2ZISB 3WUXA 5M7IA 3AFJA 3ANKA 2JJBA 2G02A 1K72A 5ILDA 1JS4A 1MZCB 1IS9A 2GH4A 3G4DA 1CLCA 1F1SA 3E33B 1OJNA 3P5RA 1N94B 3QG0A 4L0GA 4OZVA 1N7PA 3WKHA 2F0YB 4V1SA 3PZ2B 1KSDA 2YIKA 3SFXB 2BB6A 1CB8A 1N7OA 4BOKA 1O1SB 1H14A 5MEHA 4ONTA 1LXMA 1NXCA 3TF4A 4GTTB 1HN0A 2CQSA 5JPNB 1LTXB 3S4BA 1HMWA 3WKIA 3HXBB 1KS8A 1HMUA 1RW9A 3QFZA 2RI8A 1GAIA 3QRYA 2EACA 3HXDB 5FO9B 3EU8A 2DRQA 1L2AA 1NI1B 1JCRB 1GXMA 3Q78B 4WVAA 3SDVA 4F13A 3D5SA 3HXCB 4Z4LA 3M78A 3T33A 1AYXA 2Z07A 1FMIA 2XWJB 3E30B 4C1SA 3M00A 3WIQA 3VW5A 2ONGA 3K11A 4E1YA 1N7RA 3QSPA 1H39A 4GTQB 1W3YA 3Q73B 1O79A 3RENA 4AYRA 4CJ0A 1KKTA 1N7QA 3Q7FB 1RWHA 1FAEA 1N23A 4Z4JA 2FV1A 3WC3A 3W5NA 1LXKA 4L9PB 5FO7B 3RX8A 5EAUA 4GTOB 4AYQA 1V7VA 2IEJB 2SQCA 5DGQA 1AGMA 5IK0A 1H54A 1O1RB 4FUSA 1DCEB 1HM2A 3S4CA 3QDEA 3EU5B 1QQFA 4QT9A 1XWTA 5KKBA 3CU7A 1ULVA 1N21A 4WVBA 2BEDB 4FJQA 3M74A 1N20A 3SDQA 2F6DA 3M7LA 1SA5B 1FT1B 4KTRA 2WDAA 4KKJA 2V8KA 1I8QA 5CD2A 3WKFA 3D5RA 4MMHA 3S4DA 3DSXB 3VSNA 1O6QA 5IL3A 4D94A 4GTPB 2XWBB 1S64B 1UT9A 2E24A 4F10A 2BB5A 1RQ5A 1G6IA 1WU4A 3ACSA 1W6KA 3QT9A 3QXQA 1V5DA 2FUQA 3SDRA 1TNYB 1O6HA 3SDUA 2ZIRB 1SA4B 3WKGA 4LNBB 3QPFA 1CEMA 5IM1A 1F9GA 4J5TA 2E22A 4D4DA 1FBOA 4L6XA 1D8EB 1GXNA 2AHGA 4GL3A 1HM3A 3KLSA 4WU0A 3DSVB 4KTPA 3HXFB 3WIRA 4D4CA 3W7UA 2V8JA 3HXEB 4EHMB 1KSCA 1LF9A 1N7NA 2H6GB 2P0VA 1LD8B 1X81B 3E7JA 1KZPB 3KSLB 4GTVB 1N1BA 2V8IA 3M7BA 1QBQB 3S9VA 1EGUA 3P5PA 1WU6A 5GZKA 4OZWA 5JPMB 1KREA 1RWCA 5ILYA 3E37B 2X03A 1IA7A 4OK4A 1GAHA 1TNZB 5ILKA 1TN6B 1FCEA 3QXFA 4TXTA 1X1HA 1IA6A 3ACTA 3A0OA 5C05A 2PN5A 3RJ3A 1WU5A 4BOJA 2OKXA 3SQCA 3E80A 5ILZA 1W6JA 1TNOB 1N95B 2BRVX 2Q1FA 3M7CA 4D4BA 2D8LA 3GZKA 4ZG8A 2V3NA 1QSJA 4V1RA 5GW7A 4DI5A 3KQ4A 3WIWA 3QFYA 2PMVA 1H12A 2DROA 1O5MB 4FXKB 2AHFA 3GLYA 1V7WA 2DRRA 2XQWA 3H2WA 3EQAA 3PZ4B 1GLMA 4TF4A 4DOEA 2XFGA 3NFVA 3OXUA 1RWFA 1SQCA 3OEDA 4AYPA 1S63B 4M76A 3DSUB 4YDEB 1HV6A 3M7EA 1FPPB 1FP3A 3EUVB 4WVCA 3E6UA 1FO2A 3H3KA 3P2CA 1G87A 4FNVA 5IK9A 2WINB 5CZLA 1O1TB 5ILJA 2FUTA 3DSWB 3A3VA
chains in the Genus database with same CATH topology
1FO3A 1WZZA 3G6JB 2RGKA 2QNOA 1HCUA 1FT2B 4ZRPA 1TN7B 3DSSB 2H6IB 3Q79B 2CQTA 3E34B 2DRSA 2JF4A 2GZ6A 4LIXA 3M76A 3ON6A 2EADA 5GY3A 2GOXA 1H3AA 4ZRQA 3W5MA 4GTMB 1N9AB 4JJJA 3Q75B 1C3DA 3DSTB 1LD7B 5CA3A 2VN7A 3SFYB 1O6RA 3PYAA 1TN8B 3SAEA 1UMPA 2G0DA 4ZH1A 3W7XA 1N4PB 4YDOB 3GT5A 3PMMA 3KSQB 4EL8A 3M72A 1X9DA 3RX5A 1DOGA 3RRSA 1GSZA 2NOJA 1JCSB 4GTSB 1GHQA 5M7YA 1KRFA 3PZ1B 1XW2A 4Q2BA 2WYNA 1N4SB 5AGDA 2NVPA 3S4AA 1G9JA 3DRAB 1XWQA 3E73A 4AYOA 2I07B 2ZZRA 1KWFA 3M75A 1KFGA 4MU9A 4DODA 3Q7AB 3EZ8A 3RX7A 2RI9A 3W7TA 1N4RB 3M77A 4LNGB 2A73B 1H3BA 1LF6A 2BBCA 1H36A 1R76A 2JG0A 1FBWA 3E32B 3ANIA 2H6FB 1V5CA 4LNVA 1VD5A 2B4FA 1NC5A 3QT3A 2EAEA 1H35A 1TNUB 2FUZA 5FO8B 1JCQB 4FXGB 2EABA 3W7SA 1UG9A 1HZFA 1D8DB 5E2JA 1KZOB 3VXDA 3X17A 5FOBB 4GTRB 1N4QB 4MBGB 4CE7A 1H3CA 1V7XA 3RSYA 2FBAA 4KKIA 2V3PA 3M71A 3PYBA 1L1YA 3D3IA 3ANJA 3K7XA 4Q88A 1G9GA 3C72B 2D5JA 1TNBB 2R2LB 4YCRA 2WY8A 3CIHA 1DL2A 2FV0A 4ZH5A 3DPYB 3H7LA 1TF4A 1GA2A 2H6HB 2B39A 2ZBLA 3QWTA 1F9DA 3SDTA 4CJ1A 2A8ZA 4D4AA 2VN4A 2AFAA 4XUVA 2WIIB 3W7WA 1H37A 1H13A 3PZ3B 1NL4B 5DGRA 1F9OA 2WY7A 1GXOA 3M73A 2ZISB 3WUXA 5M7IA 3AFJA 3ANKA 2JJBA 2G02A 1K72A 1JS4A 1MZCB 1IS9A 2GH4A 1CLCA 3E33B 3P5RA 1N94B 3QG0A 4L0GA 3WKHA 2F0YB 4V1SA 3PZ2B 1KSDA 2YIKA 3SFXB 2BB6A 4BOKA 1O1SB 1H14A 5MEHA 4ONTA 1NXCA 3TF4A 4GTTB 2CQSA 5JPNB 1LTXB 3S4BA 3WKIA 3HXBB 1KS8A 3QFZA 2RI8A 1GAIA 3QRYA 2EACA 3HXDB 5FO9B 3EU8A 2DRQA 1L2AA 1NI1B 1JCRB 1GXMA 3Q78B 4WVAA 3SDVA 3D5SA 3HXCB 4Z4LA 3M78A 3T33A 1AYXA 2Z07A 1FMIA 2XWJB 3E30B 4C1SA 3WIQA 3VW5A 3K11A 3QSPA 1H39A 4GTQB 3Q73B 1O79A 3RENA 4AYRA 4CJ0A 1KKTA 3Q7FB 1FAEA 4Z4JA 2FV1A 3WC3A 3W5NA 4L9PB 5FO7B 3RX8A 4GTOB 4AYQA 1V7VA 2IEJB 2SQCA 5DGQA 1AGMA 1H54A 1O1RB 4FUSA 1DCEB 3S4CA 3QDEA 3EU5B 1QQFA 4QT9A 1XWTA 5KKBA 3CU7A 1ULVA 4WVBA 2BEDB 3M74A 3SDQA 2F6DA 3M7LA 1SA5B 1FT1B 4KTRA 4KKJA 2V8KA 5CD2A 3WKFA 3D5RA 3S4DA 3DSXB 1O6QA 4D94A 4GTPB 2XWBB 1S64B 1UT9A 2BB5A 1RQ5A 1G6IA 1WU4A 3ACSA 1W6KA 3QT9A 3QXQA 1V5DA 3SDRA 1TNYB 1O6HA 3SDUA 2ZIRB 1SA4B 3WKGA 4LNBB 3QPFA 1CEMA 4J5TA 4D4DA 1FBOA 4L6XA 1D8EB 1GXNA 2AHGA 4GL3A 3KLSA 4WU0A 3DSVB 4KTPA 3HXFB 3WIRA 4D4CA 3W7UA 2V8JA 3HXEB 4EHMB 1KSCA 1LF9A 2H6GB 2P0VA 1LD8B 1X81B 1KZPB 3KSLB 4GTVB 2V8IA 3M7BA 1QBQB 3S9VA 3P5PA 1WU6A 5GZKA 5JPMB 1KREA 3E37B 1IA7A 1GAHA 1TNZB 1TN6B 1FCEA 3QXFA 4TXTA 1IA6A 3ACTA 3RJ3A 2PN5A 1WU5A 4BOJA 2OKXA 3SQCA 1W6JA 1TNOB 1N95B 3M7CA 4D4BA 2D8LA 3GZKA 4ZG8A 2V3NA 1QSJA 4V1RA 5GW7A 3KQ4A 3WIWA 3QFYA 2PMVA 1H12A 2DROA 1O5MB 4FXKB 2AHFA 3GLYA 1V7WA 2DRRA 2XQWA 3H2WA 3EQAA 3PZ4B 1GLMA 4TF4A 4DOEA 2XFGA 3OXUA 1SQCA 3OEDA 4AYPA 1S63B 4M76A 3DSUB 4YDEB 3M7EA 1FPPB 1FP3A 3EUVB 4WVCA 3E6UA 1FO2A 3H3KA 3P2CA 1G87A 2WINB 5CZLA 1O1TB 3DSWB 3A3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CEM A;  3S4B A;  1VD5 A;  1FO3 A;  1WZZ A;  1NC5 A;  2B4F A;  2RGK A;  4J5T A;  3WKI A;  1FBO A;  4L6X A;  1KS8 A;  2QNO A;  3QT3 A;  1HCU A;  2EAE A;  3QPF A;  3QFZ A;  2RI8 A;  1GAI A;  2FUZ A;  2AHG A;  3QRY A;  2EAC A;  4WU0 A;  2EAB A;  3W7S A;  4KTP A;  1UG9 A;  2CQT A;  3WIR A;  2DRQ A;  1L2A A;  3W7U A;  5E2J A;  2DRS A;  1KSC A;  1LF9 A;  2JF4 A;  2P0V A;  3VXD A;  3X17 A;  2GZ6 A;  4WVA A;  4CE7 A;  4Z4L A;  3T33 A;  3ON6 A;  1AYX A;  1V7X A;  2EAD A;  5GY3 A;  2Z07 A;  1FMI A;  3RSY A;  2FBA A;  3W5M A;  1L1Y A;  3D3I A;  3ANJ A;  4JJJ A;  4Q88 A;  3WIQ A;  1G9G A;  3VW5 A;  5CA3 A;  2D5J A;  2VN7 A;  1WU6 A;  3K11 A;  3CIH A;  3QSP A;  1DL2 A;  2FV0 A;  4ZH5 A;  1KRE A;  3H7L A;  3REN A;  4AYR A;  1IA7 A;  4CJ0 A;  3W7X A;  1GAH A;  1TF4 A;  1GA2 A;  1KKT A;  3GT5 A;  1FCE A;  3QXF A;  4TXT A;  1IA6 A;  2ZBL A;  1FAE A;  3PMM A;  3ACT A;  4Z4J A;  2FV1 A;  3WC3 A;  3W5N A;  3QWT A;  1F9D A;  1WU5 A;  4EL8 A;  4CJ1 A;  2A8Z A;  1X9D A;  2OKX A;  2VN4 A;  2AFA A;  3RX5 A;  1DOG A;  3RRS A;  4XUV A;  3RX8 A;  3W7W A;  4AYQ A;  1V7V A;  2D8L A;  3GZK A;  4ZG8 A;  5DGQ A;  1H13 A;  5GW7 A;  1AGM A;  1H54 A;  1F9O A;  5DGR A;  5M7Y A;  3WUX A;  1KRF A;  4FUS A;  3WIW A;  5M7I A;  3S4C A;  3QDE A;  1XW2 A;  3AFJ A;  3ANK A;  4Q2B A;  2WYN A;  2JJB A;  3QFY A;  2NVP A;  1K72 A;  1H12 A;  2DRO A;  1XWT A;  1JS4 A;  1IS9 A;  2GH4 A;  3S4A A;  1CLC A;  1ULV A;  5KKB A;  2AHF A;  1G9J A;  3GLY A;  4WVB A;  1V7W A;  1XWQ A;  2DRR A;  3E73 A;  4AYO A;  3QG0 A;  4L0G A;  2ZZR A;  1KWF A;  2F6D A;  1KFG A;  3H2W A;  3EQA A;  3WKH A;  4KTR A;  1GLM A;  1KSD A;  2YIK A;  4TF4 A;  5CD2 A;  2XFG A;  4DOE A;  3WKF A;  4DOD A;  3S4D A;  3EZ8 A;  4AYP A;  3RX7 A;  2RI9 A;  3W7T A;  1H14 A;  1FP3 A;  4WVC A;  1LF6 A;  5MEH A;  3E6U A;  1FO2 A;  3H3K A;  3P2C A;  1NXC A;  1UT9 A;  1G87 A;  3TF4 A;  2JG0 A;  1FBW A;  1RQ5 A;  1G6I A;  1WU4 A;  2CQS A;  5CZL A;  3ACS A;  3QT9 A;  3QXQ A;  1V5D A;  3ANI A;  3WKG A;  1V5C A;  3A3V A; 
#chains in the Genus database with same CATH topology
 1FO3 A;  1WZZ A;  3G6J B;  2RGK A;  3VSM A;  2QNO A;  1HCU A;  1HXC A;  1FT2 B;  1OJP A;  4ZRP A;  1TN7 B;  5IKA A;  5JMD A;  3DSS B;  2H6I B;  3Q79 B;  2CQT A;  3E34 B;  2DRS A;  2JF4 A;  2GZ6 A;  4LIX A;  3M76 A;  4OJZ A;  3ON6 A;  2EAD A;  5GY3 A;  2BRW A;  3G4F A;  2GOX A;  1H3A A;  4ZRQ A;  3W5M A;  4GTM B;  1N9A B;  4JJJ A;  3Q75 B;  1C3D A;  3DST B;  1LD7 B;  5CA3 A;  2VN7 A;  3SFY B;  1O6R A;  3PYA A;  1N22 A;  4NEI A;  2ONH A;  1TN8 B;  3SAE A;  5DHK A;  3N0G A;  1UMP A;  2G0D A;  4ZH1 A;  3W7X A;  1N4P B;  4YDO B;  3GT5 A;  1X1I A;  3PMM A;  1QAZ A;  3KSQ B;  1HXG A;  4EL8 A;  3M72 A;  1X9D A;  3RX5 A;  1DOG A;  3RRS A;  1GSZ A;  2NOJ A;  2J5C A;  4RNQ A;  1JCS B;  4GTS B;  1GHQ A;  5M7Y A;  1KRF A;  3PZ1 B;  1XW2 A;  4Q2B A;  2WYN A;  1N4S B;  5AGD A;  2NVP A;  5IK6 A;  1C82 A;  3S4A A;  1G9J A;  1J0N A;  5EAS A;  3DRA B;  1XWQ A;  1N1Z A;  3E73 A;  4AYO A;  2I07 B;  2ZZR A;  1KWF A;  3M75 A;  5DHI A;  1KFG A;  4MU9 A;  4DOD A;  3Q7A B;  3EZ8 A;  3RX7 A;  2BRP A;  2RI9 A;  3W7T A;  1N4R B;  3M77 A;  4LNG B;  5IL8 A;  2A73 B;  1H3B A;  5IKH A;  1LF6 A;  3AFL A;  2BBC A;  1H36 A;  1R76 A;  3N0F A;  3LZ9 A;  2JG0 A;  1FBW A;  1OJM A;  3E32 B;  1N24 A;  3ANI A;  5ILI A;  2H6F B;  1V5C A;  4LNV A;  1VD5 A;  3M01 A;  2B4F A;  1NC5 A;  4MMI A;  3QT3 A;  4OK2 A;  2EAE A;  1H35 A;  1TNU B;  1RWG A;  1LOH A;  1HX9 A;  2FUZ A;  5FO8 B;  3NNB A;  1JCQ B;  4FXG B;  2EAB A;  3W7S A;  1UG9 A;  1HZF A;  1D8D B;  5E2J A;  4GAX A;  1KZO B;  1J0M A;  3VXD A;  3X17 A;  5FOB B;  4GTR B;  1N4Q B;  4MBG B;  4CE7 A;  1H3C A;  1V7X A;  3RSY A;  2FBA A;  4KKI A;  2V3P A;  3M71 A;  3PYB A;  1L1Y A;  3D3I A;  3ANJ A;  3K7X A;  4Q88 A;  1G9G A;  3C72 B;  2D5J A;  1TNB B;  2R2L B;  4YCR A;  2WY8 A;  3CIH A;  1DL2 A;  2FV0 A;  4ZH5 A;  5JMF A;  3DPY B;  3H7L A;  1TF4 A;  1GA2 A;  2H6H B;  2B39 A;  1RWA A;  1OJO A;  2WCO A;  2ZBL A;  3QWT A;  1F9D A;  3SDT A;  4CJ1 A;  2A8Z A;  4D4A A;  2VN4 A;  2AFA A;  5EAT A;  3M02 A;  1X1J A;  4XUV A;  1HXA A;  2WII B;  3W7W A;  5ILH A;  1H37 A;  1H13 A;  3PZ3 B;  1NL4 B;  5DGR A;  1F9O A;  2WY7 A;  1GXO A;  3M73 A;  2ZIS B;  3WUX A;  5M7I A;  3AFJ A;  3ANK A;  2JJB A;  2G02 A;  1K72 A;  5ILD A;  1JS4 A;  1MZC B;  1IS9 A;  2GH4 A;  3G4D A;  1CLC A;  1F1S A;  3E33 B;  1OJN A;  3P5R A;  1N94 B;  3QG0 A;  4L0G A;  4OZV A;  1N7P A;  3WKH A;  2F0Y B;  4V1S A;  3PZ2 B;  1KSD A;  2YIK A;  3SFX B;  2BB6 A;  1CB8 A;  1N7O A;  4BOK A;  1O1S B;  1H14 A;  5MEH A;  4ONT A;  1LXM A;  1NXC A;  3TF4 A;  4GTT B;  1HN0 A;  2CQS A;  5JPN B;  1LTX B;  3S4B A;  1HMW A;  3WKI A;  3HXB B;  1KS8 A;  1HMU A;  1RW9 A;  3QFZ A;  2RI8 A;  1GAI A;  3QRY A;  2EAC A;  3HXD B;  5FO9 B;  3EU8 A;  2DRQ A;  1L2A A;  1NI1 B;  1JCR B;  1GXM A;  3Q78 B;  4WVA A;  3SDV A;  4F13 A;  3D5S A;  3HXC B;  4Z4L A;  3M78 A;  3T33 A;  1AYX A;  2Z07 A;  1FMI A;  2XWJ B;  3E30 B;  4C1S A;  3M00 A;  3WIQ A;  3VW5 A;  2ONG A;  3K11 A;  4E1Y A;  1N7R A;  3QSP A;  1H39 A;  4GTQ B;  1W3Y A;  3Q73 B;  1O79 A;  3REN A;  4AYR A;  4CJ0 A;  1KKT A;  1N7Q A;  3Q7F B;  1RWH A;  1FAE A;  1N23 A;  4Z4J A;  2FV1 A;  3WC3 A;  3W5N A;  1LXK A;  4L9P B;  5FO7 B;  3RX8 A;  5EAU A;  4GTO B;  4AYQ A;  1V7V A;  2IEJ B;  2SQC A;  5DGQ A;  1AGM A;  5IK0 A;  1H54 A;  1O1R B;  4FUS A;  1DCE B;  1HM2 A;  3S4C A;  3QDE A;  3EU5 B;  1QQF A;  4QT9 A;  1XWT A;  5KKB A;  3CU7 A;  1ULV A;  1N21 A;  4WVB A;  2BED B;  4FJQ A;  3M74 A;  1N20 A;  3SDQ A;  2F6D A;  3M7L A;  1SA5 B;  1FT1 B;  4KTR A;  2WDA A;  4KKJ A;  2V8K A;  1I8Q A;  5CD2 A;  3WKF A;  3D5R A;  4MMH A;  3S4D A;  3DSX B;  3VSN A;  1O6Q A;  5IL3 A;  4D94 A;  4GTP B;  2XWB B;  1S64 B;  1UT9 A;  2E24 A;  4F10 A;  2BB5 A;  1RQ5 A;  1G6I A;  1WU4 A;  3ACS A;  1W6K A;  3QT9 A;  3QXQ A;  1V5D A;  2FUQ A;  3SDR A;  1TNY B;  1O6H A;  3SDU A;  2ZIR B;  1SA4 B;  3WKG A;  4LNB B;  3QPF A;  1CEM A;  5IM1 A;  1F9G A;  4J5T A;  2E22 A;  4D4D A;  1FBO A;  4L6X A;  1D8E B;  1GXN A;  2AHG A;  4GL3 A;  1HM3 A;  3KLS A;  4WU0 A;  3DSV B;  4KTP A;  3HXF B;  3WIR A;  4D4C A;  3W7U A;  2V8J A;  3HXE B;  4EHM B;  1KSC A;  1LF9 A;  1N7N A;  2H6G B;  2P0V A;  1LD8 B;  1X81 B;  3E7J A;  1KZP B;  3KSL B;  4GTV B;  1N1B A;  2V8I A;  3M7B A;  1QBQ B;  3S9V A;  1EGU A;  3P5P A;  1WU6 A;  5GZK A;  4OZW A;  5JPM B;  1KRE A;  1RWC A;  5ILY A;  3E37 B;  2X03 A;  1IA7 A;  4OK4 A;  1GAH A;  1TNZ B;  5ILK A;  1TN6 B;  1FCE A;  3QXF A;  4TXT A;  1X1H A;  1IA6 A;  3ACT A;  3A0O A;  5C05 A;  2PN5 A;  3RJ3 A;  1WU5 A;  4BOJ A;  2OKX A;  3SQC A;  3E80 A;  5ILZ A;  1W6J A;  1TNO B;  1N95 B;  2BRV X;  2Q1F A;  3M7C A;  4D4B A;  2D8L A;  3GZK A;  4ZG8 A;  2V3N A;  1QSJ A;  4V1R A;  5GW7 A;  4DI5 A;  3KQ4 A;  3WIW A;  3QFY A;  2PMV A;  1H12 A;  2DRO A;  1O5M B;  4FXK B;  2AHF A;  3GLY A;  1V7W A;  2DRR A;  2XQW A;  3H2W A;  3EQA A;  3PZ4 B;  1GLM A;  4TF4 A;  4DOE A;  2XFG A;  3NFV A;  3OXU A;  1RWF A;  1SQC A;  3OED A;  4AYP A;  1S63 B;  4M76 A;  3DSU B;  4YDE B;  1HV6 A;  3M7E A;  1FPP B;  1FP3 A;  3EUV B;  4WVC A;  3E6U A;  1FO2 A;  3H3K A;  3P2C A;  1G87 A;  4FNV A;  5IK9 A;  2WIN B;  5CZL A;  1O1T B;  5ILJ A;  2FUT A;  3DSW B;  3A3V A; 
#chains in the Genus database with same CATH homology
 1FO3 A;  1WZZ A;  3G6J B;  2RGK A;  2QNO A;  1HCU A;  1FT2 B;  4ZRP A;  1TN7 B;  3DSS B;  2H6I B;  3Q79 B;  2CQT A;  3E34 B;  2DRS A;  2JF4 A;  2GZ6 A;  4LIX A;  3M76 A;  3ON6 A;  2EAD A;  5GY3 A;  2GOX A;  1H3A A;  4ZRQ A;  3W5M A;  4GTM B;  1N9A B;  4JJJ A;  3Q75 B;  1C3D A;  3DST B;  1LD7 B;  5CA3 A;  2VN7 A;  3SFY B;  1O6R A;  3PYA A;  1TN8 B;  3SAE A;  1UMP A;  2G0D A;  4ZH1 A;  3W7X A;  1N4P B;  4YDO B;  3GT5 A;  3PMM A;  3KSQ B;  4EL8 A;  3M72 A;  1X9D A;  3RX5 A;  1DOG A;  3RRS A;  1GSZ A;  2NOJ A;  1JCS B;  4GTS B;  1GHQ A;  5M7Y A;  1KRF A;  3PZ1 B;  1XW2 A;  4Q2B A;  2WYN A;  1N4S B;  5AGD A;  2NVP A;  3S4A A;  1G9J A;  3DRA B;  1XWQ A;  3E73 A;  4AYO A;  2I07 B;  2ZZR A;  1KWF A;  3M75 A;  1KFG A;  4MU9 A;  4DOD A;  3Q7A B;  3EZ8 A;  3RX7 A;  2RI9 A;  3W7T A;  1N4R B;  3M77 A;  4LNG B;  2A73 B;  1H3B A;  1LF6 A;  2BBC A;  1H36 A;  1R76 A;  2JG0 A;  1FBW A;  3E32 B;  3ANI A;  2H6F B;  1V5C A;  4LNV A;  1VD5 A;  2B4F A;  1NC5 A;  3QT3 A;  2EAE A;  1H35 A;  1TNU B;  2FUZ A;  5FO8 B;  1JCQ B;  4FXG B;  2EAB A;  3W7S A;  1UG9 A;  1HZF A;  1D8D B;  5E2J A;  1KZO B;  3VXD A;  3X17 A;  5FOB B;  4GTR B;  1N4Q B;  4MBG B;  4CE7 A;  1H3C A;  1V7X A;  3RSY A;  2FBA A;  4KKI A;  2V3P A;  3M71 A;  3PYB A;  1L1Y A;  3D3I A;  3ANJ A;  3K7X A;  4Q88 A;  1G9G A;  3C72 B;  2D5J A;  1TNB B;  2R2L B;  4YCR A;  2WY8 A;  3CIH A;  1DL2 A;  2FV0 A;  4ZH5 A;  3DPY B;  3H7L A;  1TF4 A;  1GA2 A;  2H6H B;  2B39 A;  2ZBL A;  3QWT A;  1F9D A;  3SDT A;  4CJ1 A;  2A8Z A;  4D4A A;  2VN4 A;  2AFA A;  4XUV A;  2WII B;  3W7W A;  1H37 A;  1H13 A;  3PZ3 B;  1NL4 B;  5DGR A;  1F9O A;  2WY7 A;  1GXO A;  3M73 A;  2ZIS B;  3WUX A;  5M7I A;  3AFJ A;  3ANK A;  2JJB A;  2G02 A;  1K72 A;  1JS4 A;  1MZC B;  1IS9 A;  2GH4 A;  1CLC A;  3E33 B;  3P5R A;  1N94 B;  3QG0 A;  4L0G A;  3WKH A;  2F0Y B;  4V1S A;  3PZ2 B;  1KSD A;  2YIK A;  3SFX B;  2BB6 A;  4BOK A;  1O1S B;  1H14 A;  5MEH A;  4ONT A;  1NXC A;  3TF4 A;  4GTT B;  2CQS A;  5JPN B;  1LTX B;  3S4B A;  3WKI A;  3HXB B;  1KS8 A;  3QFZ A;  2RI8 A;  1GAI A;  3QRY A;  2EAC A;  3HXD B;  5FO9 B;  3EU8 A;  2DRQ A;  1L2A A;  1NI1 B;  1JCR B;  1GXM A;  3Q78 B;  4WVA A;  3SDV A;  3D5S A;  3HXC B;  4Z4L A;  3M78 A;  3T33 A;  1AYX A;  2Z07 A;  1FMI A;  2XWJ B;  3E30 B;  4C1S A;  3WIQ A;  3VW5 A;  3K11 A;  3QSP A;  1H39 A;  4GTQ B;  3Q73 B;  1O79 A;  3REN A;  4AYR A;  4CJ0 A;  1KKT A;  3Q7F B;  1FAE A;  4Z4J A;  2FV1 A;  3WC3 A;  3W5N A;  4L9P B;  5FO7 B;  3RX8 A;  4GTO B;  4AYQ A;  1V7V A;  2IEJ B;  2SQC A;  5DGQ A;  1AGM A;  1H54 A;  1O1R B;  4FUS A;  1DCE B;  3S4C A;  3QDE A;  3EU5 B;  1QQF A;  4QT9 A;  1XWT A;  5KKB A;  3CU7 A;  1ULV A;  4WVB A;  2BED B;  3M74 A;  3SDQ A;  2F6D A;  3M7L A;  1SA5 B;  1FT1 B;  4KTR A;  4KKJ A;  2V8K A;  5CD2 A;  3WKF A;  3D5R A;  3S4D A;  3DSX B;  1O6Q A;  4D94 A;  4GTP B;  2XWB B;  1S64 B;  1UT9 A;  2BB5 A;  1RQ5 A;  1G6I A;  1WU4 A;  3ACS A;  1W6K A;  3QT9 A;  3QXQ A;  1V5D A;  3SDR A;  1TNY B;  1O6H A;  3SDU A;  2ZIR B;  1SA4 B;  3WKG A;  4LNB B;  3QPF A;  1CEM A;  4J5T A;  4D4D A;  1FBO A;  4L6X A;  1D8E B;  1GXN A;  2AHG A;  4GL3 A;  3KLS A;  4WU0 A;  3DSV B;  4KTP A;  3HXF B;  3WIR A;  4D4C A;  3W7U A;  2V8J A;  3HXE B;  4EHM B;  1KSC A;  1LF9 A;  2H6G B;  2P0V A;  1LD8 B;  1X81 B;  1KZP B;  3KSL B;  4GTV B;  2V8I A;  3M7B A;  1QBQ B;  3S9V A;  3P5P A;  1WU6 A;  5GZK A;  5JPM B;  1KRE A;  3E37 B;  1IA7 A;  1GAH A;  1TNZ B;  1TN6 B;  1FCE A;  3QXF A;  4TXT A;  1IA6 A;  3ACT A;  3RJ3 A;  2PN5 A;  1WU5 A;  4BOJ A;  2OKX A;  3SQC A;  1W6J A;  1TNO B;  1N95 B;  3M7C A;  4D4B A;  2D8L A;  3GZK A;  4ZG8 A;  2V3N A;  1QSJ A;  4V1R A;  5GW7 A;  3KQ4 A;  3WIW A;  3QFY A;  2PMV A;  1H12 A;  2DRO A;  1O5M B;  4FXK B;  2AHF A;  3GLY A;  1V7W A;  2DRR A;  2XQW A;  3H2W A;  3EQA A;  3PZ4 B;  1GLM A;  4TF4 A;  4DOE A;  2XFG A;  3OXU A;  1SQC A;  3OED A;  4AYP A;  1S63 B;  4M76 A;  3DSU B;  4YDE B;  3M7E A;  1FPP B;  1FP3 A;  3EUV B;  4WVC A;  3E6U A;  1FO2 A;  3H3K A;  3P2C A;  1G87 A;  2WIN B;  5CZL A;  1O1T B;  3DSW B;  3A3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...