4GTVB

Engineered rabggtase in complex with bms analogue 13
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
327
structure length
324
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSDYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Development of Selective, Potent RabGGTase Inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 119
structure length 324
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 4gtvB00
1O5MB 2PMVA 2G02A 2R2LB 1LD7B 2H6IB 1O6RA 2BB6A 1NI1B 1N95B 1H3AA 1GXOA 3OEDA 2I07B 1JCQB 1QQFA 3DSXB 1UMPA 2SQCA 4M76A 4ONTA 1JCSB 1N4SB 1NL4B 3Q78B 3E34B 4ZRPA 1DCEB 2ZISB 3DRAB 3CU7A 3HXBB 4BOKA 1W6KA 3E32B 1SQCA 3HXEB 1N4PB 1TN6B 4L9PB 3EUVB 2WIIB 2ZIRB 3PZ3B 3DSUB 1N94B 1TNYB 4GTPB 4FXGB 4YDEB 4D4DA 1QBQB 3PZ1B 3PZ4B 1O6HA 1R76A 4C1SA 1HZFA 2A73B 4LNVA 3SQCA 1O79A 4EHMB 5JPNB 4FXKB 1TNUB 1W6JA 3DSWB 4V1RA 2NOJA 1S64B 4V1SA 3HXCB 1TNBB 4D94A 1FT1B 4KKJA 3RJ3A 4GTOB 1H35A 3E33B 2H6FB 3OXUA 1H37A 3Q7AB 4GTTB 1H39A 3D5RA 3Q79B 2V3NA 2IEJB 3EU5B 1TNOB 1H3BA 2WINB 2V8IA 2H6HB 1LD8B 4GTRB 4ZH1A 1JCRB 1N4RB 1GHQA 2F0YB 1GXNA 2GOXA 3C72B 2V3PA 3G6JB 1D8EB 1FT2B 1N4QB 3E37B 3SFXB 1MZCB 1H3CA 1KZPB 4GTQB 3KSLB 2V8KA 3SFYB 1TN8B 1TNZB 5JPMB 5FOBB 2G0DA 1O1SB 1LTXB 2H6GB 2WY8A 1D8DB 1SA5B 2BB5A 2XQWA 1KZOB 1O1TB 4GTMB 1X81B 3KLSA 2BBCA 4ZRQA 1S63B 3DPYB 1QSJA 4GTVB 4GTSB 2V8JA 4D4AA 1FPPB 5FO7B 3D5SA 4LNGB 3Q75B 1N9AB 3KSQB 3Q73B 5FO8B 4YDOB 2WY7A 2XWJB 3HXDB 4KKIA 1SA4B 1O1RB 2XWBB 1C3DA 1GXMA 3K7XA 4MBGB 3HXFB 1O6QA 2BEDB 3PZ2B 3DSSB 3KQ4A 5FO9B 3Q7FB 3DSVB 2B39A 1GSZA 4D4BA 1H36A 4BOJA 3E30B 4LNBB 4MU9A 4D4CA 5AGDA 3DSTB 2PN5A 1TN7B
chains in the Genus database with same CATH superfamily
4TF4A 5GZKA 3RX5A 2G02A 2BB6A 1N95B 4E1YA 2P0VA 2I07B 1JCQB 3P5PA 4DOEA 1N7PA 3DSXB 1QAZA 4ONTA 1JCSB 4OZWA 1N4SB 1LXMA 1HX9A 3E34B 4ZRPA 3DRAB 2CQSA 3QFZA 2FV0A 3T33A 1SQCA 3W7SA 1FAEA 1TN6B 3E7JA 1RWCA 3DSUB 4GTPB 2AFAA 4YDEB 3ANJA 3LZ9A 3H7LA 1LXKA 4WVBA 5GY3A 4C1SA 3G4FA 1G87A 2J5CA 3NFVA 3S4CA 2Z07A 1F9OA 4V1RA 2NOJA 1XWQA 3HXCB 3GZKA 4D94A 2RI9A 3WC3A 1H35A 3E33B 3M7BA 1H37A 2VN4A 1H39A 5EATA 3VXDA 1X1HA 2FV1A 3W5NA 3N0GA 3EU5B 1HMUA 1H14A 1TNOB 3E73A 3M71A 2ZBLA 2JJBA 1UG9A 1RWAA 1JCRB 4ZH5A 3M72A 3VSNA 2WYNA 5CZLA 3ANIA 3SFXB 1H3CA 3W7TA 1GAIA 4J5TA 2V8KA 1N7QA 2BRWA 3WIRA 1N24A 1V7WA 1DL2A 1G9JA 2RI8A 1KZOB 3M02A 1F1SA 3KLSA 1V7XA 4ZRQA 1QSJA 4GTVB 2OKXA 4YCRA 1FPPB 3SDQA 1X9DA 5FO7B 3WKHA 4LNGB 4F10A 1KREA 2EACA 2RGKA 2XWBB 3QXFA 1C3DA 3K7XA 1OJNA 3PZ2B 3DSSB 3KQ4A 1X1IA 2B39A 1N1BA 1GSZA 3AFLA 1H36A 5IK9A 3E30B 3H3KA 2F6DA 3M01A 4F13A 2QNOA 1FBOA 4GTOB 2WCOA 1TN7B 2Q1FA 2FUZA 2EAEA 1LD7B 5C05A 4Z4LA 4RNQA 3A0OA 3RX8A 3OEDA 1HXAA 1N1ZA 2XFGA 2ZZRA 2SQCA 1NL4B 1ULVA 3S9VA 1LF6A 1RW9A 1V5DA 2ZISB 3CU7A 4AYOA 3WKIA 1GLMA 5JMDA 3W7UA 1KWFA 2WIIB 2ZIRB 3QDEA 1TNYB 4AYQA 1N21A 1N7RA 5ILYA 1L2AA 1KSCA 1QBQB 3PZ1B 1F9DA 1O6HA 2A73B 3K11A 4MMHA 1KRFA 5JPNB 4DI5A 4FXKB 1WU4A 1TNUB 3WKGA 1FO2A 5DHKA 5IL3A 4V1SA 1TNBB 4QT9A 5E2JA 2EADA 3RJ3A 1HN0A 2VN7A 3OXUA 5ILIA 1N23A 4EL8A 4GTTB 1HV6A 3ON6A 3Q79B 1NXCA 5IK6A 1H3BA 2WINB 2V8IA 2H6HB 3PYBA 4GTRB 5KKBA 4ZH1A 3W7XA 3ANKA 5JMFA 2D8LA 1D8EB 1FT2B 5MEHA 1MZCB 1CLCA 3KSLB 1H54A 5JPMB 4CE7A 1L1YA 4TXTA 3G4DA 1O1SB 1LTXB 2WY8A 1OJPA 1GAHA 1O1TB 3S4AA 1X81B 2BBCA 3DPYB 4GTSB 5IK0A 3Q75B 1N9AB 3Q73B 1VD5A 5FO8B 3M74A 3WKFA 3HXFB 2BEDB 3M00A 3M73A 2DRSA 4BOJA 4AYPA 1V7VA 4KTRA 1WU6A 3P5RA 4D4CA 5ILKA 3N0FA 1G9GA 3W5MA 3EZ8A 4EHMB 1GA2A 1H12A 5M7YA 1UT9A 1O5MB 1OJMA 3RX7A 2R2LB 2H6IB 1V5CA 4FNVA 3ACTA 3M7CA 3PMMA 3QG0A 3E6UA 3Q78B 2D5JA 1DCEB 3HXBB 2JG0A 3WIWA 4FJQA 3HXEB 1LF9A 3W7WA 1OJOA 1N22A 1NC5A 4FXGB 1RQ5A 3PZ4B 1R76A 1KS8A 4CJ1A 3WIQA 4LNVA 1IA6A 3EQAA 1FMIA 4L6XA 1J0MA 1WZZA 1CB8A 1FT1B 4KKJA 3M7EA 1KFGA 5IKAA 2H6FB 3QFYA 1N7OA 2WDAA 3SDVA 3D5RA 4MMIA 3QRYA 5ILJA 4LIXA 2V3NA 1N20A 4DODA 1N4RB 1GHQA 2JF4A 2GH4A 3X17A 1GXNA 3M78A 3M77A 1H13A 3NNBA 3SFYB 1TN8B 1WU5A 4KTPA 2ONHA 5DHIA 3GLYA 2G0DA 5ILDA 2H6GB 1DOGA 1SA5B 2BRPA 2XQWA 3SDUA 4GTMB 3QSPA 3VW5A 1S63B 4D4AA 1XW2A 5ILZA 1HM3A 1G6IA 3KSQB 3E80A 3HXDB 1JS4A 3VSMA 1AGMA 2AHFA 2NVPA 4ZG8A 1FCEA 1O6QA 4WU0A 2GZ6A 3D3IA 4Q2BA 1FBWA 3DSVB 3S4BA 3RRSA 2DROA 2EABA 4LNBB 5AGDA 1KKTA 3QT3A 1O1RB 2PMVA 1AYXA 1O6RA 1NI1B 1W3YA 1H3AA 1GXOA 4GL3A 1QQFA 1UMPA 4M76A 5CD2A 3SDTA 2E24A 4BOKA 1W6KA 3E32B 1IS9A 1N4PB 4L9PB 3EUVB 3PZ3B 1FO3A 1TF4A 3P2CA 4OK4A 1N94B 4XUVA 3A3VA 4D4DA 4OK2A 4Q88A 1HZFA 2FUQA 1IA7A 1EGUA 3SQCA 5DGQA 1O79A 4FUSA 4OZVA 1J0NA 4OJZA 4WVAA 4CJ0A 1W6JA 2DRQA 3DSWB 5EAUA 1S64B 1RWGA 3EU8A 3M76A 3AFJA 4JJJA 1HXGA 5IM1A 3Q7AB 1F9GA 3WUXA 3QXQA 4GAXA 2X03A 5EASA 5IL8A 2IEJB 3SDRA 3M75A 4AYRA 1HCUA 1RWFA 3M7LA 1I8QA 3RSYA 1FP3A 2DRRA 1LD8B 2A8ZA 2ONGA 2F0YB 2GOXA 2FBAA 3C72B 3G6JB 1XWTA 2V3PA 1N4QB 3E37B 2AHGA 3ACSA 1KZPB 3SAEA 4GTQB 1CEMA 5DGRA 3RENA 1TNZB 1RWHA 4Z4JA 2B4FA 3QT9A 5FOBB 2FUTA 1LOHA 2E22A 1D8DB 2BB5A 1KSDA 1C82A 3S4DA 4NEIA 4WVCA 2V8JA 3CIHA 3D5SA 3H2WA 5IKHA 3TF4A 1X1JA 3QPFA 4YDOB 2WY7A 2XWJB 4KKIA 1HXCA 1SA4B 1K72A 1HM2A 1GXMA 4MBGB 2YIKA 5M7IA 3PYAA 5CA3A 4L0GA 5FO9B 3Q7FB 3GT5A 4D4BA 1HMWA 3QWTA 1N7NA 2BRVX 5ILHA 2CQTA 5GW7A 4MU9A 3DSTB 2PN5A
chains in the Genus database with same CATH topology
4TF4A 5GZKA 3RX5A 2G02A 2BB6A 1N95B 2P0VA 2I07B 1JCQB 3P5PA 4DOEA 3DSXB 4ONTA 1JCSB 1N4SB 3E34B 4ZRPA 3DRAB 2CQSA 3QFZA 2FV0A 3T33A 1SQCA 3W7SA 1FAEA 1TN6B 3DSUB 4GTPB 2AFAA 4YDEB 3ANJA 5GY3A 3H7LA 4WVBA 4C1SA 1G87A 3S4CA 2Z07A 1F9OA 4V1RA 2NOJA 1XWQA 3HXCB 3GZKA 4D94A 2RI9A 3WC3A 1H35A 3E33B 3M7BA 1H37A 2VN4A 1H39A 3VXDA 2FV1A 3W5NA 3EU5B 1H14A 1TNOB 3E73A 3M71A 2ZBLA 2JJBA 1UG9A 1JCRB 4ZH5A 3M72A 2WYNA 5CZLA 3ANIA 3SFXB 1H3CA 3W7TA 1GAIA 4J5TA 2V8KA 3WIRA 1V7WA 1DL2A 1G9JA 2RI8A 1KZOB 3KLSA 1V7XA 4ZRQA 1QSJA 4GTVB 2OKXA 4YCRA 1FPPB 3SDQA 1X9DA 5FO7B 3WKHA 4LNGB 1KREA 2EACA 2RGKA 2XWBB 3QXFA 1C3DA 3K7XA 3PZ2B 3DSSB 3KQ4A 2B39A 1GSZA 1H36A 3E30B 3H3KA 2F6DA 2QNOA 1FBOA 4GTOB 1TN7B 2FUZA 2EAEA 1LD7B 4Z4LA 3RX8A 3OEDA 2XFGA 2ZZRA 2SQCA 1NL4B 1ULVA 3S9VA 1LF6A 1V5DA 2ZISB 3CU7A 4AYOA 3WKIA 1GLMA 3W7UA 1KWFA 2WIIB 2ZIRB 3QDEA 1TNYB 4AYQA 1L2AA 1KSCA 1QBQB 3PZ1B 1F9DA 1O6HA 2A73B 3K11A 1KRFA 5JPNB 4FXKB 1WU4A 1TNUB 3WKGA 1FO2A 4V1SA 1TNBB 4QT9A 5E2JA 2EADA 3RJ3A 2VN7A 3OXUA 4EL8A 4GTTB 3ON6A 3Q79B 1NXCA 1H3BA 2WINB 2V8IA 2H6HB 3PYBA 4GTRB 5KKBA 4ZH1A 3W7XA 3ANKA 2D8LA 1D8EB 1FT2B 5MEHA 1MZCB 1CLCA 3KSLB 1H54A 5JPMB 4CE7A 1L1YA 4TXTA 1O1SB 1LTXB 2WY8A 1GAHA 1O1TB 3S4AA 1X81B 2BBCA 3DPYB 4GTSB 3Q75B 1N9AB 3Q73B 1VD5A 5FO8B 3M74A 3WKFA 3HXFB 2BEDB 3M73A 2DRSA 4BOJA 4AYPA 1V7VA 4KTRA 1WU6A 3P5RA 4D4CA 1G9GA 3W5MA 3EZ8A 4EHMB 1GA2A 1H12A 5M7YA 1UT9A 1O5MB 3RX7A 2R2LB 2H6IB 1V5CA 3ACTA 3M7CA 3PMMA 3QG0A 3E6UA 3Q78B 2D5JA 1DCEB 3HXBB 2JG0A 3WIWA 3HXEB 1LF9A 3W7WA 1NC5A 4FXGB 1RQ5A 3PZ4B 1R76A 1KS8A 4CJ1A 3WIQA 4LNVA 1IA6A 3EQAA 1FMIA 4L6XA 1WZZA 1FT1B 4KKJA 3M7EA 1KFGA 2H6FB 3QFYA 3SDVA 3D5RA 3QRYA 4LIXA 2V3NA 4DODA 1N4RB 1GHQA 2JF4A 2GH4A 3X17A 1GXNA 3M78A 3M77A 1H13A 3SFYB 1TN8B 1WU5A 4KTPA 3GLYA 2G0DA 2H6GB 1DOGA 1SA5B 2XQWA 3SDUA 4GTMB 3QSPA 3VW5A 1S63B 4D4AA 1XW2A 1G6IA 3KSQB 3HXDB 1JS4A 1AGMA 2AHFA 2NVPA 4ZG8A 1FCEA 1O6QA 4WU0A 2GZ6A 3D3IA 4Q2BA 1FBWA 3DSVB 3S4BA 3RRSA 2DROA 2EABA 4LNBB 5AGDA 1KKTA 3QT3A 1O1RB 2PMVA 1AYXA 1O6RA 1NI1B 1H3AA 1GXOA 4GL3A 1QQFA 1UMPA 4M76A 5CD2A 3SDTA 4BOKA 1W6KA 3E32B 1IS9A 1N4PB 4L9PB 3EUVB 3PZ3B 1FO3A 1TF4A 3P2CA 1N94B 4XUVA 3A3VA 4D4DA 4Q88A 1HZFA 1IA7A 3SQCA 5DGQA 1O79A 4FUSA 4WVAA 4CJ0A 1W6JA 2DRQA 3DSWB 1S64B 3EU8A 3M76A 3AFJA 4JJJA 3Q7AB 3WUXA 3QXQA 3SDRA 2IEJB 3M75A 4AYRA 1HCUA 3M7LA 3RSYA 1FP3A 2DRRA 1LD8B 2A8ZA 2F0YB 2GOXA 2FBAA 3C72B 3G6JB 1XWTA 2V3PA 1N4QB 3E37B 2AHGA 3ACSA 1KZPB 3SAEA 4GTQB 1CEMA 5DGRA 3RENA 1TNZB 4Z4JA 2B4FA 3QT9A 5FOBB 1D8DB 2BB5A 1KSDA 3S4DA 4WVCA 2V8JA 3CIHA 3D5SA 3H2WA 3TF4A 3QPFA 4YDOB 2WY7A 2XWJB 4KKIA 1SA4B 1K72A 1GXMA 4MBGB 2YIKA 5M7IA 3PYAA 5CA3A 4L0GA 5FO9B 3Q7FB 3GT5A 4D4BA 3QWTA 2CQTA 5GW7A 4MU9A 3DSTB 2PN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O5M B;  2PMV A;  2G02 A;  2R2L B;  1LD7 B;  2H6I B;  1O6R A;  2BB6 A;  1NI1 B;  1N95 B;  1H3A A;  1GXO A;  3OED A;  2I07 B;  1JCQ B;  1QQF A;  3DSX B;  1UMP A;  2SQC A;  4M76 A;  4ONT A;  1JCS B;  1N4S B;  1NL4 B;  3Q78 B;  3E34 B;  4ZRP A;  1DCE B;  2ZIS B;  3DRA B;  3CU7 A;  3HXB B;  4BOK A;  1W6K A;  3E32 B;  1SQC A;  3HXE B;  1N4P B;  1TN6 B;  4L9P B;  3EUV B;  2WII B;  2ZIR B;  3PZ3 B;  3DSU B;  1N94 B;  1TNY B;  4GTP B;  4FXG B;  4YDE B;  4D4D A;  1QBQ B;  3PZ1 B;  3PZ4 B;  1O6H A;  1R76 A;  4C1S A;  1HZF A;  2A73 B;  4LNV A;  3SQC A;  1O79 A;  4EHM B;  5JPN B;  4FXK B;  1TNU B;  1W6J A;  3DSW B;  4V1R A;  2NOJ A;  1S64 B;  4V1S A;  3HXC B;  1TNB B;  4D94 A;  1FT1 B;  4KKJ A;  3RJ3 A;  4GTO B;  1H35 A;  3E33 B;  2H6F B;  3OXU A;  1H37 A;  3Q7A B;  4GTT B;  1H39 A;  3D5R A;  3Q79 B;  2V3N A;  2IEJ B;  3EU5 B;  1TNO B;  1H3B A;  2WIN B;  2V8I A;  2H6H B;  1LD8 B;  4GTR B;  4ZH1 A;  1JCR B;  1N4R B;  1GHQ A;  2F0Y B;  1GXN A;  2GOX A;  3C72 B;  2V3P A;  3G6J B;  1D8E B;  1FT2 B;  1N4Q B;  3E37 B;  3SFX B;  1MZC B;  1H3C A;  1KZP B;  4GTQ B;  3KSL B;  2V8K A;  3SFY B;  1TN8 B;  1TNZ B;  5JPM B;  5FOB B;  2G0D A;  1O1S B;  1LTX B;  2H6G B;  2WY8 A;  1D8D B;  1SA5 B;  2BB5 A;  2XQW A;  1KZO B;  1O1T B;  4GTM B;  1X81 B;  3KLS A;  2BBC A;  4ZRQ A;  1S63 B;  3DPY B;  1QSJ A;  4GTV B;  4GTS B;  2V8J A;  4D4A A;  1FPP B;  5FO7 B;  3D5S A;  4LNG B;  3Q75 B;  1N9A B;  3KSQ B;  3Q73 B;  5FO8 B;  4YDO B;  2WY7 A;  2XWJ B;  3HXD B;  4KKI A;  1SA4 B;  1O1R B;  2XWB B;  1C3D A;  1GXM A;  3K7X A;  4MBG B;  3HXF B;  1O6Q A;  2BED B;  3PZ2 B;  3DSS B;  3KQ4 A;  5FO9 B;  3Q7F B;  3DSV B;  2B39 A;  1GSZ A;  4D4B A;  1H36 A;  4BOJ A;  3E30 B;  4LNB B;  4MU9 A;  4D4C A;  5AGD A;  3DST B;  2PN5 A;  1TN7 B; 
#chains in the Genus database with same CATH topology
 4TF4 A;  5GZK A;  3RX5 A;  2G02 A;  2BB6 A;  1N95 B;  4E1Y A;  2P0V A;  2I07 B;  1JCQ B;  3P5P A;  4DOE A;  1N7P A;  3DSX B;  1QAZ A;  4ONT A;  1JCS B;  4OZW A;  1N4S B;  1LXM A;  1HX9 A;  3E34 B;  4ZRP A;  3DRA B;  2CQS A;  3QFZ A;  2FV0 A;  3T33 A;  1SQC A;  3W7S A;  1FAE A;  1TN6 B;  3E7J A;  1RWC A;  3DSU B;  4GTP B;  2AFA A;  4YDE B;  3ANJ A;  3LZ9 A;  3H7L A;  1LXK A;  4WVB A;  5GY3 A;  4C1S A;  3G4F A;  1G87 A;  2J5C A;  3NFV A;  3S4C A;  2Z07 A;  1F9O A;  4V1R A;  2NOJ A;  1XWQ A;  3HXC B;  3GZK A;  4D94 A;  2RI9 A;  3WC3 A;  1H35 A;  3E33 B;  3M7B A;  1H37 A;  2VN4 A;  1H39 A;  5EAT A;  3VXD A;  1X1H A;  2FV1 A;  3W5N A;  3N0G A;  3EU5 B;  1HMU A;  1H14 A;  1TNO B;  3E73 A;  3M71 A;  2ZBL A;  2JJB A;  1UG9 A;  1RWA A;  1JCR B;  4ZH5 A;  3M72 A;  3VSN A;  2WYN A;  5CZL A;  3ANI A;  3SFX B;  1H3C A;  3W7T A;  1GAI A;  4J5T A;  2V8K A;  1N7Q A;  2BRW A;  3WIR A;  1N24 A;  1V7W A;  1DL2 A;  1G9J A;  2RI8 A;  1KZO B;  3M02 A;  1F1S A;  3KLS A;  1V7X A;  4ZRQ A;  1QSJ A;  4GTV B;  2OKX A;  4YCR A;  1FPP B;  3SDQ A;  1X9D A;  5FO7 B;  3WKH A;  4LNG B;  4F10 A;  1KRE A;  2EAC A;  2RGK A;  2XWB B;  3QXF A;  1C3D A;  3K7X A;  1OJN A;  3PZ2 B;  3DSS B;  3KQ4 A;  1X1I A;  2B39 A;  1N1B A;  1GSZ A;  3AFL A;  1H36 A;  5IK9 A;  3E30 B;  3H3K A;  2F6D A;  3M01 A;  4F13 A;  2QNO A;  1FBO A;  4GTO B;  2WCO A;  1TN7 B;  2Q1F A;  2FUZ A;  2EAE A;  1LD7 B;  5C05 A;  4Z4L A;  4RNQ A;  3A0O A;  3RX8 A;  3OED A;  1HXA A;  1N1Z A;  2XFG A;  2ZZR A;  2SQC A;  1NL4 B;  1ULV A;  3S9V A;  1LF6 A;  1RW9 A;  1V5D A;  2ZIS B;  3CU7 A;  4AYO A;  3WKI A;  1GLM A;  5JMD A;  3W7U A;  1KWF A;  2WII B;  2ZIR B;  3QDE A;  1TNY B;  4AYQ A;  1N21 A;  1N7R A;  5ILY A;  1L2A A;  1KSC A;  1QBQ B;  3PZ1 B;  1F9D A;  1O6H A;  2A73 B;  3K11 A;  4MMH A;  1KRF A;  5JPN B;  4DI5 A;  4FXK B;  1WU4 A;  1TNU B;  3WKG A;  1FO2 A;  5DHK A;  5IL3 A;  4V1S A;  1TNB B;  4QT9 A;  5E2J A;  2EAD A;  3RJ3 A;  1HN0 A;  2VN7 A;  3OXU A;  5ILI A;  1N23 A;  4EL8 A;  4GTT B;  1HV6 A;  3ON6 A;  3Q79 B;  1NXC A;  5IK6 A;  1H3B A;  2WIN B;  2V8I A;  2H6H B;  3PYB A;  4GTR B;  5KKB A;  4ZH1 A;  3W7X A;  3ANK A;  5JMF A;  2D8L A;  1D8E B;  1FT2 B;  5MEH A;  1MZC B;  1CLC A;  3KSL B;  1H54 A;  5JPM B;  4CE7 A;  1L1Y A;  4TXT A;  3G4D A;  1O1S B;  1LTX B;  2WY8 A;  1OJP A;  1GAH A;  1O1T B;  3S4A A;  1X81 B;  2BBC A;  3DPY B;  4GTS B;  5IK0 A;  3Q75 B;  1N9A B;  3Q73 B;  1VD5 A;  5FO8 B;  3M74 A;  3WKF A;  3HXF B;  2BED B;  3M00 A;  3M73 A;  2DRS A;  4BOJ A;  4AYP A;  1V7V A;  4KTR A;  1WU6 A;  3P5R A;  4D4C A;  5ILK A;  3N0F A;  1G9G A;  3W5M A;  3EZ8 A;  4EHM B;  1GA2 A;  1H12 A;  5M7Y A;  1UT9 A;  1O5M B;  1OJM A;  3RX7 A;  2R2L B;  2H6I B;  1V5C A;  4FNV A;  3ACT A;  3M7C A;  3PMM A;  3QG0 A;  3E6U A;  3Q78 B;  2D5J A;  1DCE B;  3HXB B;  2JG0 A;  3WIW A;  4FJQ A;  3HXE B;  1LF9 A;  3W7W A;  1OJO A;  1N22 A;  1NC5 A;  4FXG B;  1RQ5 A;  3PZ4 B;  1R76 A;  1KS8 A;  4CJ1 A;  3WIQ A;  4LNV A;  1IA6 A;  3EQA A;  1FMI A;  4L6X A;  1J0M A;  1WZZ A;  1CB8 A;  1FT1 B;  4KKJ A;  3M7E A;  1KFG A;  5IKA A;  2H6F B;  3QFY A;  1N7O A;  2WDA A;  3SDV A;  3D5R A;  4MMI A;  3QRY A;  5ILJ A;  4LIX A;  2V3N A;  1N20 A;  4DOD A;  1N4R B;  1GHQ A;  2JF4 A;  2GH4 A;  3X17 A;  1GXN A;  3M78 A;  3M77 A;  1H13 A;  3NNB A;  3SFY B;  1TN8 B;  1WU5 A;  4KTP A;  2ONH A;  5DHI A;  3GLY A;  2G0D A;  5ILD A;  2H6G B;  1DOG A;  1SA5 B;  2BRP A;  2XQW A;  3SDU A;  4GTM B;  3QSP A;  3VW5 A;  1S63 B;  4D4A A;  1XW2 A;  5ILZ A;  1HM3 A;  1G6I A;  3KSQ B;  3E80 A;  3HXD B;  1JS4 A;  3VSM A;  1AGM A;  2AHF A;  2NVP A;  4ZG8 A;  1FCE A;  1O6Q A;  4WU0 A;  2GZ6 A;  3D3I A;  4Q2B A;  1FBW A;  3DSV B;  3S4B A;  3RRS A;  2DRO A;  2EAB A;  4LNB B;  5AGD A;  1KKT A;  3QT3 A;  1O1R B;  2PMV A;  1AYX A;  1O6R A;  1NI1 B;  1W3Y A;  1H3A A;  1GXO A;  4GL3 A;  1QQF A;  1UMP A;  4M76 A;  5CD2 A;  3SDT A;  2E24 A;  4BOK A;  1W6K A;  3E32 B;  1IS9 A;  1N4P B;  4L9P B;  3EUV B;  3PZ3 B;  1FO3 A;  1TF4 A;  3P2C A;  4OK4 A;  1N94 B;  4XUV A;  3A3V A;  4D4D A;  4OK2 A;  4Q88 A;  1HZF A;  2FUQ A;  1IA7 A;  1EGU A;  3SQC A;  5DGQ A;  1O79 A;  4FUS A;  4OZV A;  1J0N A;  4OJZ A;  4WVA A;  4CJ0 A;  1W6J A;  2DRQ A;  3DSW B;  5EAU A;  1S64 B;  1RWG A;  3EU8 A;  3M76 A;  3AFJ A;  4JJJ A;  1HXG A;  5IM1 A;  3Q7A B;  1F9G A;  3WUX A;  3QXQ A;  4GAX A;  2X03 A;  5EAS A;  5IL8 A;  2IEJ B;  3SDR A;  3M75 A;  4AYR A;  1HCU A;  1RWF A;  3M7L A;  1I8Q A;  3RSY A;  1FP3 A;  2DRR A;  1LD8 B;  2A8Z A;  2ONG A;  2F0Y B;  2GOX A;  2FBA A;  3C72 B;  3G6J B;  1XWT A;  2V3P A;  1N4Q B;  3E37 B;  2AHG A;  3ACS A;  1KZP B;  3SAE A;  4GTQ B;  1CEM A;  5DGR A;  3REN A;  1TNZ B;  1RWH A;  4Z4J A;  2B4F A;  3QT9 A;  5FOB B;  2FUT A;  1LOH A;  2E22 A;  1D8D B;  2BB5 A;  1KSD A;  1C82 A;  3S4D A;  4NEI A;  4WVC A;  2V8J A;  3CIH A;  3D5S A;  3H2W A;  5IKH A;  3TF4 A;  1X1J A;  3QPF A;  4YDO B;  2WY7 A;  2XWJ B;  4KKI A;  1HXC A;  1SA4 B;  1K72 A;  1HM2 A;  1GXM A;  4MBG B;  2YIK A;  5M7I A;  3PYA A;  5CA3 A;  4L0G A;  5FO9 B;  3Q7F B;  3GT5 A;  4D4B A;  1HMW A;  3QWT A;  1N7N A;  2BRV X;  5ILH A;  2CQT A;  5GW7 A;  4MU9 A;  3DST B;  2PN5 A; 
#chains in the Genus database with same CATH homology
 4TF4 A;  5GZK A;  3RX5 A;  2G02 A;  2BB6 A;  1N95 B;  2P0V A;  2I07 B;  1JCQ B;  3P5P A;  4DOE A;  3DSX B;  4ONT A;  1JCS B;  1N4S B;  3E34 B;  4ZRP A;  3DRA B;  2CQS A;  3QFZ A;  2FV0 A;  3T33 A;  1SQC A;  3W7S A;  1FAE A;  1TN6 B;  3DSU B;  4GTP B;  2AFA A;  4YDE B;  3ANJ A;  5GY3 A;  3H7L A;  4WVB A;  4C1S A;  1G87 A;  3S4C A;  2Z07 A;  1F9O A;  4V1R A;  2NOJ A;  1XWQ A;  3HXC B;  3GZK A;  4D94 A;  2RI9 A;  3WC3 A;  1H35 A;  3E33 B;  3M7B A;  1H37 A;  2VN4 A;  1H39 A;  3VXD A;  2FV1 A;  3W5N A;  3EU5 B;  1H14 A;  1TNO B;  3E73 A;  3M71 A;  2ZBL A;  2JJB A;  1UG9 A;  1JCR B;  4ZH5 A;  3M72 A;  2WYN A;  5CZL A;  3ANI A;  3SFX B;  1H3C A;  3W7T A;  1GAI A;  4J5T A;  2V8K A;  3WIR A;  1V7W A;  1DL2 A;  1G9J A;  2RI8 A;  1KZO B;  3KLS A;  1V7X A;  4ZRQ A;  1QSJ A;  4GTV B;  2OKX A;  4YCR A;  1FPP B;  3SDQ A;  1X9D A;  5FO7 B;  3WKH A;  4LNG B;  1KRE A;  2EAC A;  2RGK A;  2XWB B;  3QXF A;  1C3D A;  3K7X A;  3PZ2 B;  3DSS B;  3KQ4 A;  2B39 A;  1GSZ A;  1H36 A;  3E30 B;  3H3K A;  2F6D A;  2QNO A;  1FBO A;  4GTO B;  1TN7 B;  2FUZ A;  2EAE A;  1LD7 B;  4Z4L A;  3RX8 A;  3OED A;  2XFG A;  2ZZR A;  2SQC A;  1NL4 B;  1ULV A;  3S9V A;  1LF6 A;  1V5D A;  2ZIS B;  3CU7 A;  4AYO A;  3WKI A;  1GLM A;  3W7U A;  1KWF A;  2WII B;  2ZIR B;  3QDE A;  1TNY B;  4AYQ A;  1L2A A;  1KSC A;  1QBQ B;  3PZ1 B;  1F9D A;  1O6H A;  2A73 B;  3K11 A;  1KRF A;  5JPN B;  4FXK B;  1WU4 A;  1TNU B;  3WKG A;  1FO2 A;  4V1S A;  1TNB B;  4QT9 A;  5E2J A;  2EAD A;  3RJ3 A;  2VN7 A;  3OXU A;  4EL8 A;  4GTT B;  3ON6 A;  3Q79 B;  1NXC A;  1H3B A;  2WIN B;  2V8I A;  2H6H B;  3PYB A;  4GTR B;  5KKB A;  4ZH1 A;  3W7X A;  3ANK A;  2D8L A;  1D8E B;  1FT2 B;  5MEH A;  1MZC B;  1CLC A;  3KSL B;  1H54 A;  5JPM B;  4CE7 A;  1L1Y A;  4TXT A;  1O1S B;  1LTX B;  2WY8 A;  1GAH A;  1O1T B;  3S4A A;  1X81 B;  2BBC A;  3DPY B;  4GTS B;  3Q75 B;  1N9A B;  3Q73 B;  1VD5 A;  5FO8 B;  3M74 A;  3WKF A;  3HXF B;  2BED B;  3M73 A;  2DRS A;  4BOJ A;  4AYP A;  1V7V A;  4KTR A;  1WU6 A;  3P5R A;  4D4C A;  1G9G A;  3W5M A;  3EZ8 A;  4EHM B;  1GA2 A;  1H12 A;  5M7Y A;  1UT9 A;  1O5M B;  3RX7 A;  2R2L B;  2H6I B;  1V5C A;  3ACT A;  3M7C A;  3PMM A;  3QG0 A;  3E6U A;  3Q78 B;  2D5J A;  1DCE B;  3HXB B;  2JG0 A;  3WIW A;  3HXE B;  1LF9 A;  3W7W A;  1NC5 A;  4FXG B;  1RQ5 A;  3PZ4 B;  1R76 A;  1KS8 A;  4CJ1 A;  3WIQ A;  4LNV A;  1IA6 A;  3EQA A;  1FMI A;  4L6X A;  1WZZ A;  1FT1 B;  4KKJ A;  3M7E A;  1KFG A;  2H6F B;  3QFY A;  3SDV A;  3D5R A;  3QRY A;  4LIX A;  2V3N A;  4DOD A;  1N4R B;  1GHQ A;  2JF4 A;  2GH4 A;  3X17 A;  1GXN A;  3M78 A;  3M77 A;  1H13 A;  3SFY B;  1TN8 B;  1WU5 A;  4KTP A;  3GLY A;  2G0D A;  2H6G B;  1DOG A;  1SA5 B;  2XQW A;  3SDU A;  4GTM B;  3QSP A;  3VW5 A;  1S63 B;  4D4A A;  1XW2 A;  1G6I A;  3KSQ B;  3HXD B;  1JS4 A;  1AGM A;  2AHF A;  2NVP A;  4ZG8 A;  1FCE A;  1O6Q A;  4WU0 A;  2GZ6 A;  3D3I A;  4Q2B A;  1FBW A;  3DSV B;  3S4B A;  3RRS A;  2DRO A;  2EAB A;  4LNB B;  5AGD A;  1KKT A;  3QT3 A;  1O1R B;  2PMV A;  1AYX A;  1O6R A;  1NI1 B;  1H3A A;  1GXO A;  4GL3 A;  1QQF A;  1UMP A;  4M76 A;  5CD2 A;  3SDT A;  4BOK A;  1W6K A;  3E32 B;  1IS9 A;  1N4P B;  4L9P B;  3EUV B;  3PZ3 B;  1FO3 A;  1TF4 A;  3P2C A;  1N94 B;  4XUV A;  3A3V A;  4D4D A;  4Q88 A;  1HZF A;  1IA7 A;  3SQC A;  5DGQ A;  1O79 A;  4FUS A;  4WVA A;  4CJ0 A;  1W6J A;  2DRQ A;  3DSW B;  1S64 B;  3EU8 A;  3M76 A;  3AFJ A;  4JJJ A;  3Q7A B;  3WUX A;  3QXQ A;  3SDR A;  2IEJ B;  3M75 A;  4AYR A;  1HCU A;  3M7L A;  3RSY A;  1FP3 A;  2DRR A;  1LD8 B;  2A8Z A;  2F0Y B;  2GOX A;  2FBA A;  3C72 B;  3G6J B;  1XWT A;  2V3P A;  1N4Q B;  3E37 B;  2AHG A;  3ACS A;  1KZP B;  3SAE A;  4GTQ B;  1CEM A;  5DGR A;  3REN A;  1TNZ B;  4Z4J A;  2B4F A;  3QT9 A;  5FOB B;  1D8D B;  2BB5 A;  1KSD A;  3S4D A;  4WVC A;  2V8J A;  3CIH A;  3D5S A;  3H2W A;  3TF4 A;  3QPF A;  4YDO B;  2WY7 A;  2XWJ B;  4KKI A;  1SA4 B;  1K72 A;  1GXM A;  4MBG B;  2YIK A;  5M7I A;  3PYA A;  5CA3 A;  4L0G A;  5FO9 B;  3Q7F B;  3GT5 A;  4D4B A;  3QWT A;  2CQT A;  5GW7 A;  4MU9 A;  3DST B;  2PN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...