4GTTB

Engineered rabggtase in complex with bms analogue 12
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 119
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4gttB00
1O79A 4FXGB 1QSJA 5JPNB 2BEDB 4GTPB 2A73B 1SA4B 1LD8B 3K7XA 1N9AB 5FO7B 4BOJA 1TNUB 1GXOA 1O6HA 1NL4B 1FPPB 3KSQB 4MU9A 1D8DB 3E33B 3G6JB 3Q78B 4GTSB 1C3DA 1QQFA 2G0DA 1KZOB 2B39A 3KSLB 3OEDA 3DPYB 3HXCB 1TN7B 1QBQB 3DSUB 2H6GB 2WIIB 1TNYB 1W6JA 2V3NA 3D5SA 4MBGB 4M76A 3Q79B 4V1RA 1S64B 2XWJB 3Q7FB 1LD7B 1UMPA 1S63B 3DSTB 1GSZA 1X81B 4FXKB 2PMVA 2WINB 1JCSB 2NOJA 3OXUA 4LNBB 1TNBB 1H3CA 2PN5A 2V8KA 2WY7A 3DSXB 3PZ1B 4YDOB 1HZFA 1DCEB 4BOKA 3D5RA 4ONTA 4GTVB 4D4AA 3SQCA 3KQ4A 1SA5B 2F0YB 4L9PB 1O5MB 2XQWA 4ZRQA 3EUVB 4C1SA 3HXFB 1N4SB 1N94B 4KKIA 3HXBB 2IEJB 5JPMB 5AGDA 1FT2B 1H36A 1H3BA 3RJ3A 4ZH1A 3Q75B 2BBCA 2WY8A 3DSWB 3DRAB 5FO8B 2SQCA 3EU5B 4GTRB 1TNOB 3PZ2B 4KKJA 1O6RA 3DSSB 3SFXB 1KZPB 4D4DA 2H6IB 4GTMB 5FOBB 1NI1B 3DSVB 2I07B 3E34B 3PZ4B 4LNGB 1H35A 3E37B 5FO9B 1H39A 1N4RB 3C72B 3HXEB 1H37A 1N4PB 2XWBB 1MZCB 1TN6B 1R76A 1GXNA 1LTXB 2GOXA 4V1SA 2ZISB 4GTOB 1JCQB 3SFYB 1N95B 1JCRB 1O6QA 3E32B 1O1RB 3Q73B 2V8IA 3CU7A 1TNZB 1TN8B 3E30B 4YDEB 4D94A 4EHMB 2H6FB 4GTTB 2V3PA 1GXMA 1O1TB 1D8EB 3Q7AB 1GHQA 4D4CA 1N4QB 2ZIRB 2G02A 4GTQB 2V8JA 1FT1B 2BB6A 1H3AA 4LNVA 1O1SB 2R2LB 4ZRPA 3KLSA 2BB5A 3PZ3B 1SQCA 3HXDB 1W6KA 2H6HB 4D4BA
chains in the Genus database with same CATH superfamily
3GZKA 2Q1FA 1WU6A 3P5PA 1TNUB 4F13A 1K72A 3RRSA 3EU8A 1F1SA 4WVCA 4GTSB 1HXGA 2B39A 1RW9A 1G9GA 2EAEA 3HXCB 1UT9A 1LXKA 2H6GB 3DSUB 1W6JA 4MBGB 3SDQA 4V1RA 1WZZA 2J5CA 1LD7B 3QT3A 3ANIA 2XFGA 2FUQA 1WU4A 2DRRA 2PMVA 5EAUA 3S4DA 2WINB 2D5JA 1HMWA 4OK2A 3PZ1B 2PN5A 2V8KA 5ILJA 1V5DA 3QFYA 4YDOB 1HZFA 1DCEB 5IL3A 4ONTA 1GAIA 4L0GA 1L1YA 1H12A 2XQWA 3EUVB 1N4SB 4KKIA 5IK6A 1H14A 3HXBB 2BRPA 1G9JA 2IEJB 1UG9A 3RJ3A 4ZH1A 3QWTA 1FP3A 3Q75B 5DGRA 4L6XA 5FO8B 2B4FA 4KTRA 3P2CA 2RGKA 1KZPB 2VN4A 5FOBB 2A8ZA 3VXDA 4WU0A 5KKBA 1LF9A 2WDAA 2Z07A 3RSYA 1DOGA 3M78A 1IS9A 1N4PB 3M7CA 2P0VA 3W7XA 2DROA 1TN6B 1RWFA 1GXNA 4V1SA 3WIQA 3SFYB 1N1ZA 1JCRB 3WIWA 1N24A 1O1RB 1IA6A 2RI9A 3WC3A 3W7UA 2FBAA 3QDEA 2NVPA 5JMFA 1TN8B 3E6UA 1X9DA 3S4CA 1G87A 1GHQA 5C05A 4AYRA 4D4CA 3PYAA 1OJNA 4LNVA 1G6IA 4FNVA 5IK9A 4JJJA 3WKGA 4CJ1A 1V7XA 3GLYA 5JPNB 1N23A 2BEDB 3EZ8A 2A73B 3W7WA 3M75A 1HV6A 3A3VA 2FV0A 5DGQA 5ILZA 1GXOA 1NL4B 3G4DA 1CEMA 1OJMA 1N7OA 2X03A 1D8DB 1HN0A 3E33B 3G6JB 3M76A 3Q78B 1C3DA 3M72A 3KSLB 4DOEA 5CD2A 3QT9A 4RNQA 2OKXA 3M74A 1TNYB 2V3NA 3Q79B 4KTPA 1S64B 3ANKA 3W7SA 5IKHA 1X81B 1HCUA 3W5MA 3N0GA 2ONHA 4YCRA 1JCSB 5JMDA 1RWAA 5ILYA 4LNBB 1H3CA 1HXAA 3N0FA 1GAHA 4GTVB 1FO2A 3SQCA 3WKHA 3SDUA 3M01A 4ZRQA 2AHGA 4GAXA 3QXQA 1H36A 1I8QA 1KFGA 2BBCA 2GH4A 3DSWB 3DRAB 3EU5B 3M73A 3QSPA 1KREA 4D4DA 2FV1A 2BRVX 2E24A 3WKFA 4LNGB 1H35A 2BRWA 3E37B 4DODA 1NXCA 1KSDA 4GL3A 1H37A 3RX5A 1N7PA 3QFZA 2ZISB 1N20A 3W7TA 5CA3A 3SAEA 1N22A 5GZKA 2WYNA 1KRFA 1DL2A 3PMMA 1NC5A 3EQAA 1RWHA 3AFLA 3Q7AB 1N4QB 3ON6A 4XUVA 1HM3A 4FJQA 2V8JA 2BB6A 2D8LA 1GA2A 1H3AA 1O1SB 5E2JA 1HX9A 1N21A 3PZ3B 3HXDB 3E73A 2H6HB 3S9VA 2EABA 4FXGB 1AYXA 1L2AA 1QSJA 4EL8A 1V7VA 3W5NA 5M7YA 1LD8B 3S4AA 1HMUA 3SDRA 1O6HA 4OK4A 1FPPB 1H13A 2JF4A 5IL8A 1C82A 1FBOA 1N7NA 3WIRA 3G4FA 1JS4A 4MU9A 2ZBLA 4OJZA 1J0MA 3M00A 3OEDA 1W3YA 3VSMA 3ANJA 2WIIB 4OZWA 4M76A 3M77A 2XWJB 3Q7FB 5IKAA 5EATA 1GSZA 1FAEA 4FXKB 3VW5A 5IM1A 3H3KA 1KWFA 4AYPA 3M7EA 3GT5A 2NOJA 1TNBB 3DSXB 4BOKA 3D5RA 4Q88A 3RX7A 4D4AA 3NNBA 4L9PB 1O5MB 4C1SA 4NEIA 2EACA 3QPFA 2FUZA 5JPMB 2GZ6A 1H3BA 3A0OA 1V5CA 1X1HA 1HXCA 5GY3A 1FCEA 1RQ5A 4GTRB 4KKJA 3PZ2B 1F9GA 2E22A 1O6RA 3DSSB 3P5RA 1HM2A 2YIKA 1KKTA 4LIXA 3SDVA 3TF4A 3LZ9A 1XW2A 2I07B 2WCOA 3PZ4B 1H39A 1LXMA 1N4RB 3VSNA 2JG0A 1CB8A 3E7JA 4CJ0A 1F9DA 1WU5A 2XWBB 1MZCB 3WKIA 1R76A 1RWGA 1KS8A 1FMIA 3M7LA 3M71A 1O6QA 3E32B 3Q73B 3QRYA 2V8IA 1FBWA 3QXFA 4CE7A 4YDEB 1X1JA 2AFAA 1N7QA 4Q2BA 1O1TB 1D8EB 2ZIRB 4Z4LA 4WVAA 2R2LB 4ZRPA 2EADA 3KLSA 4TXTA 3PYBA 4QT9A 1W6KA 4D4BA 1O79A 4AYQA 1J0NA 2CQTA 1GLMA 4GTPB 1SA4B 3RX8A 2FUTA 3K7XA 1N9AB 5FO7B 4BOJA 5DHIA 3KSQB 2RI8A 5ILHA 3X17A 3T33A 1QQFA 2G0DA 1KZOB 5DHKA 1N7RA 3DPYB 1TN7B 1QBQB 3M02A 3D5SA 2CQSA 1TF4A 2DRQA 1UMPA 1S63B 5EASA 3DSTB 2F6DA 4WVBA 3CIHA 1V7WA 3K11A 1EGUA 1AGMA 4J5TA 1OJPA 5GW7A 3OXUA 1OJOA 3QG0A 2WY7A 4Z4JA 3KQ4A 1SA5B 3D3IA 2F0YB 5M7IA 3ACTA 3HXFB 1N94B 2QNOA 3M7BA 4FUSA 2JJBA 5AGDA 1FT2B 4ZH5A 3S4BA 1FO3A 2WY8A 1XWQA 2SQCA 1TNOB 1LOHA 1CLCA 1IA7A 2ONGA 3RENA 3SFXB 1VD5A 2AHFA 4OZVA 2H6IB 4GTMB 5MEHA 4ZG8A 1NI1B 3DSVB 3E34B 5FO9B 4TF4A 5CZLA 3C72B 1X1IA 3AFJA 3HXEB 4MMHA 2DRSA 1QAZA 1XWTA 1RWCA 2ZZRA 3SDTA 1LTXB 2GOXA 5IK0A 4GTOB 1JCQB 1N95B 4F10A 5ILIA 3CU7A 4E1YA 1KSCA 4DI5A 3H7LA 1F9OA 1TNZB 4D94A 3E30B 4EHMB 2H6FB 3NFVA 2VN7A 4GTTB 2V3PA 1ULVA 1GXMA 5ILKA 1N1BA 4MMIA 1LF6A 3H2WA 2G02A 4GTQB 5ILDA 1FT1B 3WUXA 3ACSA 3E80A 4AYOA 2BB5A 1SQCA 1H54A
chains in the Genus database with same CATH topology
3GZKA 1WU6A 3P5PA 1TNUB 1K72A 3RRSA 3EU8A 4WVCA 4GTSB 2B39A 1G9GA 2EAEA 3HXCB 1UT9A 3DSUB 2H6GB 1W6JA 4MBGB 3SDQA 4V1RA 1WZZA 1LD7B 3QT3A 3ANIA 2XFGA 1WU4A 2DRRA 2PMVA 3S4DA 2WINB 2D5JA 3PZ1B 2PN5A 2V8KA 1V5DA 3QFYA 4YDOB 1HZFA 1DCEB 4ONTA 1GAIA 4L0GA 1L1YA 1H12A 2XQWA 3EUVB 1N4SB 4KKIA 1H14A 3HXBB 1G9JA 2IEJB 1UG9A 3RJ3A 4ZH1A 3QWTA 1FP3A 3Q75B 5DGRA 4L6XA 5FO8B 2B4FA 4KTRA 3P2CA 2RGKA 1KZPB 2VN4A 5FOBB 2A8ZA 3VXDA 4WU0A 5KKBA 1LF9A 2Z07A 3RSYA 1DOGA 3M78A 1IS9A 1N4PB 3M7CA 2P0VA 3W7XA 2DROA 1TN6B 1GXNA 4V1SA 3WIQA 3SFYB 1JCRB 3WIWA 1O1RB 1IA6A 2RI9A 3WC3A 3W7UA 2FBAA 3QDEA 2NVPA 1TN8B 3E6UA 1X9DA 3S4CA 1G87A 1GHQA 4D4CA 4AYRA 3PYAA 4LNVA 1G6IA 4JJJA 3WKGA 4CJ1A 1V7XA 3GLYA 5JPNB 2BEDB 3EZ8A 2A73B 3W7WA 3M75A 3A3VA 2FV0A 5DGQA 1GXOA 1NL4B 1CEMA 1D8DB 3E33B 3G6JB 3M76A 3Q78B 1C3DA 3M72A 3KSLB 4DOEA 5CD2A 3QT9A 2OKXA 3M74A 1TNYB 2V3NA 3Q79B 4KTPA 1S64B 3ANKA 3W7SA 1X81B 1HCUA 3W5MA 4YCRA 1JCSB 4LNBB 1H3CA 1GAHA 4GTVB 1FO2A 3SQCA 3WKHA 3SDUA 4ZRQA 2AHGA 3QXQA 1H36A 1KFGA 2BBCA 2GH4A 3DSWB 3DRAB 3EU5B 3M73A 3QSPA 1KREA 4D4DA 2FV1A 3WKFA 4LNGB 1H35A 3E37B 4DODA 1NXCA 1KSDA 4GL3A 1H37A 3RX5A 3QFZA 2ZISB 3W7TA 5CA3A 3SAEA 5GZKA 2WYNA 1KRFA 1DL2A 3PMMA 1NC5A 3EQAA 3Q7AB 1N4QB 3ON6A 4XUVA 2V8JA 2BB6A 2D8LA 1GA2A 1H3AA 1O1SB 5E2JA 3PZ3B 3HXDB 3E73A 2H6HB 3S9VA 2EABA 4FXGB 1AYXA 1L2AA 1QSJA 4EL8A 1V7VA 3W5NA 5M7YA 1LD8B 3S4AA 3SDRA 1O6HA 1FPPB 1H13A 2JF4A 1FBOA 3WIRA 1JS4A 4MU9A 2ZBLA 3OEDA 3ANJA 2WIIB 4M76A 3M77A 2XWJB 3Q7FB 1GSZA 1FAEA 4FXKB 3VW5A 3H3KA 1KWFA 4AYPA 3M7EA 3GT5A 2NOJA 1TNBB 3DSXB 4BOKA 3D5RA 4Q88A 3RX7A 4D4AA 4L9PB 1O5MB 4C1SA 2EACA 3QPFA 2FUZA 5JPMB 2GZ6A 1H3BA 1V5CA 5GY3A 1FCEA 1RQ5A 4GTRB 4KKJA 3PZ2B 1O6RA 3DSSB 3P5RA 2YIKA 1KKTA 4LIXA 3SDVA 3TF4A 1XW2A 2I07B 3PZ4B 1H39A 1N4RB 2JG0A 4CJ0A 1F9DA 1WU5A 2XWBB 1MZCB 3WKIA 1R76A 1KS8A 1FMIA 3M7LA 3M71A 1O6QA 3E32B 3Q73B 3QRYA 2V8IA 1FBWA 3QXFA 4CE7A 4YDEB 2AFAA 4Q2BA 1O1TB 1D8EB 2ZIRB 4Z4LA 4WVAA 2R2LB 4ZRPA 2EADA 3KLSA 4TXTA 3PYBA 4QT9A 1W6KA 4D4BA 1O79A 4AYQA 2CQTA 1GLMA 4GTPB 1SA4B 3RX8A 3K7XA 1N9AB 5FO7B 4BOJA 3KSQB 2RI8A 3X17A 3T33A 1QQFA 2G0DA 1KZOB 3DPYB 1TN7B 1QBQB 3D5SA 2CQSA 1TF4A 2DRQA 1UMPA 1S63B 3DSTB 2F6DA 4WVBA 3CIHA 1V7WA 3K11A 1AGMA 4J5TA 5GW7A 3OXUA 3QG0A 2WY7A 4Z4JA 3KQ4A 1SA5B 3D3IA 2F0YB 5M7IA 3ACTA 3HXFB 1N94B 2QNOA 3M7BA 4FUSA 2JJBA 5AGDA 1FT2B 4ZH5A 3S4BA 1FO3A 2WY8A 1XWQA 2SQCA 1TNOB 1CLCA 1IA7A 3RENA 3SFXB 1VD5A 2AHFA 2H6IB 4GTMB 5MEHA 4ZG8A 1NI1B 3DSVB 3E34B 5FO9B 4TF4A 5CZLA 3C72B 3AFJA 3HXEB 2DRSA 1XWTA 2ZZRA 3SDTA 1LTXB 2GOXA 4GTOB 1JCQB 1N95B 3CU7A 1KSCA 3H7LA 1F9OA 1TNZB 4D94A 3E30B 4EHMB 2H6FB 2VN7A 4GTTB 2V3PA 1ULVA 1GXMA 1LF6A 3H2WA 2G02A 4GTQB 1FT1B 3WUXA 3ACSA 4AYOA 2BB5A 1SQCA 1H54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O79 A;  4FXG B;  1QSJ A;  5JPN B;  2BED B;  4GTP B;  2A73 B;  1SA4 B;  1LD8 B;  3K7X A;  1N9A B;  5FO7 B;  4BOJ A;  1TNU B;  1GXO A;  1O6H A;  1NL4 B;  1FPP B;  3KSQ B;  4MU9 A;  1D8D B;  3E33 B;  3G6J B;  3Q78 B;  4GTS B;  1C3D A;  1QQF A;  2G0D A;  1KZO B;  2B39 A;  3KSL B;  3OED A;  3DPY B;  3HXC B;  1TN7 B;  1QBQ B;  3DSU B;  2H6G B;  2WII B;  1TNY B;  1W6J A;  2V3N A;  3D5S A;  4MBG B;  4M76 A;  3Q79 B;  4V1R A;  1S64 B;  2XWJ B;  3Q7F B;  1LD7 B;  1UMP A;  1S63 B;  3DST B;  1GSZ A;  1X81 B;  4FXK B;  2PMV A;  2WIN B;  1JCS B;  2NOJ A;  3OXU A;  4LNB B;  1TNB B;  1H3C A;  2PN5 A;  2V8K A;  2WY7 A;  3DSX B;  3PZ1 B;  4YDO B;  1HZF A;  1DCE B;  4BOK A;  3D5R A;  4ONT A;  4GTV B;  4D4A A;  3SQC A;  3KQ4 A;  1SA5 B;  2F0Y B;  4L9P B;  1O5M B;  2XQW A;  4ZRQ A;  3EUV B;  4C1S A;  3HXF B;  1N4S B;  1N94 B;  4KKI A;  3HXB B;  2IEJ B;  5JPM B;  5AGD A;  1FT2 B;  1H36 A;  1H3B A;  3RJ3 A;  4ZH1 A;  3Q75 B;  2BBC A;  2WY8 A;  3DSW B;  3DRA B;  5FO8 B;  2SQC A;  3EU5 B;  4GTR B;  1TNO B;  3PZ2 B;  4KKJ A;  1O6R A;  3DSS B;  3SFX B;  1KZP B;  4D4D A;  2H6I B;  4GTM B;  5FOB B;  1NI1 B;  3DSV B;  2I07 B;  3E34 B;  3PZ4 B;  4LNG B;  1H35 A;  3E37 B;  5FO9 B;  1H39 A;  1N4R B;  3C72 B;  3HXE B;  1H37 A;  1N4P B;  2XWB B;  1MZC B;  1TN6 B;  1R76 A;  1GXN A;  1LTX B;  2GOX A;  4V1S A;  2ZIS B;  4GTO B;  1JCQ B;  3SFY B;  1N95 B;  1JCR B;  1O6Q A;  3E32 B;  1O1R B;  3Q73 B;  2V8I A;  3CU7 A;  1TNZ B;  1TN8 B;  3E30 B;  4YDE B;  4D94 A;  4EHM B;  2H6F B;  4GTT B;  2V3P A;  1GXM A;  1O1T B;  1D8E B;  3Q7A B;  1GHQ A;  4D4C A;  1N4Q B;  2ZIR B;  2G02 A;  4GTQ B;  2V8J A;  1FT1 B;  2BB6 A;  1H3A A;  4LNV A;  1O1S B;  2R2L B;  4ZRP A;  3KLS A;  2BB5 A;  3PZ3 B;  1SQC A;  3HXD B;  1W6K A;  2H6H B;  4D4B A; 
#chains in the Genus database with same CATH topology
 3GZK A;  2Q1F A;  1WU6 A;  3P5P A;  1TNU B;  4F13 A;  1K72 A;  3RRS A;  3EU8 A;  1F1S A;  4WVC A;  4GTS B;  1HXG A;  2B39 A;  1RW9 A;  1G9G A;  2EAE A;  3HXC B;  1UT9 A;  1LXK A;  2H6G B;  3DSU B;  1W6J A;  4MBG B;  3SDQ A;  4V1R A;  1WZZ A;  2J5C A;  1LD7 B;  3QT3 A;  3ANI A;  2XFG A;  2FUQ A;  1WU4 A;  2DRR A;  2PMV A;  5EAU A;  3S4D A;  2WIN B;  2D5J A;  1HMW A;  4OK2 A;  3PZ1 B;  2PN5 A;  2V8K A;  5ILJ A;  1V5D A;  3QFY A;  4YDO B;  1HZF A;  1DCE B;  5IL3 A;  4ONT A;  1GAI A;  4L0G A;  1L1Y A;  1H12 A;  2XQW A;  3EUV B;  1N4S B;  4KKI A;  5IK6 A;  1H14 A;  3HXB B;  2BRP A;  1G9J A;  2IEJ B;  1UG9 A;  3RJ3 A;  4ZH1 A;  3QWT A;  1FP3 A;  3Q75 B;  5DGR A;  4L6X A;  5FO8 B;  2B4F A;  4KTR A;  3P2C A;  2RGK A;  1KZP B;  2VN4 A;  5FOB B;  2A8Z A;  3VXD A;  4WU0 A;  5KKB A;  1LF9 A;  2WDA A;  2Z07 A;  3RSY A;  1DOG A;  3M78 A;  1IS9 A;  1N4P B;  3M7C A;  2P0V A;  3W7X A;  2DRO A;  1TN6 B;  1RWF A;  1GXN A;  4V1S A;  3WIQ A;  3SFY B;  1N1Z A;  1JCR B;  3WIW A;  1N24 A;  1O1R B;  1IA6 A;  2RI9 A;  3WC3 A;  3W7U A;  2FBA A;  3QDE A;  2NVP A;  5JMF A;  1TN8 B;  3E6U A;  1X9D A;  3S4C A;  1G87 A;  1GHQ A;  5C05 A;  4AYR A;  4D4C A;  3PYA A;  1OJN A;  4LNV A;  1G6I A;  4FNV A;  5IK9 A;  4JJJ A;  3WKG A;  4CJ1 A;  1V7X A;  3GLY A;  5JPN B;  1N23 A;  2BED B;  3EZ8 A;  2A73 B;  3W7W A;  3M75 A;  1HV6 A;  3A3V A;  2FV0 A;  5DGQ A;  5ILZ A;  1GXO A;  1NL4 B;  3G4D A;  1CEM A;  1OJM A;  1N7O A;  2X03 A;  1D8D B;  1HN0 A;  3E33 B;  3G6J B;  3M76 A;  3Q78 B;  1C3D A;  3M72 A;  3KSL B;  4DOE A;  5CD2 A;  3QT9 A;  4RNQ A;  2OKX A;  3M74 A;  1TNY B;  2V3N A;  3Q79 B;  4KTP A;  1S64 B;  3ANK A;  3W7S A;  5IKH A;  1X81 B;  1HCU A;  3W5M A;  3N0G A;  2ONH A;  4YCR A;  1JCS B;  5JMD A;  1RWA A;  5ILY A;  4LNB B;  1H3C A;  1HXA A;  3N0F A;  1GAH A;  4GTV B;  1FO2 A;  3SQC A;  3WKH A;  3SDU A;  3M01 A;  4ZRQ A;  2AHG A;  4GAX A;  3QXQ A;  1H36 A;  1I8Q A;  1KFG A;  2BBC A;  2GH4 A;  3DSW B;  3DRA B;  3EU5 B;  3M73 A;  3QSP A;  1KRE A;  4D4D A;  2FV1 A;  2BRV X;  2E24 A;  3WKF A;  4LNG B;  1H35 A;  2BRW A;  3E37 B;  4DOD A;  1NXC A;  1KSD A;  4GL3 A;  1H37 A;  3RX5 A;  1N7P A;  3QFZ A;  2ZIS B;  1N20 A;  3W7T A;  5CA3 A;  3SAE A;  1N22 A;  5GZK A;  2WYN A;  1KRF A;  1DL2 A;  3PMM A;  1NC5 A;  3EQA A;  1RWH A;  3AFL A;  3Q7A B;  1N4Q B;  3ON6 A;  4XUV A;  1HM3 A;  4FJQ A;  2V8J A;  2BB6 A;  2D8L A;  1GA2 A;  1H3A A;  1O1S B;  5E2J A;  1HX9 A;  1N21 A;  3PZ3 B;  3HXD B;  3E73 A;  2H6H B;  3S9V A;  2EAB A;  4FXG B;  1AYX A;  1L2A A;  1QSJ A;  4EL8 A;  1V7V A;  3W5N A;  5M7Y A;  1LD8 B;  3S4A A;  1HMU A;  3SDR A;  1O6H A;  4OK4 A;  1FPP B;  1H13 A;  2JF4 A;  5IL8 A;  1C82 A;  1FBO A;  1N7N A;  3WIR A;  3G4F A;  1JS4 A;  4MU9 A;  2ZBL A;  4OJZ A;  1J0M A;  3M00 A;  3OED A;  1W3Y A;  3VSM A;  3ANJ A;  2WII B;  4OZW A;  4M76 A;  3M77 A;  2XWJ B;  3Q7F B;  5IKA A;  5EAT A;  1GSZ A;  1FAE A;  4FXK B;  3VW5 A;  5IM1 A;  3H3K A;  1KWF A;  4AYP A;  3M7E A;  3GT5 A;  2NOJ A;  1TNB B;  3DSX B;  4BOK A;  3D5R A;  4Q88 A;  3RX7 A;  4D4A A;  3NNB A;  4L9P B;  1O5M B;  4C1S A;  4NEI A;  2EAC A;  3QPF A;  2FUZ A;  5JPM B;  2GZ6 A;  1H3B A;  3A0O A;  1V5C A;  1X1H A;  1HXC A;  5GY3 A;  1FCE A;  1RQ5 A;  4GTR B;  4KKJ A;  3PZ2 B;  1F9G A;  2E22 A;  1O6R A;  3DSS B;  3P5R A;  1HM2 A;  2YIK A;  1KKT A;  4LIX A;  3SDV A;  3TF4 A;  3LZ9 A;  1XW2 A;  2I07 B;  2WCO A;  3PZ4 B;  1H39 A;  1LXM A;  1N4R B;  3VSN A;  2JG0 A;  1CB8 A;  3E7J A;  4CJ0 A;  1F9D A;  1WU5 A;  2XWB B;  1MZC B;  3WKI A;  1R76 A;  1RWG A;  1KS8 A;  1FMI A;  3M7L A;  3M71 A;  1O6Q A;  3E32 B;  3Q73 B;  3QRY A;  2V8I A;  1FBW A;  3QXF A;  4CE7 A;  4YDE B;  1X1J A;  2AFA A;  1N7Q A;  4Q2B A;  1O1T B;  1D8E B;  2ZIR B;  4Z4L A;  4WVA A;  2R2L B;  4ZRP A;  2EAD A;  3KLS A;  4TXT A;  3PYB A;  4QT9 A;  1W6K A;  4D4B A;  1O79 A;  4AYQ A;  1J0N A;  2CQT A;  1GLM A;  4GTP B;  1SA4 B;  3RX8 A;  2FUT A;  3K7X A;  1N9A B;  5FO7 B;  4BOJ A;  5DHI A;  3KSQ B;  2RI8 A;  5ILH A;  3X17 A;  3T33 A;  1QQF A;  2G0D A;  1KZO B;  5DHK A;  1N7R A;  3DPY B;  1TN7 B;  1QBQ B;  3M02 A;  3D5S A;  2CQS A;  1TF4 A;  2DRQ A;  1UMP A;  1S63 B;  5EAS A;  3DST B;  2F6D A;  4WVB A;  3CIH A;  1V7W A;  3K11 A;  1EGU A;  1AGM A;  4J5T A;  1OJP A;  5GW7 A;  3OXU A;  1OJO A;  3QG0 A;  2WY7 A;  4Z4J A;  3KQ4 A;  1SA5 B;  3D3I A;  2F0Y B;  5M7I A;  3ACT A;  3HXF B;  1N94 B;  2QNO A;  3M7B A;  4FUS A;  2JJB A;  5AGD A;  1FT2 B;  4ZH5 A;  3S4B A;  1FO3 A;  2WY8 A;  1XWQ A;  2SQC A;  1TNO B;  1LOH A;  1CLC A;  1IA7 A;  2ONG A;  3REN A;  3SFX B;  1VD5 A;  2AHF A;  4OZV A;  2H6I B;  4GTM B;  5MEH A;  4ZG8 A;  1NI1 B;  3DSV B;  3E34 B;  5FO9 B;  4TF4 A;  5CZL A;  3C72 B;  1X1I A;  3AFJ A;  3HXE B;  4MMH A;  2DRS A;  1QAZ A;  1XWT A;  1RWC A;  2ZZR A;  3SDT A;  1LTX B;  2GOX A;  5IK0 A;  4GTO B;  1JCQ B;  1N95 B;  4F10 A;  5ILI A;  3CU7 A;  4E1Y A;  1KSC A;  4DI5 A;  3H7L A;  1F9O A;  1TNZ B;  4D94 A;  3E30 B;  4EHM B;  2H6F B;  3NFV A;  2VN7 A;  4GTT B;  2V3P A;  1ULV A;  1GXM A;  5ILK A;  1N1B A;  4MMI A;  1LF6 A;  3H2W A;  2G02 A;  4GTQ B;  5ILD A;  1FT1 B;  3WUX A;  3ACS A;  3E80 A;  4AYO A;  2BB5 A;  1SQC A;  1H54 A; 
#chains in the Genus database with same CATH homology
 3GZK A;  1WU6 A;  3P5P A;  1TNU B;  1K72 A;  3RRS A;  3EU8 A;  4WVC A;  4GTS B;  2B39 A;  1G9G A;  2EAE A;  3HXC B;  1UT9 A;  3DSU B;  2H6G B;  1W6J A;  4MBG B;  3SDQ A;  4V1R A;  1WZZ A;  1LD7 B;  3QT3 A;  3ANI A;  2XFG A;  1WU4 A;  2DRR A;  2PMV A;  3S4D A;  2WIN B;  2D5J A;  3PZ1 B;  2PN5 A;  2V8K A;  1V5D A;  3QFY A;  4YDO B;  1HZF A;  1DCE B;  4ONT A;  1GAI A;  4L0G A;  1L1Y A;  1H12 A;  2XQW A;  3EUV B;  1N4S B;  4KKI A;  1H14 A;  3HXB B;  1G9J A;  2IEJ B;  1UG9 A;  3RJ3 A;  4ZH1 A;  3QWT A;  1FP3 A;  3Q75 B;  5DGR A;  4L6X A;  5FO8 B;  2B4F A;  4KTR A;  3P2C A;  2RGK A;  1KZP B;  2VN4 A;  5FOB B;  2A8Z A;  3VXD A;  4WU0 A;  5KKB A;  1LF9 A;  2Z07 A;  3RSY A;  1DOG A;  3M78 A;  1IS9 A;  1N4P B;  3M7C A;  2P0V A;  3W7X A;  2DRO A;  1TN6 B;  1GXN A;  4V1S A;  3WIQ A;  3SFY B;  1JCR B;  3WIW A;  1O1R B;  1IA6 A;  2RI9 A;  3WC3 A;  3W7U A;  2FBA A;  3QDE A;  2NVP A;  1TN8 B;  3E6U A;  1X9D A;  3S4C A;  1G87 A;  1GHQ A;  4D4C A;  4AYR A;  3PYA A;  4LNV A;  1G6I A;  4JJJ A;  3WKG A;  4CJ1 A;  1V7X A;  3GLY A;  5JPN B;  2BED B;  3EZ8 A;  2A73 B;  3W7W A;  3M75 A;  3A3V A;  2FV0 A;  5DGQ A;  1GXO A;  1NL4 B;  1CEM A;  1D8D B;  3E33 B;  3G6J B;  3M76 A;  3Q78 B;  1C3D A;  3M72 A;  3KSL B;  4DOE A;  5CD2 A;  3QT9 A;  2OKX A;  3M74 A;  1TNY B;  2V3N A;  3Q79 B;  4KTP A;  1S64 B;  3ANK A;  3W7S A;  1X81 B;  1HCU A;  3W5M A;  4YCR A;  1JCS B;  4LNB B;  1H3C A;  1GAH A;  4GTV B;  1FO2 A;  3SQC A;  3WKH A;  3SDU A;  4ZRQ A;  2AHG A;  3QXQ A;  1H36 A;  1KFG A;  2BBC A;  2GH4 A;  3DSW B;  3DRA B;  3EU5 B;  3M73 A;  3QSP A;  1KRE A;  4D4D A;  2FV1 A;  3WKF A;  4LNG B;  1H35 A;  3E37 B;  4DOD A;  1NXC A;  1KSD A;  4GL3 A;  1H37 A;  3RX5 A;  3QFZ A;  2ZIS B;  3W7T A;  5CA3 A;  3SAE A;  5GZK A;  2WYN A;  1KRF A;  1DL2 A;  3PMM A;  1NC5 A;  3EQA A;  3Q7A B;  1N4Q B;  3ON6 A;  4XUV A;  2V8J A;  2BB6 A;  2D8L A;  1GA2 A;  1H3A A;  1O1S B;  5E2J A;  3PZ3 B;  3HXD B;  3E73 A;  2H6H B;  3S9V A;  2EAB A;  4FXG B;  1AYX A;  1L2A A;  1QSJ A;  4EL8 A;  1V7V A;  3W5N A;  5M7Y A;  1LD8 B;  3S4A A;  3SDR A;  1O6H A;  1FPP B;  1H13 A;  2JF4 A;  1FBO A;  3WIR A;  1JS4 A;  4MU9 A;  2ZBL A;  3OED A;  3ANJ A;  2WII B;  4M76 A;  3M77 A;  2XWJ B;  3Q7F B;  1GSZ A;  1FAE A;  4FXK B;  3VW5 A;  3H3K A;  1KWF A;  4AYP A;  3M7E A;  3GT5 A;  2NOJ A;  1TNB B;  3DSX B;  4BOK A;  3D5R A;  4Q88 A;  3RX7 A;  4D4A A;  4L9P B;  1O5M B;  4C1S A;  2EAC A;  3QPF A;  2FUZ A;  5JPM B;  2GZ6 A;  1H3B A;  1V5C A;  5GY3 A;  1FCE A;  1RQ5 A;  4GTR B;  4KKJ A;  3PZ2 B;  1O6R A;  3DSS B;  3P5R A;  2YIK A;  1KKT A;  4LIX A;  3SDV A;  3TF4 A;  1XW2 A;  2I07 B;  3PZ4 B;  1H39 A;  1N4R B;  2JG0 A;  4CJ0 A;  1F9D A;  1WU5 A;  2XWB B;  1MZC B;  3WKI A;  1R76 A;  1KS8 A;  1FMI A;  3M7L A;  3M71 A;  1O6Q A;  3E32 B;  3Q73 B;  3QRY A;  2V8I A;  1FBW A;  3QXF A;  4CE7 A;  4YDE B;  2AFA A;  4Q2B A;  1O1T B;  1D8E B;  2ZIR B;  4Z4L A;  4WVA A;  2R2L B;  4ZRP A;  2EAD A;  3KLS A;  4TXT A;  3PYB A;  4QT9 A;  1W6K A;  4D4B A;  1O79 A;  4AYQ A;  2CQT A;  1GLM A;  4GTP B;  1SA4 B;  3RX8 A;  3K7X A;  1N9A B;  5FO7 B;  4BOJ A;  3KSQ B;  2RI8 A;  3X17 A;  3T33 A;  1QQF A;  2G0D A;  1KZO B;  3DPY B;  1TN7 B;  1QBQ B;  3D5S A;  2CQS A;  1TF4 A;  2DRQ A;  1UMP A;  1S63 B;  3DST B;  2F6D A;  4WVB A;  3CIH A;  1V7W A;  3K11 A;  1AGM A;  4J5T A;  5GW7 A;  3OXU A;  3QG0 A;  2WY7 A;  4Z4J A;  3KQ4 A;  1SA5 B;  3D3I A;  2F0Y B;  5M7I A;  3ACT A;  3HXF B;  1N94 B;  2QNO A;  3M7B A;  4FUS A;  2JJB A;  5AGD A;  1FT2 B;  4ZH5 A;  3S4B A;  1FO3 A;  2WY8 A;  1XWQ A;  2SQC A;  1TNO B;  1CLC A;  1IA7 A;  3REN A;  3SFX B;  1VD5 A;  2AHF A;  2H6I B;  4GTM B;  5MEH A;  4ZG8 A;  1NI1 B;  3DSV B;  3E34 B;  5FO9 B;  4TF4 A;  5CZL A;  3C72 B;  3AFJ A;  3HXE B;  2DRS A;  1XWT A;  2ZZR A;  3SDT A;  1LTX B;  2GOX A;  4GTO B;  1JCQ B;  1N95 B;  3CU7 A;  1KSC A;  3H7L A;  1F9O A;  1TNZ B;  4D94 A;  3E30 B;  4EHM B;  2H6F B;  2VN7 A;  4GTT B;  2V3P A;  1ULV A;  1GXM A;  1LF6 A;  3H2W A;  2G02 A;  4GTQ B;  1FT1 B;  3WUX A;  3ACS A;  4AYO A;  2BB5 A;  1SQC A;  1H54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...