4GTTB

Engineered rabggtase in complex with bms analogue 12
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
324
Chain Sequence
b'QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 119
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4gttB00
1HZFA 1GXNA 1S64B 2PMVA 1MZCB 2B39A 2G0DA 2ZIRB 4GTSB 3G6JB 1TN7B 5JPMB 1FT2B 1JCSB 5FO8B 2BB6A 1GXOA 2PN5A 3DRAB 4ONTA 3Q7AB 1S63B 1LD7B 1W6KA 3DSXB 1SA5B 3KLSA 3Q75B 4GTQB 4GTOB 3SQCA 1QSJA 2V8IA 4V1SA 1TNOB 1H3AA 2BB5A 5AGDA 1H36A 2XWJB 1JCRB 3OEDA 4ZH1A 3DSTB 3Q79B 1UMPA 4LNGB 2H6FB 4GTRB 3E32B 2IEJB 3HXFB 2WINB 1LTXB 1KZPB 3E34B 1H35A 1N4PB 1QQFA 2WIIB 4FXKB 2WY8A 1O5MB 2ZISB 1JCQB 1QBQB 2H6IB 3KQ4A 3KSLB 1NL4B 5JPNB 2BEDB 1O6HA 1N4SB 1TN6B 3DSUB 1FPPB 1N4RB 1O6QA 4MU9A 4YDOB 3SFXB 1H3CA 3DSVB 3PZ2B 5FO9B 1FT1B 4V1RA 3EU5B 3Q73B 4GTPB 1H37A 3HXCB 1N9AB 2V8JA 1GHQA 2WY7A 5FO7B 3E37B 4KKIA 2H6HB 3CU7A 3DPYB 3RJ3A 1D8EB 3C72B 3Q7FB 2SQCA 3D5RA 1KZOB 1O1SB 2GOXA 2XWBB 1N4QB 3HXDB 5FOBB 2H6GB 4ZRQA 4EHMB 4BOKA 1H3BA 1GXMA 3PZ3B 4M76A 1SA4B 3SFYB 1GSZA 2I07B 1N94B 3E33B 1X81B 4D94A 4KKJA 3OXUA 1DCEB 1TNYB 2V3NA 4LNBB 4D4DA 4MBGB 4D4CA 1TNZB 2V3PA 1O79A 1SQCA 1C3DA 4D4AA 1O6RA 1TNUB 1TNBB 2A73B 1LD8B 3KSQB 3PZ1B 1H39A 3HXBB 4GTMB 1O1RB 3D5SA 3HXEB 3PZ4B 1TN8B 4GTVB 1N95B 3E30B 3EUVB 3K7XA 2BBCA 2NOJA 4LNVA 1R76A 3DSSB 1D8DB 4C1SA 4D4BA 2V8KA 1W6JA 3DSWB 4YDEB 4ZRPA 4GTTB 2F0YB 2G02A 2R2LB 4FXGB 3Q78B 1O1TB 2XQWA 4BOJA 1NI1B 4L9PB
chains in the Genus database with same CATH superfamily
2PMVA 2B39A 2FV0A 1X9DA 4GTSB 2F6DA 1EGUA 1JCSB 2RI8A 5FO8B 1G9JA 1VD5A 3DRAB 1IA6A 1FAEA 2A8ZA 3M00A 3WKGA 3DSXB 4TF4A 2FV1A 3H3KA 1H13A 5IK9A 5EATA 1UT9A 5GZKA 2RGKA 3K11A 3RRSA 2XWJB 3DSTB 3Q79B 5IM1A 1AGMA 1FO2A 4E1YA 4WVCA 1FCEA 3HXFB 2WINB 1LTXB 1KZPB 1QAZA 1H35A 1ULVA 2AHGA 2D8LA 3TF4A 3QPFA 2WY8A 1N7PA 1QBQB 1CLCA 2BEDB 2EADA 3S4CA 4TXTA 3DSUB 4MU9A 1LXMA 3G4FA 1AYXA 3DSVB 3PZ2B 3WIRA 4V1RA 4GTPB 4JJJA 5GY3A 1HCUA 2WDAA 1V7VA 2RI9A 1N1ZA 3QG0A 1N20A 1N7QA 3CU7A 3DPYB 3SDVA 1N7NA 3C72B 2ZBLA 3SDRA 2FUTA 3D5RA 3QXQA 3A3VA 2H6GB 4ZRQA 1GXMA 4ZH5A 2I07B 3RX8A 3WKIA 4J5TA 2JJBA 4D94A 1N1BA 3OXUA 2J5CA 1W3YA 2WYNA 3M7BA 2V3NA 3E6UA 1TNZB 1UG9A 1SQCA 3PZ1B 1F9DA 1H39A 3PZ4B 5ILDA 1XWQA 3VSMA 4LNVA 3DSSB 3S4BA 1HX9A 2V8KA 1W6JA 4ZRPA 1F9OA 1HMUA 2G02A 4FXGB 1KWFA 4L9PB 1RWCA 1HZFA 3X17A 1S64B 2G0DA 5DGRA 3PYBA 3G6JB 4MMHA 1LXKA 1LF9A 5JPMB 5EASA 1RWFA 1FT2B 3NFVA 4F13A 1GXOA 1S63B 5IKHA 5ILJA 3LZ9A 1WZZA 4NEIA 1N23A 3QDEA 1TF4A 1OJMA 3SQCA 3W7SA 1H3AA 1V5CA 5AGDA 5JMDA 4Z4JA 1H36A 5JMFA 1JCRB 3OEDA 3W7WA 4ZH1A 5CA3A 2DROA 1UMPA 2H6FB 5IKAA 3E80A 3PYAA 3VW5A 1KFGA 1N4PB 3M74A 3W7TA 4FXKB 1HXCA 1JCQB 1KREA 3S9VA 4CJ1A 3PMMA 3WIQA 1TN6B 1DOGA 2B4FA 1FPPB 1RWGA 2FUQA 3EU8A 1RWHA 5FO9B 1X1IA 5DHKA 1H37A 3WKHA 1KSDA 3W5MA 1RQ5A 4Q2BA 2BRWA 3P2CA 3M7CA 4LIXA 3E37B 1OJPA 1X1HA 3P5PA 2H6HB 4OJZA 3RJ3A 4OK2A 3Q7FB 3W5NA 1KZOB 3M7EA 2OKXA 3EZ8A 5GW7A 4EHMB 3SFYB 1SA4B 1N24A 4GL3A 3CIHA 2YIKA 1GAHA 2DRRA 1HMWA 4RNQA 4KKJA 3AFJA 1DCEB 1TNYB 4LNBB 3SDTA 4D4CA 2V3PA 3RSYA 5C05A 1C3DA 1TNUB 4ZG8A 4FUSA 3HXBB 1O1RB 3D5SA 2XFGA 3HXEB 1TN8B 1V7WA 3M71A 3K7XA 1R76A 4AYPA 1V5DA 4XUVA 3SDUA 2F0YB 5MEHA 3GZKA 4YCRA 3E73A 4DODA 4Q88A 3Q78B 3M77A 4QT9A 1O1TB 2ONGA 4BOJA 1NI1B 2QNOA 4AYOA 2JG0A 1GXNA 1N22A 5KKBA 2ZIRB 3N0GA 4DOEA 4GAXA 1J0NA 3N0FA 2VN4A 1IS9A 5ILKA 4WU0A 1W6KA 1KKTA 4WVAA 5EAUA 3KLSA 3Q75B 2ZZRA 4GTQB 1QSJA 2V8IA 2Z07A 1F9GA 1TNOB 1C82A 4AYQA 1WU4A 3E32B 2IEJB 3QWTA 1FP3A 3QT9A 3M72A 1O5MB 1N7OA 2ZISB 2CQSA 3KQ4A 3QSPA 1NL4B 4WVBA 4CE7A 4KTRA 1N4SB 3AFLA 4FNVA 4YDOB 5DGQA 1CB8A 3SFXB 1GLMA 1H3CA 1HXAA 3VSNA 1FT1B 1X1JA 2E24A 3Q73B 3QFYA 1K72A 3S4AA 3WKFA 1N9AB 4MMIA 4CJ0A 5ILHA 1H12A 1GHQA 2WY7A 5FO7B 3H2WA 3QXFA 4KKIA 1J0MA 5IL8A 5DHIA 3RENA 1XWTA 3WUXA 1HM3A 2SQCA 1WU5A 1HM2A 2GOXA 5FOBB 3PZ3B 5IK0A 3W7XA 3ANIA 1X81B 1XW2A 3H7LA 3W7UA 3GLYA 2P0VA 4D4DA 4MBGB 2ONHA 5ILZA 5IK6A 1O6RA 1HN0A 2A73B 1LD8B 2DRSA 1L1YA 1G87A 2AHFA 1L2AA 4GTMB 1NXCA 1I8QA 3ANKA 3QT3A 3E30B 2BRPA 1LF6A 4YDEB 4GTTB 4OK4A 1RW9A 5ILIA 3M01A 1FO3A 3M7LA 3S4DA 1H14A 4DI5A 1MZCB 3WC3A 3G4DA 1FBWA 3RX5A 1G6IA 1TN7B 3P5RA 2EACA 2JF4A 4FJQA 4KTPA 2BB6A 1FBOA 5E2JA 2PN5A 4ONTA 3EQAA 2Q1FA 3Q7AB 1LD7B 4EL8A 5M7IA 5M7YA 2EABA 1SA5B 4Z4LA 3WIWA 3ON6A 5CD2A 4F10A 4GTOB 1HXGA 2WCOA 4V1SA 2BB5A 3T33A 3ACSA 4LNGB 5IL3A 1G9GA 4GTRB 1GA2A 1WU6A 2AFAA 2WIIB 1F1SA 1QQFA 1H54A 4OZWA 5CZLA 1LOHA 3RX7A 2D5JA 4L6XA 2H6IB 3KSLB 2E22A 1OJOA 5JPNB 1O6HA 2BRVX 3M76A 1N4RB 1O6QA 1N21A 4L0GA 3ACTA 2DRQA 2CQTA 3M75A 3EU5B 2EAEA 2VN7A 3HXCB 3VXDA 2V8JA 3M73A 1IA7A 1RWAA 3GT5A 4OZVA 1D8EB 1KS8A 1O1SB 2XWBB 1N4QB 3HXDB 3M78A 4BOKA 1H3BA 4M76A 1GSZA 2GZ6A 3A0OA 1N94B 3E33B 3QRYA 3QFZA 3E7JA 2GH4A 3SDQA 1HV6A 1N7RA 5ILYA 2X03A 3D3IA 1OJNA 1GAIA 1O79A 4D4AA 4AYRA 1CEMA 1TNBB 3KSQB 1KRFA 2FBAA 3SAEA 4GTVB 1N95B 3M02A 3EUVB 2BBCA 2NOJA 1D8DB 4C1SA 1DL2A 4D4BA 3DSWB 1FMIA 3ANJA 3NNBA 1KSCA 2FUZA 1V7XA 1NC5A 2R2LB 1JS4A 2XQWA 3E34B 2NVPA
chains in the Genus database with same CATH topology
2PMVA 2B39A 2FV0A 1X9DA 4GTSB 2F6DA 1JCSB 2RI8A 5FO8B 1G9JA 1VD5A 3DRAB 1IA6A 1FAEA 2A8ZA 3WKGA 3DSXB 4TF4A 2FV1A 3H3KA 1H13A 1UT9A 5GZKA 2RGKA 3K11A 3RRSA 2XWJB 3DSTB 3Q79B 1AGMA 1FO2A 4WVCA 1FCEA 3HXFB 2WINB 1LTXB 1KZPB 1ULVA 1H35A 2AHGA 2D8LA 3TF4A 3QPFA 2WY8A 1QBQB 1CLCA 2BEDB 2EADA 3S4CA 4TXTA 3DSUB 4MU9A 1AYXA 3DSVB 3PZ2B 3WIRA 4V1RA 4GTPB 4JJJA 5GY3A 1HCUA 1V7VA 2RI9A 3QG0A 3CU7A 3DPYB 3SDVA 3C72B 2ZBLA 3SDRA 3QXQA 3D5RA 3A3VA 2H6GB 4ZRQA 1GXMA 4ZH5A 2I07B 3RX8A 3WKIA 4J5TA 2JJBA 4D94A 3OXUA 2WYNA 3M7BA 2V3NA 3E6UA 1TNZB 1UG9A 1SQCA 3PZ1B 1F9DA 1H39A 3PZ4B 1XWQA 4LNVA 3DSSB 3S4BA 2V8KA 1W6JA 4ZRPA 1F9OA 2G02A 4FXGB 1KWFA 4L9PB 1HZFA 3X17A 1S64B 2G0DA 5DGRA 3PYBA 3G6JB 1LF9A 5JPMB 1FT2B 1GXOA 1S63B 1WZZA 3QDEA 1TF4A 3SQCA 3W7SA 1H3AA 1V5CA 5AGDA 3W7WA 4Z4JA 1H36A 1JCRB 3OEDA 4ZH1A 5CA3A 2DROA 1UMPA 2H6FB 3PYAA 3VW5A 1KFGA 1N4PB 3M74A 3W7TA 4FXKB 1JCQB 1KREA 3S9VA 4CJ1A 3PMMA 3WIQA 1TN6B 1DOGA 2B4FA 1FPPB 3EU8A 5FO9B 3WKHA 1H37A 1KSDA 3W5MA 1RQ5A 4Q2BA 3P2CA 3M7CA 4LIXA 3E37B 3P5PA 2H6HB 3RJ3A 3Q7FB 3W5NA 1KZOB 3M7EA 2OKXA 3EZ8A 5GW7A 4EHMB 3SFYB 1SA4B 4GL3A 3CIHA 2YIKA 1GAHA 2DRRA 4KKJA 3AFJA 1DCEB 1TNYB 4LNBB 3SDTA 4D4CA 2V3PA 3RSYA 1C3DA 1TNUB 4ZG8A 4FUSA 3HXBB 1O1RB 3D5SA 2XFGA 3HXEB 1TN8B 1V7WA 3M71A 3K7XA 1R76A 4AYPA 1V5DA 4XUVA 3SDUA 2F0YB 5MEHA 3GZKA 4YCRA 3E73A 4DODA 4Q88A 3Q78B 3M77A 4QT9A 1O1TB 4BOJA 1NI1B 2QNOA 4AYOA 2JG0A 1GXNA 5KKBA 2ZIRB 4DOEA 2VN4A 1IS9A 4WU0A 1W6KA 1KKTA 4WVAA 3KLSA 3Q75B 2ZZRA 4GTQB 1QSJA 2V8IA 2Z07A 1TNOB 4AYQA 1WU4A 3E32B 2IEJB 3QWTA 1FP3A 3QT9A 3M72A 1O5MB 2ZISB 2CQSA 3KQ4A 3QSPA 1NL4B 4WVBA 4CE7A 4KTRA 1N4SB 4YDOB 5DGQA 3SFXB 1GLMA 1H3CA 1FT1B 3QFYA 3Q73B 1K72A 3S4AA 3WKFA 1N9AB 4CJ0A 1H12A 1GHQA 2WY7A 5FO7B 3H2WA 3QXFA 4KKIA 3RENA 1XWTA 3WUXA 2SQCA 1WU5A 2GOXA 5FOBB 3PZ3B 3W7XA 3ANIA 1X81B 1XW2A 3H7LA 3W7UA 3GLYA 2P0VA 4D4DA 4MBGB 1O6RA 2A73B 1LD8B 2DRSA 1L1YA 1G87A 2AHFA 1L2AA 4GTMB 1NXCA 3ANKA 3QT3A 3E30B 1LF6A 4YDEB 4GTTB 1FO3A 3M7LA 3S4DA 1H14A 1MZCB 3WC3A 3RX5A 1FBWA 1G6IA 1TN7B 3P5RA 2EACA 2JF4A 4KTPA 2BB6A 1FBOA 5E2JA 2PN5A 4ONTA 3EQAA 3Q7AB 1LD7B 4EL8A 5M7IA 5M7YA 2EABA 1SA5B 4Z4LA 3WIWA 3ON6A 5CD2A 4GTOB 4V1SA 2BB5A 3T33A 3ACSA 4LNGB 1G9GA 4GTRB 1GA2A 1WU6A 2AFAA 2WIIB 1QQFA 1H54A 5CZLA 3RX7A 2D5JA 4L6XA 2H6IB 3KSLB 5JPNB 1O6HA 3M76A 1N4RB 1O6QA 4L0GA 3ACTA 2DRQA 2CQTA 3M75A 3EU5B 2EAEA 2VN7A 3HXCB 3VXDA 2V8JA 3M73A 1IA7A 3GT5A 1D8EB 1KS8A 1O1SB 2XWBB 1N4QB 3HXDB 3M78A 4BOKA 1H3BA 4M76A 1GSZA 2GZ6A 1N94B 3E33B 3QRYA 3QFZA 2GH4A 3SDQA 3D3IA 1GAIA 1O79A 4D4AA 4AYRA 1CEMA 1TNBB 3KSQB 1KRFA 2FBAA 3SAEA 4GTVB 1N95B 3EUVB 2BBCA 2NOJA 1D8DB 4C1SA 1DL2A 4D4BA 3DSWB 1FMIA 3ANJA 1KSCA 2FUZA 1V7XA 1NC5A 2R2LB 1JS4A 2XQWA 3E34B 2NVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZF A;  1GXN A;  1S64 B;  2PMV A;  1MZC B;  2B39 A;  2G0D A;  2ZIR B;  4GTS B;  3G6J B;  1TN7 B;  5JPM B;  1FT2 B;  1JCS B;  5FO8 B;  2BB6 A;  1GXO A;  2PN5 A;  3DRA B;  4ONT A;  3Q7A B;  1S63 B;  1LD7 B;  1W6K A;  3DSX B;  1SA5 B;  3KLS A;  3Q75 B;  4GTQ B;  4GTO B;  3SQC A;  1QSJ A;  2V8I A;  4V1S A;  1TNO B;  1H3A A;  2BB5 A;  5AGD A;  1H36 A;  2XWJ B;  1JCR B;  3OED A;  4ZH1 A;  3DST B;  3Q79 B;  1UMP A;  4LNG B;  2H6F B;  4GTR B;  3E32 B;  2IEJ B;  3HXF B;  2WIN B;  1LTX B;  1KZP B;  3E34 B;  1H35 A;  1N4P B;  1QQF A;  2WII B;  4FXK B;  2WY8 A;  1O5M B;  2ZIS B;  1JCQ B;  1QBQ B;  2H6I B;  3KQ4 A;  3KSL B;  1NL4 B;  5JPN B;  2BED B;  1O6H A;  1N4S B;  1TN6 B;  3DSU B;  1FPP B;  1N4R B;  1O6Q A;  4MU9 A;  4YDO B;  3SFX B;  1H3C A;  3DSV B;  3PZ2 B;  5FO9 B;  1FT1 B;  4V1R A;  3EU5 B;  3Q73 B;  4GTP B;  1H37 A;  3HXC B;  1N9A B;  2V8J A;  1GHQ A;  2WY7 A;  5FO7 B;  3E37 B;  4KKI A;  2H6H B;  3CU7 A;  3DPY B;  3RJ3 A;  1D8E B;  3C72 B;  3Q7F B;  2SQC A;  3D5R A;  1KZO B;  1O1S B;  2GOX A;  2XWB B;  1N4Q B;  3HXD B;  5FOB B;  2H6G B;  4ZRQ A;  4EHM B;  4BOK A;  1H3B A;  1GXM A;  3PZ3 B;  4M76 A;  1SA4 B;  3SFY B;  1GSZ A;  2I07 B;  1N94 B;  3E33 B;  1X81 B;  4D94 A;  4KKJ A;  3OXU A;  1DCE B;  1TNY B;  2V3N A;  4LNB B;  4D4D A;  4MBG B;  4D4C A;  1TNZ B;  2V3P A;  1O79 A;  1SQC A;  1C3D A;  4D4A A;  1O6R A;  1TNU B;  1TNB B;  2A73 B;  1LD8 B;  3KSQ B;  3PZ1 B;  1H39 A;  3HXB B;  4GTM B;  1O1R B;  3D5S A;  3HXE B;  3PZ4 B;  1TN8 B;  4GTV B;  1N95 B;  3E30 B;  3EUV B;  3K7X A;  2BBC A;  2NOJ A;  4LNV A;  1R76 A;  3DSS B;  1D8D B;  4C1S A;  4D4B A;  2V8K A;  1W6J A;  3DSW B;  4YDE B;  4ZRP A;  4GTT B;  2F0Y B;  2G02 A;  2R2L B;  4FXG B;  3Q78 B;  1O1T B;  2XQW A;  4BOJ A;  1NI1 B;  4L9P B; 
#chains in the Genus database with same CATH topology
 2PMV A;  2B39 A;  2FV0 A;  1X9D A;  4GTS B;  2F6D A;  1EGU A;  1JCS B;  2RI8 A;  5FO8 B;  1G9J A;  1VD5 A;  3DRA B;  1IA6 A;  1FAE A;  2A8Z A;  3M00 A;  3WKG A;  3DSX B;  4TF4 A;  2FV1 A;  3H3K A;  1H13 A;  5IK9 A;  5EAT A;  1UT9 A;  5GZK A;  2RGK A;  3K11 A;  3RRS A;  2XWJ B;  3DST B;  3Q79 B;  5IM1 A;  1AGM A;  1FO2 A;  4E1Y A;  4WVC A;  1FCE A;  3HXF B;  2WIN B;  1LTX B;  1KZP B;  1QAZ A;  1H35 A;  1ULV A;  2AHG A;  2D8L A;  3TF4 A;  3QPF A;  2WY8 A;  1N7P A;  1QBQ B;  1CLC A;  2BED B;  2EAD A;  3S4C A;  4TXT A;  3DSU B;  4MU9 A;  1LXM A;  3G4F A;  1AYX A;  3DSV B;  3PZ2 B;  3WIR A;  4V1R A;  4GTP B;  4JJJ A;  5GY3 A;  1HCU A;  2WDA A;  1V7V A;  2RI9 A;  1N1Z A;  3QG0 A;  1N20 A;  1N7Q A;  3CU7 A;  3DPY B;  3SDV A;  1N7N A;  3C72 B;  2ZBL A;  3SDR A;  2FUT A;  3D5R A;  3QXQ A;  3A3V A;  2H6G B;  4ZRQ A;  1GXM A;  4ZH5 A;  2I07 B;  3RX8 A;  3WKI A;  4J5T A;  2JJB A;  4D94 A;  1N1B A;  3OXU A;  2J5C A;  1W3Y A;  2WYN A;  3M7B A;  2V3N A;  3E6U A;  1TNZ B;  1UG9 A;  1SQC A;  3PZ1 B;  1F9D A;  1H39 A;  3PZ4 B;  5ILD A;  1XWQ A;  3VSM A;  4LNV A;  3DSS B;  3S4B A;  1HX9 A;  2V8K A;  1W6J A;  4ZRP A;  1F9O A;  1HMU A;  2G02 A;  4FXG B;  1KWF A;  4L9P B;  1RWC A;  1HZF A;  3X17 A;  1S64 B;  2G0D A;  5DGR A;  3PYB A;  3G6J B;  4MMH A;  1LXK A;  1LF9 A;  5JPM B;  5EAS A;  1RWF A;  1FT2 B;  3NFV A;  4F13 A;  1GXO A;  1S63 B;  5IKH A;  5ILJ A;  3LZ9 A;  1WZZ A;  4NEI A;  1N23 A;  3QDE A;  1TF4 A;  1OJM A;  3SQC A;  3W7S A;  1H3A A;  1V5C A;  5AGD A;  5JMD A;  4Z4J A;  1H36 A;  5JMF A;  1JCR B;  3OED A;  3W7W A;  4ZH1 A;  5CA3 A;  2DRO A;  1UMP A;  2H6F B;  5IKA A;  3E80 A;  3PYA A;  3VW5 A;  1KFG A;  1N4P B;  3M74 A;  3W7T A;  4FXK B;  1HXC A;  1JCQ B;  1KRE A;  3S9V A;  4CJ1 A;  3PMM A;  3WIQ A;  1TN6 B;  1DOG A;  2B4F A;  1FPP B;  1RWG A;  2FUQ A;  3EU8 A;  1RWH A;  5FO9 B;  1X1I A;  5DHK A;  1H37 A;  3WKH A;  1KSD A;  3W5M A;  1RQ5 A;  4Q2B A;  2BRW A;  3P2C A;  3M7C A;  4LIX A;  3E37 B;  1OJP A;  1X1H A;  3P5P A;  2H6H B;  4OJZ A;  3RJ3 A;  4OK2 A;  3Q7F B;  3W5N A;  1KZO B;  3M7E A;  2OKX A;  3EZ8 A;  5GW7 A;  4EHM B;  3SFY B;  1SA4 B;  1N24 A;  4GL3 A;  3CIH A;  2YIK A;  1GAH A;  2DRR A;  1HMW A;  4RNQ A;  4KKJ A;  3AFJ A;  1DCE B;  1TNY B;  4LNB B;  3SDT A;  4D4C A;  2V3P A;  3RSY A;  5C05 A;  1C3D A;  1TNU B;  4ZG8 A;  4FUS A;  3HXB B;  1O1R B;  3D5S A;  2XFG A;  3HXE B;  1TN8 B;  1V7W A;  3M71 A;  3K7X A;  1R76 A;  4AYP A;  1V5D A;  4XUV A;  3SDU A;  2F0Y B;  5MEH A;  3GZK A;  4YCR A;  3E73 A;  4DOD A;  4Q88 A;  3Q78 B;  3M77 A;  4QT9 A;  1O1T B;  2ONG A;  4BOJ A;  1NI1 B;  2QNO A;  4AYO A;  2JG0 A;  1GXN A;  1N22 A;  5KKB A;  2ZIR B;  3N0G A;  4DOE A;  4GAX A;  1J0N A;  3N0F A;  2VN4 A;  1IS9 A;  5ILK A;  4WU0 A;  1W6K A;  1KKT A;  4WVA A;  5EAU A;  3KLS A;  3Q75 B;  2ZZR A;  4GTQ B;  1QSJ A;  2V8I A;  2Z07 A;  1F9G A;  1TNO B;  1C82 A;  4AYQ A;  1WU4 A;  3E32 B;  2IEJ B;  3QWT A;  1FP3 A;  3QT9 A;  3M72 A;  1O5M B;  1N7O A;  2ZIS B;  2CQS A;  3KQ4 A;  3QSP A;  1NL4 B;  4WVB A;  4CE7 A;  4KTR A;  1N4S B;  3AFL A;  4FNV A;  4YDO B;  5DGQ A;  1CB8 A;  3SFX B;  1GLM A;  1H3C A;  1HXA A;  3VSN A;  1FT1 B;  1X1J A;  2E24 A;  3Q73 B;  3QFY A;  1K72 A;  3S4A A;  3WKF A;  1N9A B;  4MMI A;  4CJ0 A;  5ILH A;  1H12 A;  1GHQ A;  2WY7 A;  5FO7 B;  3H2W A;  3QXF A;  4KKI A;  1J0M A;  5IL8 A;  5DHI A;  3REN A;  1XWT A;  3WUX A;  1HM3 A;  2SQC A;  1WU5 A;  1HM2 A;  2GOX A;  5FOB B;  3PZ3 B;  5IK0 A;  3W7X A;  3ANI A;  1X81 B;  1XW2 A;  3H7L A;  3W7U A;  3GLY A;  2P0V A;  4D4D A;  4MBG B;  2ONH A;  5ILZ A;  5IK6 A;  1O6R A;  1HN0 A;  2A73 B;  1LD8 B;  2DRS A;  1L1Y A;  1G87 A;  2AHF A;  1L2A A;  4GTM B;  1NXC A;  1I8Q A;  3ANK A;  3QT3 A;  3E30 B;  2BRP A;  1LF6 A;  4YDE B;  4GTT B;  4OK4 A;  1RW9 A;  5ILI A;  3M01 A;  1FO3 A;  3M7L A;  3S4D A;  1H14 A;  4DI5 A;  1MZC B;  3WC3 A;  3G4D A;  1FBW A;  3RX5 A;  1G6I A;  1TN7 B;  3P5R A;  2EAC A;  2JF4 A;  4FJQ A;  4KTP A;  2BB6 A;  1FBO A;  5E2J A;  2PN5 A;  4ONT A;  3EQA A;  2Q1F A;  3Q7A B;  1LD7 B;  4EL8 A;  5M7I A;  5M7Y A;  2EAB A;  1SA5 B;  4Z4L A;  3WIW A;  3ON6 A;  5CD2 A;  4F10 A;  4GTO B;  1HXG A;  2WCO A;  4V1S A;  2BB5 A;  3T33 A;  3ACS A;  4LNG B;  5IL3 A;  1G9G A;  4GTR B;  1GA2 A;  1WU6 A;  2AFA A;  2WII B;  1F1S A;  1QQF A;  1H54 A;  4OZW A;  5CZL A;  1LOH A;  3RX7 A;  2D5J A;  4L6X A;  2H6I B;  3KSL B;  2E22 A;  1OJO A;  5JPN B;  1O6H A;  2BRV X;  3M76 A;  1N4R B;  1O6Q A;  1N21 A;  4L0G A;  3ACT A;  2DRQ A;  2CQT A;  3M75 A;  3EU5 B;  2EAE A;  2VN7 A;  3HXC B;  3VXD A;  2V8J A;  3M73 A;  1IA7 A;  1RWA A;  3GT5 A;  4OZV A;  1D8E B;  1KS8 A;  1O1S B;  2XWB B;  1N4Q B;  3HXD B;  3M78 A;  4BOK A;  1H3B A;  4M76 A;  1GSZ A;  2GZ6 A;  3A0O A;  1N94 B;  3E33 B;  3QRY A;  3QFZ A;  3E7J A;  2GH4 A;  3SDQ A;  1HV6 A;  1N7R A;  5ILY A;  2X03 A;  3D3I A;  1OJN A;  1GAI A;  1O79 A;  4D4A A;  4AYR A;  1CEM A;  1TNB B;  3KSQ B;  1KRF A;  2FBA A;  3SAE A;  4GTV B;  1N95 B;  3M02 A;  3EUV B;  2BBC A;  2NOJ A;  1D8D B;  4C1S A;  1DL2 A;  4D4B A;  3DSW B;  1FMI A;  3ANJ A;  3NNB A;  1KSC A;  2FUZ A;  1V7X A;  1NC5 A;  2R2L B;  1JS4 A;  2XQW A;  3E34 B;  2NVP A; 
#chains in the Genus database with same CATH homology
 2PMV A;  2B39 A;  2FV0 A;  1X9D A;  4GTS B;  2F6D A;  1JCS B;  2RI8 A;  5FO8 B;  1G9J A;  1VD5 A;  3DRA B;  1IA6 A;  1FAE A;  2A8Z A;  3WKG A;  3DSX B;  4TF4 A;  2FV1 A;  3H3K A;  1H13 A;  1UT9 A;  5GZK A;  2RGK A;  3K11 A;  3RRS A;  2XWJ B;  3DST B;  3Q79 B;  1AGM A;  1FO2 A;  4WVC A;  1FCE A;  3HXF B;  2WIN B;  1LTX B;  1KZP B;  1ULV A;  1H35 A;  2AHG A;  2D8L A;  3TF4 A;  3QPF A;  2WY8 A;  1QBQ B;  1CLC A;  2BED B;  2EAD A;  3S4C A;  4TXT A;  3DSU B;  4MU9 A;  1AYX A;  3DSV B;  3PZ2 B;  3WIR A;  4V1R A;  4GTP B;  4JJJ A;  5GY3 A;  1HCU A;  1V7V A;  2RI9 A;  3QG0 A;  3CU7 A;  3DPY B;  3SDV A;  3C72 B;  2ZBL A;  3SDR A;  3QXQ A;  3D5R A;  3A3V A;  2H6G B;  4ZRQ A;  1GXM A;  4ZH5 A;  2I07 B;  3RX8 A;  3WKI A;  4J5T A;  2JJB A;  4D94 A;  3OXU A;  2WYN A;  3M7B A;  2V3N A;  3E6U A;  1TNZ B;  1UG9 A;  1SQC A;  3PZ1 B;  1F9D A;  1H39 A;  3PZ4 B;  1XWQ A;  4LNV A;  3DSS B;  3S4B A;  2V8K A;  1W6J A;  4ZRP A;  1F9O A;  2G02 A;  4FXG B;  1KWF A;  4L9P B;  1HZF A;  3X17 A;  1S64 B;  2G0D A;  5DGR A;  3PYB A;  3G6J B;  1LF9 A;  5JPM B;  1FT2 B;  1GXO A;  1S63 B;  1WZZ A;  3QDE A;  1TF4 A;  3SQC A;  3W7S A;  1H3A A;  1V5C A;  5AGD A;  3W7W A;  4Z4J A;  1H36 A;  1JCR B;  3OED A;  4ZH1 A;  5CA3 A;  2DRO A;  1UMP A;  2H6F B;  3PYA A;  3VW5 A;  1KFG A;  1N4P B;  3M74 A;  3W7T A;  4FXK B;  1JCQ B;  1KRE A;  3S9V A;  4CJ1 A;  3PMM A;  3WIQ A;  1TN6 B;  1DOG A;  2B4F A;  1FPP B;  3EU8 A;  5FO9 B;  3WKH A;  1H37 A;  1KSD A;  3W5M A;  1RQ5 A;  4Q2B A;  3P2C A;  3M7C A;  4LIX A;  3E37 B;  3P5P A;  2H6H B;  3RJ3 A;  3Q7F B;  3W5N A;  1KZO B;  3M7E A;  2OKX A;  3EZ8 A;  5GW7 A;  4EHM B;  3SFY B;  1SA4 B;  4GL3 A;  3CIH A;  2YIK A;  1GAH A;  2DRR A;  4KKJ A;  3AFJ A;  1DCE B;  1TNY B;  4LNB B;  3SDT A;  4D4C A;  2V3P A;  3RSY A;  1C3D A;  1TNU B;  4ZG8 A;  4FUS A;  3HXB B;  1O1R B;  3D5S A;  2XFG A;  3HXE B;  1TN8 B;  1V7W A;  3M71 A;  3K7X A;  1R76 A;  4AYP A;  1V5D A;  4XUV A;  3SDU A;  2F0Y B;  5MEH A;  3GZK A;  4YCR A;  3E73 A;  4DOD A;  4Q88 A;  3Q78 B;  3M77 A;  4QT9 A;  1O1T B;  4BOJ A;  1NI1 B;  2QNO A;  4AYO A;  2JG0 A;  1GXN A;  5KKB A;  2ZIR B;  4DOE A;  2VN4 A;  1IS9 A;  4WU0 A;  1W6K A;  1KKT A;  4WVA A;  3KLS A;  3Q75 B;  2ZZR A;  4GTQ B;  1QSJ A;  2V8I A;  2Z07 A;  1TNO B;  4AYQ A;  1WU4 A;  3E32 B;  2IEJ B;  3QWT A;  1FP3 A;  3QT9 A;  3M72 A;  1O5M B;  2ZIS B;  2CQS A;  3KQ4 A;  3QSP A;  1NL4 B;  4WVB A;  4CE7 A;  4KTR A;  1N4S B;  4YDO B;  5DGQ A;  3SFX B;  1GLM A;  1H3C A;  1FT1 B;  3QFY A;  3Q73 B;  1K72 A;  3S4A A;  3WKF A;  1N9A B;  4CJ0 A;  1H12 A;  1GHQ A;  2WY7 A;  5FO7 B;  3H2W A;  3QXF A;  4KKI A;  3REN A;  1XWT A;  3WUX A;  2SQC A;  1WU5 A;  2GOX A;  5FOB B;  3PZ3 B;  3W7X A;  3ANI A;  1X81 B;  1XW2 A;  3H7L A;  3W7U A;  3GLY A;  2P0V A;  4D4D A;  4MBG B;  1O6R A;  2A73 B;  1LD8 B;  2DRS A;  1L1Y A;  1G87 A;  2AHF A;  1L2A A;  4GTM B;  1NXC A;  3ANK A;  3QT3 A;  3E30 B;  1LF6 A;  4YDE B;  4GTT B;  1FO3 A;  3M7L A;  3S4D A;  1H14 A;  1MZC B;  3WC3 A;  3RX5 A;  1FBW A;  1G6I A;  1TN7 B;  3P5R A;  2EAC A;  2JF4 A;  4KTP A;  2BB6 A;  1FBO A;  5E2J A;  2PN5 A;  4ONT A;  3EQA A;  3Q7A B;  1LD7 B;  4EL8 A;  5M7I A;  5M7Y A;  2EAB A;  1SA5 B;  4Z4L A;  3WIW A;  3ON6 A;  5CD2 A;  4GTO B;  4V1S A;  2BB5 A;  3T33 A;  3ACS A;  4LNG B;  1G9G A;  4GTR B;  1GA2 A;  1WU6 A;  2AFA A;  2WII B;  1QQF A;  1H54 A;  5CZL A;  3RX7 A;  2D5J A;  4L6X A;  2H6I B;  3KSL B;  5JPN B;  1O6H A;  3M76 A;  1N4R B;  1O6Q A;  4L0G A;  3ACT A;  2DRQ A;  2CQT A;  3M75 A;  3EU5 B;  2EAE A;  2VN7 A;  3HXC B;  3VXD A;  2V8J A;  3M73 A;  1IA7 A;  3GT5 A;  1D8E B;  1KS8 A;  1O1S B;  2XWB B;  1N4Q B;  3HXD B;  3M78 A;  4BOK A;  1H3B A;  4M76 A;  1GSZ A;  2GZ6 A;  1N94 B;  3E33 B;  3QRY A;  3QFZ A;  2GH4 A;  3SDQ A;  3D3I A;  1GAI A;  1O79 A;  4D4A A;  4AYR A;  1CEM A;  1TNB B;  3KSQ B;  1KRF A;  2FBA A;  3SAE A;  4GTV B;  1N95 B;  3EUV B;  2BBC A;  2NOJ A;  1D8D B;  4C1S A;  1DL2 A;  4D4B A;  3DSW B;  1FMI A;  3ANJ A;  1KSC A;  2FUZ A;  1V7X A;  1NC5 A;  2R2L B;  1JS4 A;  2XQW A;  3E34 B;  2NVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...