4GTTB

Engineered rabggtase in complex with bms analogue 12
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 119
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4gttB00
1N95B 2R2LB 4FXKB 4C1SA 5JPMB 3E37B 1LD8B 1O5MB 1GXOA 4GTPB 4EHMB 2SQCA 1TNYB 1H36A 3DSUB 4FXGB 1DCEB 1C3DA 3DSSB 1O6QA 2GOXA 4YDEB 4ZRPA 3KSQB 2G0DA 4V1SA 1FPPB 3OXUA 3Q79B 1N4PB 3Q75B 4BOKA 2WINB 1SA5B 3HXBB 4GTSB 1QBQB 4D4AA 2V3PA 1S63B 4ZRQA 1O1SB 2BBCA 3Q73B 2H6HB 4M76A 2WY7A 1MZCB 1TNOB 3K7XA 2IEJB 2BEDB 1FT1B 3EUVB 3PZ3B 2ZISB 1SA4B 1S64B 2B39A 4GTVB 3SFYB 4GTQB 3KLSA 4KKIA 5FO7B 1O79A 1TN6B 3OEDA 3D5SA 2WIIB 1FT2B 1LTXB 4MU9A 1D8DB 4D4CA 5FO8B 1JCQB 3G6JB 2G02A 2H6GB 4D4DA 1O6RA 4LNGB 4ONTA 1W6JA 3HXDB 1LD7B 1SQCA 1N94B 2PN5A 1N4QB 3DSWB 3HXCB 3E32B 2BB5A 3Q78B 1QSJA 2WY8A 1TNUB 3DRAB 2V8JA 1GSZA 2PMVA 3HXFB 1O6HA 3C72B 1KZOB 2BB6A 3KSLB 1KZPB 3DSTB 4BOJA 1H37A 2XWJB 3DSXB 2A73B 3E33B 1W6KA 2NOJA 5JPNB 3SQCA 1X81B 1H3CA 1N4RB 1JCSB 1QQFA 1H35A 2XWBB 4LNBB 3KQ4A 2ZIRB 4ZH1A 4L9PB 4KKJA 1TNBB 2H6IB 3PZ1B 3E34B 2I07B 3DSVB 1NI1B 1H3AA 1TNZB 1HZFA 1O1RB 2F0YB 1UMPA 3CU7A 2V8IA 3E30B 3SFXB 4D4BA 1R76A 3PZ4B 1TN7B 1JCRB 3HXEB 1D8EB 4MBGB 3DPYB 1GHQA 1N9AB 1O1TB 4GTTB 4GTRB 4D94A 3Q7FB 2H6FB 3Q7AB 3PZ2B 1TN8B 4GTMB 4GTOB 4LNVA 3RJ3A 2XQWA 2V3NA 4YDOB 5FOBB 4V1RA 2V8KA 5AGDA 3D5RA 5FO9B 1GXMA 1N4SB 1NL4B 1GXNA 3EU5B 1H3BA 1H39A
chains in the Genus database with same CATH superfamily
2R2LB 5ILJA 4MMIA 5JPMB 3E37B 1W3YA 1O5MB 5DHIA 3RRSA 2YIKA 1FBWA 2DRQA 3CIHA 1F9OA 3P2CA 2B4FA 4FXGB 1DCEB 2BRPA 3QSPA 3SDUA 1N1ZA 2GOXA 1N24A 1H12A 4YDEB 2AFAA 2EACA 2P0VA 1N23A 3N0FA 3TF4A 3Q79B 3RENA 2WINB 3QDEA 1QBQB 1LF6A 1X9DA 1QAZA 4D4AA 1UG9A 2V3PA 3RX5A 4ZRQA 1HXAA 1MZCB 2IEJB 4DI5A 1KFGA 2BEDB 3K11A 2ZISB 1SA4B 1S64B 1IS9A 1HCUA 3N0GA 1FBOA 4GTVB 4JJJA 2ONHA 4KKIA 4OK2A 1J0NA 5M7IA 3QT9A 4MU9A 1D8DB 4D4CA 5FO8B 3AFLA 4XUVA 1KRFA 2FUTA 1X1IA 1HM2A 1LD7B 1N94B 2EABA 3HXCB 3E32B 1N1BA 3DRAB 3QRYA 1GSZA 2PMVA 4LIXA 3HXFB 3H3KA 4BOJA 3M72A 2A73B 1X81B 5ILKA 2XWBB 1G9JA 1JCSB 1QQFA 1H35A 1DOGA 2ONGA 2ZIRB 4CE7A 3W7WA 3G4FA 1TNBB 2H6IB 3E34B 5GZKA 1NI1B 1TNZB 2RGKA 1O1RB 3QFYA 3E7JA 1FP3A 2FUZA 1UMPA 3W7UA 1FO3A 1XWTA 1TN7B 5EASA 5ILYA 4GTTB 4GTRB 2ZBLA 1LXMA 3Q7FB 1WZZA 2J5CA 1N7NA 2RI8A 1TN8B 1I8QA 1V7XA 4GTOB 3RSYA 4MMHA 3GLYA 3S4BA 2Q1FA 5GW7A 4KTRA 1KSDA 3VXDA 4V1RA 5AGDA 3D5RA 1DL2A 1N4SB 4L6XA 1H3BA 1N95B 3GT5A 5ILDA 2GZ6A 2FBAA 1LXKA 3M7BA 3EU8A 3G4DA 4GTPB 1V5DA 3W7TA 2SQCA 1TNYB 1XWQA 2BRWA 4AYQA 3VSMA 1H13A 3QXQA 1C3DA 3GZKA 1F9DA 4OZVA 4Q2BA 4TF4A 3OXUA 3ANIA 1N21A 5IK0A 1HN0A 1N7RA 3E6UA 1H14A 3W7SA 1O1SB 2H6HB 4M76A 2D8LA 2WY7A 4TXTA 1FT1B 1EGUA 5DGRA 3H2WA 1CLCA 4FNVA 4WVAA 3SDVA 3KLSA 1O79A 1TN6B 3S4DA 2DROA 3QFZA 3D5SA 2WIIB 1FT2B 2QNOA 2RI9A 4LNGB 4ONTA 3WC3A 1SQCA 1IA6A 2F6DA 3DSWB 2X03A 4GL3A 2BB5A 3Q78B 4WVBA 2WY8A 1TF4A 2V8JA 1GAIA 3C72B 1GLMA 2BB6A 3LZ9A 5IL3A 3PYAA 1HXCA 3P5RA 2GH4A 1KREA 1H37A 2XWJB 3WKGA 3E33B 2D5JA 5CZLA 2JJBA 3M76A 4L9PB 4KKJA 2I07B 1K72A 4WVCA 3E30B 4D4BA 1R76A 1D8EB 1HMWA 3DPYB 1O1TB 1WU4A 3RX7A 3M02A 3Q7AB 4Z4JA 3ACTA 2AHFA 1G87A 2CQTA 2DRSA 5DHKA 3QPFA 5JMDA 4LNVA 3M71A 5M7YA 3X17A 4AYRA 1N20A 4YDOB 2Z07A 3AFJA 2WYNA 4FXKB 3M7CA 2CQSA 1JS4A 1KSCA 1GXOA 3SAEA 4E1YA 1RWGA 4DOEA 1RWHA 3W5MA 1FCEA 4EHMB 3WUXA 1L2AA 3ON6A 1H36A 5IKAA 1N22A 3DSUB 1HX9A 3M7LA 4OZWA 1O6QA 1NC5A 5C05A 3S4AA 4ZRPA 3S9VA 2EADA 1N7PA 4BOKA 1SA5B 1KWFA 4GTSB 3WKIA 1J0MA 2JG0A 2BBCA 1FO2A 5JMFA 1TNOB 3K7XA 1VD5A 1AYXA 3PZ3B 1F1SA 1H54A 2B39A 1LF9A 2EAEA 1GAHA 4QT9A 1WU6A 3SFYB 3NNBA 1GA2A 5ILIA 3SDTA 1LTXB 4AYPA 3VW5A 3G6JB 4GAXA 2G02A 2H6GB 4D4DA 4CJ1A 1O6RA 5ILZA 1W6JA 3HXDB 4FUSA 2PN5A 5IK6A 3PYBA 1O6HA 1KZOB 3KSLB 3SDRA 3DSTB 3S4CA 3EQAA 3M74A 3WKHA 2FV1A 5CD2A 3NFVA 5JPNB 3SQCA 1H3CA 4LNBB 3WIWA 3KQ4A 4ZH1A 1HV6A 1FAEA 3VSNA 3PZ1B 1OJPA 1RQ5A 1H3AA 4NEIA 2XFGA 4Z4LA 1AGMA 2NVPA 2BRVX 3CU7A 1IA7A 3E80A 2JF4A 2E24A 3SFXB 3PZ4B 1JCRB 1HMUA 1ULVA 2FV0A 3HXEB 4OK4A 1HM3A 4D94A 2OKXA 1HXGA 2H6FB 2AHGA 3PZ2B 1FMIA 5IKHA 4GTMB 5GY3A 4ZH5A 5EATA 4Q88A 1N7OA 3RJ3A 2V3NA 2DRRA 5FOBB 1V7WA 2V8KA 1V5CA 4OJZA 5FO9B 1F9GA 1GXMA 1OJMA 1UT9A 2VN7A 3W5NA 4FJQA 3M00A 1GXNA 4EL8A 3P5PA 3PMMA 4C1SA 3H7LA 3WIQA 1LD8B 3M77A 3WKFA 1WU5A 1G6IA 1RWFA 2A8ZA 3M75A 5DGQA 2VN4A 2ZZRA 1N7QA 3DSSB 1G9GA 3T33A 3KSQB 2G0DA 4V1SA 1FPPB 3M78A 4YCRA 3EZ8A 4L0GA 3QWTA 1N4PB 3Q75B 1OJNA 3HXBB 4DODA 1KKTA 3WIRA 1S63B 3Q73B 4ZG8A 3M7EA 3SDQA 2WDAA 1V7VA 3EUVB 1LOHA 4GTQB 5FO7B 3QXFA 3OEDA 4RNQA 1JCQB 3ANKA 1OJOA 3A3VA 3M73A 1XW2A 3RX8A 5IK9A 1N4QB 3QT3A 1QSJA 1TNUB 1CB8A 3ACSA 4CJ0A 1KZPB 1NXCA 5IL8A 1X1HA 3DSXB 5E2JA 4WU0A 2WCOA 1W6KA 2NOJA 3M01A 1RW9A 1N4RB 5ILHA 5IM1A 3W7XA 1X1JA 5KKBA 3DSVB 5EAUA 1CEMA 1HZFA 3A0OA 4F10A 2F0YB 4KTPA 1C82A 2E22A 2V8IA 3E73A 3QG0A 4AYOA 4F13A 4MBGB 1GHQA 1N9AB 1RWAA 3ANJA 2FUQA 4J5TA 5CA3A 1KS8A 2XQWA 5MEHA 1RWCA 3D3IA 1L1YA 1NL4B 3EU5B 1H39A
chains in the Genus database with same CATH topology
2R2LB 5JPMB 3E37B 1O5MB 3RRSA 2YIKA 1FBWA 2DRQA 3CIHA 1F9OA 3P2CA 2B4FA 4FXGB 1DCEB 3QSPA 3SDUA 2GOXA 1H12A 4YDEB 2AFAA 2EACA 2P0VA 3TF4A 3Q79B 3RENA 2WINB 3QDEA 1QBQB 1LF6A 1X9DA 4D4AA 1UG9A 2V3PA 3RX5A 4ZRQA 1MZCB 2IEJB 1KFGA 2BEDB 3K11A 2ZISB 1SA4B 1S64B 1IS9A 1HCUA 1FBOA 4GTVB 4JJJA 4KKIA 5M7IA 3QT9A 4MU9A 1D8DB 4D4CA 5FO8B 4XUVA 1KRFA 1LD7B 1N94B 2EABA 3HXCB 3E32B 3DRAB 3QRYA 1GSZA 2PMVA 4LIXA 3HXFB 3H3KA 4BOJA 3M72A 2A73B 1X81B 1G9JA 1QQFA 1JCSB 2XWBB 1H35A 1DOGA 2ZIRB 4CE7A 3W7WA 1TNBB 2H6IB 3E34B 5GZKA 1NI1B 1TNZB 2RGKA 1O1RB 3QFYA 1FP3A 2FUZA 1UMPA 3W7UA 1FO3A 1XWTA 1TN7B 4GTTB 4GTRB 2ZBLA 3Q7FB 1WZZA 2RI8A 1TN8B 1V7XA 4GTOB 3RSYA 3GLYA 3S4BA 5GW7A 4KTRA 1KSDA 3VXDA 4V1RA 5AGDA 3D5RA 1DL2A 1N4SB 4L6XA 1H3BA 1N95B 3GT5A 2GZ6A 2FBAA 3M7BA 3EU8A 4GTPB 1V5DA 3W7TA 2SQCA 1TNYB 1XWQA 4AYQA 1H13A 3QXQA 1C3DA 3GZKA 1F9DA 4Q2BA 4TF4A 3OXUA 3ANIA 3E6UA 1H14A 3W7SA 1O1SB 2H6HB 4M76A 2D8LA 2WY7A 4TXTA 1FT1B 5DGRA 3H2WA 1CLCA 4WVAA 3SDVA 3KLSA 1O79A 1TN6B 3S4DA 2DROA 3QFZA 3D5SA 2WIIB 1FT2B 2QNOA 2RI9A 4LNGB 4ONTA 3WC3A 1SQCA 1IA6A 2F6DA 3DSWB 4GL3A 2BB5A 3Q78B 4WVBA 2WY8A 1TF4A 2V8JA 1GAIA 3C72B 1GLMA 2BB6A 3PYAA 3P5RA 2GH4A 1KREA 1H37A 2XWJB 3WKGA 3E33B 2D5JA 5CZLA 2JJBA 3M76A 4L9PB 4KKJA 2I07B 1K72A 4WVCA 3E30B 4D4BA 1R76A 1D8EB 3DPYB 1O1TB 1WU4A 3RX7A 3Q7AB 4Z4JA 2AHFA 3ACTA 1G87A 2CQTA 2DRSA 3QPFA 4LNVA 3M71A 5M7YA 3X17A 4AYRA 4YDOB 2Z07A 3AFJA 2WYNA 4FXKB 3M7CA 2CQSA 1JS4A 1KSCA 1GXOA 3SAEA 4DOEA 3W5MA 1FCEA 4EHMB 3WUXA 1L2AA 3ON6A 1H36A 3DSUB 3M7LA 1O6QA 1NC5A 3S4AA 4ZRPA 3S9VA 2EADA 4BOKA 1SA5B 1KWFA 4GTSB 3WKIA 2JG0A 2BBCA 1FO2A 1TNOB 3K7XA 1VD5A 1AYXA 3PZ3B 1H54A 2B39A 1LF9A 2EAEA 1GAHA 4QT9A 1WU6A 3SFYB 1GA2A 3SDTA 1LTXB 4AYPA 3VW5A 3G6JB 2G02A 2H6GB 4D4DA 4CJ1A 1O6RA 1W6JA 4FUSA 3HXDB 2PN5A 3PYBA 1O6HA 1KZOB 3KSLB 3SDRA 3DSTB 3S4CA 3EQAA 3M74A 3WKHA 2FV1A 5CD2A 5JPNB 3SQCA 1H3CA 4LNBB 3WIWA 3KQ4A 4ZH1A 1FAEA 3PZ1B 1RQ5A 1H3AA 2XFGA 4Z4LA 1AGMA 2NVPA 3CU7A 1IA7A 2JF4A 3SFXB 3PZ4B 1JCRB 3HXEB 1ULVA 2FV0A 4D94A 2OKXA 2H6FB 2AHGA 3PZ2B 1FMIA 4GTMB 5GY3A 4ZH5A 4Q88A 3RJ3A 2V3NA 2DRRA 5FOBB 1V7WA 2V8KA 1V5CA 5FO9B 1GXMA 1UT9A 2VN7A 3W5NA 1GXNA 4EL8A 3P5PA 3PMMA 4C1SA 3H7LA 3WIQA 1LD8B 3M77A 3WKFA 1WU5A 1G6IA 2A8ZA 3M75A 5DGQA 2VN4A 2ZZRA 3DSSB 1G9GA 3T33A 3KSQB 2G0DA 4V1SA 1FPPB 3M78A 4YCRA 3EZ8A 4L0GA 3QWTA 1N4PB 3Q75B 3HXBB 4DODA 1KKTA 3WIRA 1S63B 3Q73B 4ZG8A 3M7EA 3SDQA 3EUVB 1V7VA 4GTQB 5FO7B 3QXFA 3OEDA 1JCQB 3ANKA 3A3VA 3M73A 1XW2A 3RX8A 1N4QB 3QT3A 1QSJA 1TNUB 3ACSA 4CJ0A 1KZPB 1NXCA 3DSXB 5E2JA 4WU0A 1W6KA 2NOJA 1N4RB 3W7XA 5KKBA 3DSVB 1CEMA 1HZFA 2F0YB 4KTPA 2V8IA 3E73A 3QG0A 4AYOA 4MBGB 1GHQA 1N9AB 3ANJA 4J5TA 5CA3A 1KS8A 2XQWA 5MEHA 3D3IA 1L1YA 1NL4B 3EU5B 1H39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N95 B;  2R2L B;  4FXK B;  4C1S A;  5JPM B;  3E37 B;  1LD8 B;  1O5M B;  1GXO A;  4GTP B;  4EHM B;  2SQC A;  1TNY B;  1H36 A;  3DSU B;  4FXG B;  1DCE B;  1C3D A;  3DSS B;  1O6Q A;  2GOX A;  4YDE B;  4ZRP A;  3KSQ B;  2G0D A;  4V1S A;  1FPP B;  3OXU A;  3Q79 B;  1N4P B;  3Q75 B;  4BOK A;  2WIN B;  1SA5 B;  3HXB B;  4GTS B;  1QBQ B;  4D4A A;  2V3P A;  1S63 B;  4ZRQ A;  1O1S B;  2BBC A;  3Q73 B;  2H6H B;  4M76 A;  2WY7 A;  1MZC B;  1TNO B;  3K7X A;  2IEJ B;  2BED B;  1FT1 B;  3EUV B;  3PZ3 B;  2ZIS B;  1SA4 B;  1S64 B;  2B39 A;  4GTV B;  3SFY B;  4GTQ B;  3KLS A;  4KKI A;  5FO7 B;  1O79 A;  1TN6 B;  3OED A;  3D5S A;  2WII B;  1FT2 B;  1LTX B;  4MU9 A;  1D8D B;  4D4C A;  5FO8 B;  1JCQ B;  3G6J B;  2G02 A;  2H6G B;  4D4D A;  1O6R A;  4LNG B;  4ONT A;  1W6J A;  3HXD B;  1LD7 B;  1SQC A;  1N94 B;  2PN5 A;  1N4Q B;  3DSW B;  3HXC B;  3E32 B;  2BB5 A;  3Q78 B;  1QSJ A;  2WY8 A;  1TNU B;  3DRA B;  2V8J A;  1GSZ A;  2PMV A;  3HXF B;  1O6H A;  3C72 B;  1KZO B;  2BB6 A;  3KSL B;  1KZP B;  3DST B;  4BOJ A;  1H37 A;  2XWJ B;  3DSX B;  2A73 B;  3E33 B;  1W6K A;  2NOJ A;  5JPN B;  3SQC A;  1X81 B;  1H3C A;  1N4R B;  1JCS B;  1QQF A;  1H35 A;  2XWB B;  4LNB B;  3KQ4 A;  2ZIR B;  4ZH1 A;  4L9P B;  4KKJ A;  1TNB B;  2H6I B;  3PZ1 B;  3E34 B;  2I07 B;  3DSV B;  1NI1 B;  1H3A A;  1TNZ B;  1HZF A;  1O1R B;  2F0Y B;  1UMP A;  3CU7 A;  2V8I A;  3E30 B;  3SFX B;  4D4B A;  1R76 A;  3PZ4 B;  1TN7 B;  1JCR B;  3HXE B;  1D8E B;  4MBG B;  3DPY B;  1GHQ A;  1N9A B;  1O1T B;  4GTT B;  4GTR B;  4D94 A;  3Q7F B;  2H6F B;  3Q7A B;  3PZ2 B;  1TN8 B;  4GTM B;  4GTO B;  4LNV A;  3RJ3 A;  2XQW A;  2V3N A;  4YDO B;  5FOB B;  4V1R A;  2V8K A;  5AGD A;  3D5R A;  5FO9 B;  1GXM A;  1N4S B;  1NL4 B;  1GXN A;  3EU5 B;  1H3B A;  1H39 A; 
#chains in the Genus database with same CATH topology
 2R2L B;  5ILJ A;  4MMI A;  5JPM B;  3E37 B;  1W3Y A;  1O5M B;  5DHI A;  3RRS A;  2YIK A;  1FBW A;  2DRQ A;  3CIH A;  1F9O A;  3P2C A;  2B4F A;  4FXG B;  1DCE B;  2BRP A;  3QSP A;  3SDU A;  1N1Z A;  2GOX A;  1N24 A;  1H12 A;  4YDE B;  2AFA A;  2EAC A;  2P0V A;  1N23 A;  3N0F A;  3TF4 A;  3Q79 B;  3REN A;  2WIN B;  3QDE A;  1QBQ B;  1LF6 A;  1X9D A;  1QAZ A;  4D4A A;  1UG9 A;  2V3P A;  3RX5 A;  4ZRQ A;  1HXA A;  1MZC B;  2IEJ B;  4DI5 A;  1KFG A;  2BED B;  3K11 A;  2ZIS B;  1SA4 B;  1S64 B;  1IS9 A;  1HCU A;  3N0G A;  1FBO A;  4GTV B;  4JJJ A;  2ONH A;  4KKI A;  4OK2 A;  1J0N A;  5M7I A;  3QT9 A;  4MU9 A;  1D8D B;  4D4C A;  5FO8 B;  3AFL A;  4XUV A;  1KRF A;  2FUT A;  1X1I A;  1HM2 A;  1LD7 B;  1N94 B;  2EAB A;  3HXC B;  3E32 B;  1N1B A;  3DRA B;  3QRY A;  1GSZ A;  2PMV A;  4LIX A;  3HXF B;  3H3K A;  4BOJ A;  3M72 A;  2A73 B;  1X81 B;  5ILK A;  2XWB B;  1G9J A;  1JCS B;  1QQF A;  1H35 A;  1DOG A;  2ONG A;  2ZIR B;  4CE7 A;  3W7W A;  3G4F A;  1TNB B;  2H6I B;  3E34 B;  5GZK A;  1NI1 B;  1TNZ B;  2RGK A;  1O1R B;  3QFY A;  3E7J A;  1FP3 A;  2FUZ A;  1UMP A;  3W7U A;  1FO3 A;  1XWT A;  1TN7 B;  5EAS A;  5ILY A;  4GTT B;  4GTR B;  2ZBL A;  1LXM A;  3Q7F B;  1WZZ A;  2J5C A;  1N7N A;  2RI8 A;  1TN8 B;  1I8Q A;  1V7X A;  4GTO B;  3RSY A;  4MMH A;  3GLY A;  3S4B A;  2Q1F A;  5GW7 A;  4KTR A;  1KSD A;  3VXD A;  4V1R A;  5AGD A;  3D5R A;  1DL2 A;  1N4S B;  4L6X A;  1H3B A;  1N95 B;  3GT5 A;  5ILD A;  2GZ6 A;  2FBA A;  1LXK A;  3M7B A;  3EU8 A;  3G4D A;  4GTP B;  1V5D A;  3W7T A;  2SQC A;  1TNY B;  1XWQ A;  2BRW A;  4AYQ A;  3VSM A;  1H13 A;  3QXQ A;  1C3D A;  3GZK A;  1F9D A;  4OZV A;  4Q2B A;  4TF4 A;  3OXU A;  3ANI A;  1N21 A;  5IK0 A;  1HN0 A;  1N7R A;  3E6U A;  1H14 A;  3W7S A;  1O1S B;  2H6H B;  4M76 A;  2D8L A;  2WY7 A;  4TXT A;  1FT1 B;  1EGU A;  5DGR A;  3H2W A;  1CLC A;  4FNV A;  4WVA A;  3SDV A;  3KLS A;  1O79 A;  1TN6 B;  3S4D A;  2DRO A;  3QFZ A;  3D5S A;  2WII B;  1FT2 B;  2QNO A;  2RI9 A;  4LNG B;  4ONT A;  3WC3 A;  1SQC A;  1IA6 A;  2F6D A;  3DSW B;  2X03 A;  4GL3 A;  2BB5 A;  3Q78 B;  4WVB A;  2WY8 A;  1TF4 A;  2V8J A;  1GAI A;  3C72 B;  1GLM A;  2BB6 A;  3LZ9 A;  5IL3 A;  3PYA A;  1HXC A;  3P5R A;  2GH4 A;  1KRE A;  1H37 A;  2XWJ B;  3WKG A;  3E33 B;  2D5J A;  5CZL A;  2JJB A;  3M76 A;  4L9P B;  4KKJ A;  2I07 B;  1K72 A;  4WVC A;  3E30 B;  4D4B A;  1R76 A;  1D8E B;  1HMW A;  3DPY B;  1O1T B;  1WU4 A;  3RX7 A;  3M02 A;  3Q7A B;  4Z4J A;  3ACT A;  2AHF A;  1G87 A;  2CQT A;  2DRS A;  5DHK A;  3QPF A;  5JMD A;  4LNV A;  3M71 A;  5M7Y A;  3X17 A;  4AYR A;  1N20 A;  4YDO B;  2Z07 A;  3AFJ A;  2WYN A;  4FXK B;  3M7C A;  2CQS A;  1JS4 A;  1KSC A;  1GXO A;  3SAE A;  4E1Y A;  1RWG A;  4DOE A;  1RWH A;  3W5M A;  1FCE A;  4EHM B;  3WUX A;  1L2A A;  3ON6 A;  1H36 A;  5IKA A;  1N22 A;  3DSU B;  1HX9 A;  3M7L A;  4OZW A;  1O6Q A;  1NC5 A;  5C05 A;  3S4A A;  4ZRP A;  3S9V A;  2EAD A;  1N7P A;  4BOK A;  1SA5 B;  1KWF A;  4GTS B;  3WKI A;  1J0M A;  2JG0 A;  2BBC A;  1FO2 A;  5JMF A;  1TNO B;  3K7X A;  1VD5 A;  1AYX A;  3PZ3 B;  1F1S A;  1H54 A;  2B39 A;  1LF9 A;  2EAE A;  1GAH A;  4QT9 A;  1WU6 A;  3SFY B;  3NNB A;  1GA2 A;  5ILI A;  3SDT A;  1LTX B;  4AYP A;  3VW5 A;  3G6J B;  4GAX A;  2G02 A;  2H6G B;  4D4D A;  4CJ1 A;  1O6R A;  5ILZ A;  1W6J A;  3HXD B;  4FUS A;  2PN5 A;  5IK6 A;  3PYB A;  1O6H A;  1KZO B;  3KSL B;  3SDR A;  3DST B;  3S4C A;  3EQA A;  3M74 A;  3WKH A;  2FV1 A;  5CD2 A;  3NFV A;  5JPN B;  3SQC A;  1H3C A;  4LNB B;  3WIW A;  3KQ4 A;  4ZH1 A;  1HV6 A;  1FAE A;  3VSN A;  3PZ1 B;  1OJP A;  1RQ5 A;  1H3A A;  4NEI A;  2XFG A;  4Z4L A;  1AGM A;  2NVP A;  2BRV X;  3CU7 A;  1IA7 A;  3E80 A;  2JF4 A;  2E24 A;  3SFX B;  3PZ4 B;  1JCR B;  1HMU A;  1ULV A;  2FV0 A;  3HXE B;  4OK4 A;  1HM3 A;  4D94 A;  2OKX A;  1HXG A;  2H6F B;  2AHG A;  3PZ2 B;  1FMI A;  5IKH A;  4GTM B;  5GY3 A;  4ZH5 A;  5EAT A;  4Q88 A;  1N7O A;  3RJ3 A;  2V3N A;  2DRR A;  5FOB B;  1V7W A;  2V8K A;  1V5C A;  4OJZ A;  5FO9 B;  1F9G A;  1GXM A;  1OJM A;  1UT9 A;  2VN7 A;  3W5N A;  4FJQ A;  3M00 A;  1GXN A;  4EL8 A;  3P5P A;  3PMM A;  4C1S A;  3H7L A;  3WIQ A;  1LD8 B;  3M77 A;  3WKF A;  1WU5 A;  1G6I A;  1RWF A;  2A8Z A;  3M75 A;  5DGQ A;  2VN4 A;  2ZZR A;  1N7Q A;  3DSS B;  1G9G A;  3T33 A;  3KSQ B;  2G0D A;  4V1S A;  1FPP B;  3M78 A;  4YCR A;  3EZ8 A;  4L0G A;  3QWT A;  1N4P B;  3Q75 B;  1OJN A;  3HXB B;  4DOD A;  1KKT A;  3WIR A;  1S63 B;  3Q73 B;  4ZG8 A;  3M7E A;  3SDQ A;  2WDA A;  1V7V A;  3EUV B;  1LOH A;  4GTQ B;  5FO7 B;  3QXF A;  3OED A;  4RNQ A;  1JCQ B;  3ANK A;  1OJO A;  3A3V A;  3M73 A;  1XW2 A;  3RX8 A;  5IK9 A;  1N4Q B;  3QT3 A;  1QSJ A;  1TNU B;  1CB8 A;  3ACS A;  4CJ0 A;  1KZP B;  1NXC A;  5IL8 A;  1X1H A;  3DSX B;  5E2J A;  4WU0 A;  2WCO A;  1W6K A;  2NOJ A;  3M01 A;  1RW9 A;  1N4R B;  5ILH A;  5IM1 A;  3W7X A;  1X1J A;  5KKB A;  3DSV B;  5EAU A;  1CEM A;  1HZF A;  3A0O A;  4F10 A;  2F0Y B;  4KTP A;  1C82 A;  2E22 A;  2V8I A;  3E73 A;  3QG0 A;  4AYO A;  4F13 A;  4MBG B;  1GHQ A;  1N9A B;  1RWA A;  3ANJ A;  2FUQ A;  4J5T A;  5CA3 A;  1KS8 A;  2XQW A;  5MEH A;  1RWC A;  3D3I A;  1L1Y A;  1NL4 B;  3EU5 B;  1H39 A; 
#chains in the Genus database with same CATH homology
 2R2L B;  5JPM B;  3E37 B;  1O5M B;  3RRS A;  2YIK A;  1FBW A;  2DRQ A;  3CIH A;  1F9O A;  3P2C A;  2B4F A;  4FXG B;  1DCE B;  3QSP A;  3SDU A;  2GOX A;  1H12 A;  4YDE B;  2AFA A;  2EAC A;  2P0V A;  3TF4 A;  3Q79 B;  3REN A;  2WIN B;  3QDE A;  1QBQ B;  1LF6 A;  1X9D A;  4D4A A;  1UG9 A;  2V3P A;  3RX5 A;  4ZRQ A;  1MZC B;  2IEJ B;  1KFG A;  2BED B;  3K11 A;  2ZIS B;  1SA4 B;  1S64 B;  1IS9 A;  1HCU A;  1FBO A;  4GTV B;  4JJJ A;  4KKI A;  5M7I A;  3QT9 A;  4MU9 A;  1D8D B;  4D4C A;  5FO8 B;  4XUV A;  1KRF A;  1LD7 B;  1N94 B;  2EAB A;  3HXC B;  3E32 B;  3DRA B;  3QRY A;  1GSZ A;  2PMV A;  4LIX A;  3HXF B;  3H3K A;  4BOJ A;  3M72 A;  2A73 B;  1X81 B;  1G9J A;  1QQF A;  1JCS B;  2XWB B;  1H35 A;  1DOG A;  2ZIR B;  4CE7 A;  3W7W A;  1TNB B;  2H6I B;  3E34 B;  5GZK A;  1NI1 B;  1TNZ B;  2RGK A;  1O1R B;  3QFY A;  1FP3 A;  2FUZ A;  1UMP A;  3W7U A;  1FO3 A;  1XWT A;  1TN7 B;  4GTT B;  4GTR B;  2ZBL A;  3Q7F B;  1WZZ A;  2RI8 A;  1TN8 B;  1V7X A;  4GTO B;  3RSY A;  3GLY A;  3S4B A;  5GW7 A;  4KTR A;  1KSD A;  3VXD A;  4V1R A;  5AGD A;  3D5R A;  1DL2 A;  1N4S B;  4L6X A;  1H3B A;  1N95 B;  3GT5 A;  2GZ6 A;  2FBA A;  3M7B A;  3EU8 A;  4GTP B;  1V5D A;  3W7T A;  2SQC A;  1TNY B;  1XWQ A;  4AYQ A;  1H13 A;  3QXQ A;  1C3D A;  3GZK A;  1F9D A;  4Q2B A;  4TF4 A;  3OXU A;  3ANI A;  3E6U A;  1H14 A;  3W7S A;  1O1S B;  2H6H B;  4M76 A;  2D8L A;  2WY7 A;  4TXT A;  1FT1 B;  5DGR A;  3H2W A;  1CLC A;  4WVA A;  3SDV A;  3KLS A;  1O79 A;  1TN6 B;  3S4D A;  2DRO A;  3QFZ A;  3D5S A;  2WII B;  1FT2 B;  2QNO A;  2RI9 A;  4LNG B;  4ONT A;  3WC3 A;  1SQC A;  1IA6 A;  2F6D A;  3DSW B;  4GL3 A;  2BB5 A;  3Q78 B;  4WVB A;  2WY8 A;  1TF4 A;  2V8J A;  1GAI A;  3C72 B;  1GLM A;  2BB6 A;  3PYA A;  3P5R A;  2GH4 A;  1KRE A;  1H37 A;  2XWJ B;  3WKG A;  3E33 B;  2D5J A;  5CZL A;  2JJB A;  3M76 A;  4L9P B;  4KKJ A;  2I07 B;  1K72 A;  4WVC A;  3E30 B;  4D4B A;  1R76 A;  1D8E B;  3DPY B;  1O1T B;  1WU4 A;  3RX7 A;  3Q7A B;  4Z4J A;  2AHF A;  3ACT A;  1G87 A;  2CQT A;  2DRS A;  3QPF A;  4LNV A;  3M71 A;  5M7Y A;  3X17 A;  4AYR A;  4YDO B;  2Z07 A;  3AFJ A;  2WYN A;  4FXK B;  3M7C A;  2CQS A;  1JS4 A;  1KSC A;  1GXO A;  3SAE A;  4DOE A;  3W5M A;  1FCE A;  4EHM B;  3WUX A;  1L2A A;  3ON6 A;  1H36 A;  3DSU B;  3M7L A;  1O6Q A;  1NC5 A;  3S4A A;  4ZRP A;  3S9V A;  2EAD A;  4BOK A;  1SA5 B;  1KWF A;  4GTS B;  3WKI A;  2JG0 A;  2BBC A;  1FO2 A;  1TNO B;  3K7X A;  1VD5 A;  1AYX A;  3PZ3 B;  1H54 A;  2B39 A;  1LF9 A;  2EAE A;  1GAH A;  4QT9 A;  1WU6 A;  3SFY B;  1GA2 A;  3SDT A;  1LTX B;  4AYP A;  3VW5 A;  3G6J B;  2G02 A;  2H6G B;  4D4D A;  4CJ1 A;  1O6R A;  1W6J A;  4FUS A;  3HXD B;  2PN5 A;  3PYB A;  1O6H A;  1KZO B;  3KSL B;  3SDR A;  3DST B;  3S4C A;  3EQA A;  3M74 A;  3WKH A;  2FV1 A;  5CD2 A;  5JPN B;  3SQC A;  1H3C A;  4LNB B;  3WIW A;  3KQ4 A;  4ZH1 A;  1FAE A;  3PZ1 B;  1RQ5 A;  1H3A A;  2XFG A;  4Z4L A;  1AGM A;  2NVP A;  3CU7 A;  1IA7 A;  2JF4 A;  3SFX B;  3PZ4 B;  1JCR B;  3HXE B;  1ULV A;  2FV0 A;  4D94 A;  2OKX A;  2H6F B;  2AHG A;  3PZ2 B;  1FMI A;  4GTM B;  5GY3 A;  4ZH5 A;  4Q88 A;  3RJ3 A;  2V3N A;  2DRR A;  5FOB B;  1V7W A;  2V8K A;  1V5C A;  5FO9 B;  1GXM A;  1UT9 A;  2VN7 A;  3W5N A;  1GXN A;  4EL8 A;  3P5P A;  3PMM A;  4C1S A;  3H7L A;  3WIQ A;  1LD8 B;  3M77 A;  3WKF A;  1WU5 A;  1G6I A;  2A8Z A;  3M75 A;  5DGQ A;  2VN4 A;  2ZZR A;  3DSS B;  1G9G A;  3T33 A;  3KSQ B;  2G0D A;  4V1S A;  1FPP B;  3M78 A;  4YCR A;  3EZ8 A;  4L0G A;  3QWT A;  1N4P B;  3Q75 B;  3HXB B;  4DOD A;  1KKT A;  3WIR A;  1S63 B;  3Q73 B;  4ZG8 A;  3M7E A;  3SDQ A;  3EUV B;  1V7V A;  4GTQ B;  5FO7 B;  3QXF A;  3OED A;  1JCQ B;  3ANK A;  3A3V A;  3M73 A;  1XW2 A;  3RX8 A;  1N4Q B;  3QT3 A;  1QSJ A;  1TNU B;  3ACS A;  4CJ0 A;  1KZP B;  1NXC A;  3DSX B;  5E2J A;  4WU0 A;  1W6K A;  2NOJ A;  1N4R B;  3W7X A;  5KKB A;  3DSV B;  1CEM A;  1HZF A;  2F0Y B;  4KTP A;  2V8I A;  3E73 A;  3QG0 A;  4AYO A;  4MBG B;  1GHQ A;  1N9A B;  3ANJ A;  4J5T A;  5CA3 A;  1KS8 A;  2XQW A;  5MEH A;  3D3I A;  1L1Y A;  1NL4 B;  3EU5 B;  1H39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...