3WKHA

Crystal structure of cellobiose 2-epimerase in complex with epilactose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
410
structure length
410
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
total genus 164
structure length 410
sequence length 410
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkhA00
2CQSA 1KSCA 1TF4A 2B4FA 1FP3A 3EQAA 1G9GA 1FO2A 4TF4A 2GH4A 4Z4JA 1DOGA 1G6IA 1ULVA 3QSPA 1GLMA 4FUSA 3QFYA 3QRYA 1H54A 1F9DA 2A8ZA 4CJ1A 4KTPA 4TXTA 1FAEA 4AYOA 3WKFA 3QT3A 3GZKA 3RX8A 1UT9A 2EACA 3RX7A 3CIHA 2RI8A 3ACSA 4L0GA 1L1YA 1XWQA 3W7SA 5MEHA 1IA6A 3W5NA 1KKTA 2GZ6A 2D5JA 2AFAA 3QXFA 3H2WA 2D8LA 4CE7A 2QNOA 2ZZRA 4JJJA 1G9JA 1H14A 3VXDA 3W7UA 3GLYA 1H12A 5GW7A 4KTRA 4DOEA 2RI9A 1V5DA 4Z4LA 4XUVA 3QPFA 1WU6A 2RGKA 3ANJA 1V7VA 1WU5A 1VD5A 1V5CA 2JG0A 3A3VA 5E2JA 1KFGA 3QDEA 1IA7A 3RSYA 3PMMA 4Q88A 2JJBA 2DROA 2EABA 3P2CA 4EL8A 3E6UA 2P0VA 3QFZA 4DODA 3H7LA 1KWFA 1FBWA 2F6DA 3X17A 3EZ8A 1NXCA 4AYPA 2OKXA 5M7IA 4WU0A 4J5TA 2NVPA 3RRSA 1CEMA 1AGMA 4WVCA 3RX5A 1V7WA 1V7XA 5CA3A 3W5MA 1LF6A 1DL2A 3H3KA 4AYQA 3QXQA 1XWTA 5M7YA 3GT5A 3WKHA 3WC3A 1GA2A 4L6XA 2CQTA 5CD2A 2VN4A 1CLCA 2VN7A 3ANIA 3ANKA 2JF4A 1KSDA 2Z07A 1WU4A 1FO3A 2YIKA 1JS4A 2DRRA 1L2AA 3ON6A 3S4CA 1GAHA 2DRQA 4WVBA 2XFGA 4Q2BA 5DGRA 3WIQA 3S4DA 3WKIA 1FCEA 2AHFA 1KRFA 3WUXA 3WIRA 2EAEA 1XW2A 1G87A 2WYNA 3ACTA 1LF9A 2FUZA 1H13A 4ZH5A 3AFJA 1KS8A 2FV1A 5DGQA 3QT9A 1KREA 1WZZA 1FMIA 4CJ0A 3TF4A 5KKBA 3W7WA 1F9OA 3RENA 4WVAA 5GY3A 2AHGA 1FBOA 1IS9A 2FBAA 1AYXA 1HCUA 2ZBLA 3WKGA 3D3IA 3K11A 3W7TA 1NC5A 3QWTA 3VW5A 2EADA 3S4AA 3WIWA 1GAIA 3W7XA 4AYRA 1X9DA 1UG9A 4ZG8A 1RQ5A 5CZLA 3QG0A 3T33A 3E73A 3S4BA 1K72A 2FV0A 2DRSA
chains in the Genus database with same CATH superfamily
1O6RA 1TF4A 3M7EA 3OXUA 3PZ3B 3M01A 1HM3A 5FO8B 4TF4A 4Z4JA 3SDUA 5JMFA 4M76A 3QFYA 4F10A 1F9DA 2A8ZA 3M71A 4KTPA 4E1YA 1FAEA 1HMUA 2H6IB 3RX8A 2EACA 1KZOB 3DRAB 1N24A 4KKIA 1N7RA 1OJNA 3M00A 2D5JA 1H3BA 3QXFA 4EHMB 1KZPB 4JJJA 5JPMB 1UMPA 1H14A 1H12A 3HXBB 4FJQA 4ONTA 3DSUB 2RI9A 1QSJA 5ILHA 2RGKA 3ANJA 1W6KA 1V7VA 1WU5A 1VD5A 1V5CA 1F1SA 1KFGA 3QDEA 2E24A 2JJBA 5IK9A 4GTSB 1GSZA 2R2LB 1GXMA 3M7LA 5DHKA 3G6JB 1I8QA 2F6DA 1NXCA 4AYPA 2WY8A 2OKXA 1NL4B 5IK6A 2XWJB 5M7IA 4WU0A 4WVCA 3RX5A 5CA3A 5IM1A 1LF6A 1DL2A 3QXQA 5M7YA 4QT9A 4LIXA 1R76A 5AGDA 3ANIA 5ILYA 3E33B 1TN8B 3ANKA 2JF4A 1FO3A 2YIKA 2DRRA 5EASA 1L2AA 5EATA 3SDRA 3Q7FB 3WIRA 3VSMA 1EGUA 3DSTB 2H6FB 1G87A 2GOXA 3ACTA 1H13A 1FPPB 3C72B 4OK2A 1KREA 1O79A 1WZZA 4GTQB 3W7WA 2H6HB 4D4AA 2AHGA 1D8DB 3SQCA 4D4DA 1FBOA 5ILKA 2FBAA 3PYBA 5IK0A 2SQCA 3D3IA 3VW5A 3E7JA 4AYRA 1UG9A 3HXFB 1HZFA 1J0MA 5CZLA 2ZIRB 4D4BA 3M73A 1KSCA 1TN7B 1FP3A 1DCEB 4FUSA 1G6IA 3KSLB 2Q1FA 4KKJA 1GXOA 4C1SA 1GXNA 3Q73B 4AYOA 5ILJA 2BRPA 3Q7AB 3CIHA 2RI8A 1H3CA 4YCRA 3DSVB 1H36A 4OZWA 4L9PB 3W5NA 3G4FA 3M7BA 1LTXB 4D4CA 1X1HA 4YDEB 1GHQA 1N7OA 2D8LA 2IEJB 2ZZRA 4OZVA 3VXDA 3W7UA 1V5DA 2ONGA 4XUVA 4Z4LA 1HMWA 1TN6B 3DSSB 3A3VA 1IA7A 2XQWA 3PMMA 2DROA 2EABA 3P2CA 2V8IA 3E6UA 4FNVA 2WY7A 1RWFA 1FBWA 3X17A 3EZ8A 1HX9A 3M76A 2WINB 1N7QA 1V7WA 1V7XA 4OJZA 3H3KA 1XWTA 3DSWB 4L6XA 3M78A 2BEDB 1LD8B 1HV6A 4LNVA 5ILIA 1QAZA 4GTPB 1LXKA 3EU5B 3NNBA 3HXCB 1O1RB 3PZ2B 2G02A 4Q2BA 1D8EB 3WKIA 5IL8A 4RNQA 1O1TB 3N0FA 1MZCB 1KS8A 1N4SB 2FV1A 5DGQA 4V1RA 4ZRPA 4CJ0A 4BOKA 3DPYB 5GY3A 2BRVX 3WKGA 1NC5A 2EADA 3WIWA 1N23A 4GTMB 3A0OA 2H6GB 1N95B 1LD7B 3Q75B 2X03A 4GTVB 3S4BA 2ONHA 2PN5A 2CQSA 3D5RA 4DI5A 3EQAA 1G9GA 1H39A 1FO2A 2GH4A 4GAXA 4OK4A 3PZ1B 5FO9B 2WCOA 1J0NA 1F9GA 1X1IA 3RX7A 5JMDA 1TNZB 3ACSA 1N1ZA 3Q79B 2FUTA 5IL3A 1RWAA 1RWCA 5MEHA 1H35A 2J5CA 4GTTB 5EAUA 1KKTA 2GZ6A 5ILDA 4CE7A 4BOJA 3OEDA 3GLYA 5GW7A 1HN0A 4KTRA 1JCSB 3PYAA 1N4PB 1W6JA 3VSNA 3PZ4B 3QPFA 3G4DA 3D5SA 2JG0A 3HXDB 1N20A 3RSYA 4Q88A 1OJPA 3EU8A 3KQ4A 5DHIA 3E30B 4DODA 1KWFA 3SDTA 4F13A 3KLSA 1HM2A 5IKHA 1N9AB 4FXGB 1S64B 2NVPA 1AGMA 3P5RA 4V1SA 3DSXB 5FO7B 3AFLA 3SDQA 3WC3A 3N0GA 3LZ9A 1O5MB 2VN4A 3SFYB 5ILZA 2FUQA 1KSDA 2Z07A 1JS4A 2BB5A 3ON6A 3HXEB 4WVBA 4LNBB 3E80A 2XFGA 1N21A 3M02A 5DGRA 3WIQA 1NI1B 1O6HA 2AHFA 3WUXA 1KRFA 3M75A 2WYNA 1LF9A 2FUZA 4ZH5A 3AFJA 3EUVB 3QT9A 4NEIA 3TF4A 5KKBA 3RENA 1SA5B 2BRWA 1HCUA 1SQCA 3K11A 1CB8A 1N7NA 4D94A 3W7XA 5GZKA 3M7CA 4ZG8A 3E37B 3K7XA 2A73B 3CU7A 2G0DA 4GTRB 3T33A 3E32B 3M72A 2B4FA 5JPNB 1C82A 1TNBB 1DOGA 1O1SB 1ULVA 3QSPA 1GLMA 1H3AA 3M74A 3QRYA 1H54A 4CJ1A 3S9VA 4TXTA 3WKFA 1HXGA 3QT3A 3GZKA 1UT9A 3E34B 3NFVA 4L0GA 1L1YA 1XWQA 3RJ3A 3W7SA 4ZH1A 2I07B 2PMVA 1IA6A 2AFAA 3H2WA 1O6QA 1SA4B 4MMHA 2QNOA 1G9JA 1H37A 4DOEA 4MMIA 1LXMA 2BBCA 1QBQB 1N4RB 1JCQB 1WU6A 2V3PA 4GTOB 2BB6A 5E2JA 1RWHA 2F0YB 3SFXB 3Q78B 1S63B 4EL8A 1HXCA 2P0VA 3QFZA 3H7LA 4MBGB 2ZISB 1LOHA 5C05A 1HXAA 4MU9A 4J5TA 1N7PA 3RRSA 1CEMA 1OJMA 3W5MA 2V8JA 4AYQA 3GT5A 3WKHA 1TNOB 1GA2A 2V8KA 3SDVA 2CQTA 2NOJA 5CD2A 1CLCA 2VN7A 2V3NA 1X81B 1WU4A 4YDOB 5IKAA 3S4CA 3M77A 1N1BA 3KSQB 1GAHA 2DRQA 3S4DA 3P5PA 1FCEA 2E22A 1N22A 2EAEA 1N94B 1XW2A 3SAEA 1RWGA 1TNUB 1JCRB 1X1JA 2XWBB 2WDAA 1FMIA 1F9OA 2B39A 4WVAA 4ZRQA 2WIIB 1W3YA 4FXKB 5FOBB 1IS9A 2ZBLA 1AYXA 1QQFA 1RW9A 3W7TA 1N4QB 3QWTA 3S4AA 1C3DA 1GAIA 1X9DA 1FT1B 1RQ5A 4LNGB 3QG0A 4GL3A 1FT2B 1TNYB 3E73A 1K72A 2FV0A 2DRSA 1OJOA
chains in the Genus database with same CATH topology
1O6RA 1TF4A 3M7EA 3OXUA 3PZ3B 5FO8B 4TF4A 4Z4JA 3SDUA 4M76A 3QFYA 1F9DA 2A8ZA 3M71A 4KTPA 1FAEA 2H6IB 3RX8A 2EACA 1KZOB 3DRAB 4KKIA 2D5JA 1H3BA 3QXFA 4EHMB 1KZPB 4JJJA 5JPMB 1UMPA 1H14A 1H12A 3HXBB 4ONTA 3DSUB 2RI9A 1QSJA 2RGKA 3ANJA 1W6KA 1V7VA 1WU5A 1VD5A 1V5CA 1KFGA 3QDEA 2JJBA 4GTSB 1GSZA 2R2LB 1GXMA 3M7LA 3G6JB 2F6DA 1NXCA 4AYPA 2WY8A 2OKXA 1NL4B 2XWJB 5M7IA 4WU0A 4WVCA 3RX5A 5CA3A 1LF6A 1DL2A 3QXQA 5M7YA 4QT9A 4LIXA 1R76A 5AGDA 3ANIA 3E33B 1TN8B 3ANKA 2JF4A 1FO3A 2YIKA 2DRRA 1L2AA 3SDRA 3Q7FB 3WIRA 3DSTB 2H6FB 1G87A 2GOXA 3ACTA 1H13A 1FPPB 3C72B 1KREA 1O79A 1WZZA 4GTQB 3W7WA 2H6HB 4D4AA 2AHGA 1D8DB 3SQCA 4D4DA 1FBOA 2FBAA 3PYBA 2SQCA 3D3IA 3VW5A 4AYRA 1UG9A 3HXFB 1HZFA 5CZLA 2ZIRB 4D4BA 3M73A 1KSCA 1TN7B 1FP3A 1DCEB 4FUSA 1G6IA 3KSLB 4KKJA 1GXOA 4C1SA 1GXNA 3Q73B 4AYOA 3Q7AB 3CIHA 2RI8A 1H3CA 4YCRA 3DSVB 1H36A 4L9PB 3W5NA 3M7BA 1LTXB 4D4CA 4YDEB 1GHQA 2D8LA 2IEJB 2ZZRA 3VXDA 3W7UA 1V5DA 4Z4LA 4XUVA 1TN6B 3DSSB 3A3VA 1IA7A 2XQWA 3PMMA 2DROA 2EABA 3P2CA 2V8IA 3E6UA 2WY7A 1FBWA 3X17A 3EZ8A 3M76A 2WINB 1V7WA 1V7XA 3H3KA 1XWTA 3DSWB 4L6XA 3M78A 2BEDB 1LD8B 4LNVA 4GTPB 3EU5B 3HXCB 1O1RB 3PZ2B 2G02A 4Q2BA 1D8EB 3WKIA 1O1TB 1MZCB 1KS8A 1N4SB 2FV1A 5DGQA 4V1RA 4ZRPA 4CJ0A 4BOKA 3DPYB 5GY3A 3WKGA 1NC5A 2EADA 3WIWA 4GTMB 2H6GB 1N95B 1LD7B 3Q75B 4GTVB 3S4BA 2PN5A 2CQSA 3D5RA 3EQAA 1G9GA 1H39A 1FO2A 2GH4A 3PZ1B 5FO9B 3RX7A 1TNZB 3ACSA 3Q79B 5MEHA 1H35A 4GTTB 1KKTA 2GZ6A 4CE7A 4BOJA 3OEDA 3GLYA 5GW7A 4KTRA 1JCSB 3PYAA 1N4PB 1W6JA 3PZ4B 3QPFA 3D5SA 2JG0A 3HXDB 3RSYA 4Q88A 3EU8A 3KQ4A 3E30B 4DODA 1KWFA 3SDTA 3KLSA 1N9AB 4FXGB 1S64B 2NVPA 1AGMA 3P5RA 4V1SA 3DSXB 5FO7B 3SDQA 3WC3A 1O5MB 2VN4A 3SFYB 1KSDA 2Z07A 1JS4A 2BB5A 3ON6A 3HXEB 4WVBA 4LNBB 2XFGA 5DGRA 3WIQA 1NI1B 1O6HA 2AHFA 3WUXA 1KRFA 3M75A 2WYNA 1LF9A 2FUZA 4ZH5A 3AFJA 3EUVB 3QT9A 3TF4A 5KKBA 3RENA 1SA5B 1HCUA 1SQCA 3K11A 4D94A 3W7XA 5GZKA 3M7CA 4ZG8A 3E37B 3K7XA 2A73B 3CU7A 2G0DA 4GTRB 3T33A 3E32B 3M72A 2B4FA 5JPNB 1TNBB 1DOGA 1O1SB 1ULVA 3QSPA 1GLMA 1H3AA 3M74A 3QRYA 1H54A 4CJ1A 3S9VA 4TXTA 3WKFA 3QT3A 3GZKA 1UT9A 3E34B 4L0GA 1L1YA 1XWQA 3RJ3A 3W7SA 4ZH1A 2I07B 2PMVA 1IA6A 2AFAA 3H2WA 1O6QA 1SA4B 2QNOA 1G9JA 1H37A 4DOEA 2BBCA 1QBQB 1N4RB 1JCQB 1WU6A 2V3PA 4GTOB 2BB6A 5E2JA 2F0YB 3SFXB 3Q78B 1S63B 4EL8A 2P0VA 3QFZA 3H7LA 4MBGB 2ZISB 4MU9A 4J5TA 3RRSA 1CEMA 3W5MA 2V8JA 4AYQA 3GT5A 3WKHA 1TNOB 1GA2A 2V8KA 3SDVA 2CQTA 2NOJA 5CD2A 1CLCA 2VN7A 2V3NA 1X81B 1WU4A 4YDOB 3S4CA 3M77A 3KSQB 1GAHA 2DRQA 3S4DA 3P5PA 1FCEA 2EAEA 1N94B 1XW2A 3SAEA 1TNUB 1JCRB 2XWBB 1FMIA 1F9OA 2B39A 4WVAA 4ZRQA 2WIIB 4FXKB 5FOBB 1IS9A 2ZBLA 1AYXA 1QQFA 3W7TA 1N4QB 3QWTA 3S4AA 1C3DA 1GAIA 1X9DA 1FT1B 1RQ5A 4LNGB 3QG0A 4GL3A 1FT2B 1TNYB 3E73A 1K72A 2FV0A 2DRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQS A;  1KSC A;  1TF4 A;  2B4F A;  1FP3 A;  3EQA A;  1G9G A;  1FO2 A;  4TF4 A;  2GH4 A;  4Z4J A;  1DOG A;  1G6I A;  1ULV A;  3QSP A;  1GLM A;  4FUS A;  3QFY A;  3QRY A;  1H54 A;  1F9D A;  2A8Z A;  4CJ1 A;  4KTP A;  4TXT A;  1FAE A;  4AYO A;  3WKF A;  3QT3 A;  3GZK A;  3RX8 A;  1UT9 A;  2EAC A;  3RX7 A;  3CIH A;  2RI8 A;  3ACS A;  4L0G A;  1L1Y A;  1XWQ A;  3W7S A;  5MEH A;  1IA6 A;  3W5N A;  1KKT A;  2GZ6 A;  2D5J A;  2AFA A;  3QXF A;  3H2W A;  2D8L A;  4CE7 A;  2QNO A;  2ZZR A;  4JJJ A;  1G9J A;  1H14 A;  3VXD A;  3W7U A;  3GLY A;  1H12 A;  5GW7 A;  4KTR A;  4DOE A;  2RI9 A;  1V5D A;  4Z4L A;  4XUV A;  3QPF A;  1WU6 A;  2RGK A;  3ANJ A;  1V7V A;  1WU5 A;  1VD5 A;  1V5C A;  2JG0 A;  3A3V A;  5E2J A;  1KFG A;  3QDE A;  1IA7 A;  3RSY A;  3PMM A;  4Q88 A;  2JJB A;  2DRO A;  2EAB A;  3P2C A;  4EL8 A;  3E6U A;  2P0V A;  3QFZ A;  4DOD A;  3H7L A;  1KWF A;  1FBW A;  2F6D A;  3X17 A;  3EZ8 A;  1NXC A;  4AYP A;  2OKX A;  5M7I A;  4WU0 A;  4J5T A;  2NVP A;  3RRS A;  1CEM A;  1AGM A;  4WVC A;  3RX5 A;  1V7W A;  1V7X A;  5CA3 A;  3W5M A;  1LF6 A;  1DL2 A;  3H3K A;  4AYQ A;  3QXQ A;  1XWT A;  5M7Y A;  3GT5 A;  3WKH A;  3WC3 A;  1GA2 A;  4L6X A;  2CQT A;  5CD2 A;  2VN4 A;  1CLC A;  2VN7 A;  3ANI A;  3ANK A;  2JF4 A;  1KSD A;  2Z07 A;  1WU4 A;  1FO3 A;  2YIK A;  1JS4 A;  2DRR A;  1L2A A;  3ON6 A;  3S4C A;  1GAH A;  2DRQ A;  4WVB A;  2XFG A;  4Q2B A;  5DGR A;  3WIQ A;  3S4D A;  3WKI A;  1FCE A;  2AHF A;  1KRF A;  3WUX A;  3WIR A;  2EAE A;  1XW2 A;  1G87 A;  2WYN A;  3ACT A;  1LF9 A;  2FUZ A;  1H13 A;  4ZH5 A;  3AFJ A;  1KS8 A;  2FV1 A;  5DGQ A;  3QT9 A;  1KRE A;  1WZZ A;  1FMI A;  4CJ0 A;  3TF4 A;  5KKB A;  3W7W A;  1F9O A;  3REN A;  4WVA A;  5GY3 A;  2AHG A;  1FBO A;  1IS9 A;  2FBA A;  1AYX A;  1HCU A;  2ZBL A;  3WKG A;  3D3I A;  3K11 A;  3W7T A;  1NC5 A;  3QWT A;  3VW5 A;  2EAD A;  3S4A A;  3WIW A;  1GAI A;  3W7X A;  4AYR A;  1X9D A;  1UG9 A;  4ZG8 A;  1RQ5 A;  5CZL A;  3QG0 A;  3T33 A;  3E73 A;  3S4B A;  1K72 A;  2FV0 A;  2DRS A; 
#chains in the Genus database with same CATH topology
 1O6R A;  1TF4 A;  3M7E A;  3OXU A;  3PZ3 B;  3M01 A;  1HM3 A;  5FO8 B;  4TF4 A;  4Z4J A;  3SDU A;  5JMF A;  4M76 A;  3QFY A;  4F10 A;  1F9D A;  2A8Z A;  3M71 A;  4KTP A;  4E1Y A;  1FAE A;  1HMU A;  2H6I B;  3RX8 A;  2EAC A;  1KZO B;  3DRA B;  1N24 A;  4KKI A;  1N7R A;  1OJN A;  3M00 A;  2D5J A;  1H3B A;  3QXF A;  4EHM B;  1KZP B;  4JJJ A;  5JPM B;  1UMP A;  1H14 A;  1H12 A;  3HXB B;  4FJQ A;  4ONT A;  3DSU B;  2RI9 A;  1QSJ A;  5ILH A;  2RGK A;  3ANJ A;  1W6K A;  1V7V A;  1WU5 A;  1VD5 A;  1V5C A;  1F1S A;  1KFG A;  3QDE A;  2E24 A;  2JJB A;  5IK9 A;  4GTS B;  1GSZ A;  2R2L B;  1GXM A;  3M7L A;  5DHK A;  3G6J B;  1I8Q A;  2F6D A;  1NXC A;  4AYP A;  2WY8 A;  2OKX A;  1NL4 B;  5IK6 A;  2XWJ B;  5M7I A;  4WU0 A;  4WVC A;  3RX5 A;  5CA3 A;  5IM1 A;  1LF6 A;  1DL2 A;  3QXQ A;  5M7Y A;  4QT9 A;  4LIX A;  1R76 A;  5AGD A;  3ANI A;  5ILY A;  3E33 B;  1TN8 B;  3ANK A;  2JF4 A;  1FO3 A;  2YIK A;  2DRR A;  5EAS A;  1L2A A;  5EAT A;  3SDR A;  3Q7F B;  3WIR A;  3VSM A;  1EGU A;  3DST B;  2H6F B;  1G87 A;  2GOX A;  3ACT A;  1H13 A;  1FPP B;  3C72 B;  4OK2 A;  1KRE A;  1O79 A;  1WZZ A;  4GTQ B;  3W7W A;  2H6H B;  4D4A A;  2AHG A;  1D8D B;  3SQC A;  4D4D A;  1FBO A;  5ILK A;  2FBA A;  3PYB A;  5IK0 A;  2SQC A;  3D3I A;  3VW5 A;  3E7J A;  4AYR A;  1UG9 A;  3HXF B;  1HZF A;  1J0M A;  5CZL A;  2ZIR B;  4D4B A;  3M73 A;  1KSC A;  1TN7 B;  1FP3 A;  1DCE B;  4FUS A;  1G6I A;  3KSL B;  2Q1F A;  4KKJ A;  1GXO A;  4C1S A;  1GXN A;  3Q73 B;  4AYO A;  5ILJ A;  2BRP A;  3Q7A B;  3CIH A;  2RI8 A;  1H3C A;  4YCR A;  3DSV B;  1H36 A;  4OZW A;  4L9P B;  3W5N A;  3G4F A;  3M7B A;  1LTX B;  4D4C A;  1X1H A;  4YDE B;  1GHQ A;  1N7O A;  2D8L A;  2IEJ B;  2ZZR A;  4OZV A;  3VXD A;  3W7U A;  1V5D A;  2ONG A;  4XUV A;  4Z4L A;  1HMW A;  1TN6 B;  3DSS B;  3A3V A;  1IA7 A;  2XQW A;  3PMM A;  2DRO A;  2EAB A;  3P2C A;  2V8I A;  3E6U A;  4FNV A;  2WY7 A;  1RWF A;  1FBW A;  3X17 A;  3EZ8 A;  1HX9 A;  3M76 A;  2WIN B;  1N7Q A;  1V7W A;  1V7X A;  4OJZ A;  3H3K A;  1XWT A;  3DSW B;  4L6X A;  3M78 A;  2BED B;  1LD8 B;  1HV6 A;  4LNV A;  5ILI A;  1QAZ A;  4GTP B;  1LXK A;  3EU5 B;  3NNB A;  3HXC B;  1O1R B;  3PZ2 B;  2G02 A;  4Q2B A;  1D8E B;  3WKI A;  5IL8 A;  4RNQ A;  1O1T B;  3N0F A;  1MZC B;  1KS8 A;  1N4S B;  2FV1 A;  5DGQ A;  4V1R A;  4ZRP A;  4CJ0 A;  4BOK A;  3DPY B;  5GY3 A;  2BRV X;  3WKG A;  1NC5 A;  2EAD A;  3WIW A;  1N23 A;  4GTM B;  3A0O A;  2H6G B;  1N95 B;  1LD7 B;  3Q75 B;  2X03 A;  4GTV B;  3S4B A;  2ONH A;  2PN5 A;  2CQS A;  3D5R A;  4DI5 A;  3EQA A;  1G9G A;  1H39 A;  1FO2 A;  2GH4 A;  4GAX A;  4OK4 A;  3PZ1 B;  5FO9 B;  2WCO A;  1J0N A;  1F9G A;  1X1I A;  3RX7 A;  5JMD A;  1TNZ B;  3ACS A;  1N1Z A;  3Q79 B;  2FUT A;  5IL3 A;  1RWA A;  1RWC A;  5MEH A;  1H35 A;  2J5C A;  4GTT B;  5EAU A;  1KKT A;  2GZ6 A;  5ILD A;  4CE7 A;  4BOJ A;  3OED A;  3GLY A;  5GW7 A;  1HN0 A;  4KTR A;  1JCS B;  3PYA A;  1N4P B;  1W6J A;  3VSN A;  3PZ4 B;  3QPF A;  3G4D A;  3D5S A;  2JG0 A;  3HXD B;  1N20 A;  3RSY A;  4Q88 A;  1OJP A;  3EU8 A;  3KQ4 A;  5DHI A;  3E30 B;  4DOD A;  1KWF A;  3SDT A;  4F13 A;  3KLS A;  1HM2 A;  5IKH A;  1N9A B;  4FXG B;  1S64 B;  2NVP A;  1AGM A;  3P5R A;  4V1S A;  3DSX B;  5FO7 B;  3AFL A;  3SDQ A;  3WC3 A;  3N0G A;  3LZ9 A;  1O5M B;  2VN4 A;  3SFY B;  5ILZ A;  2FUQ A;  1KSD A;  2Z07 A;  1JS4 A;  2BB5 A;  3ON6 A;  3HXE B;  4WVB A;  4LNB B;  3E80 A;  2XFG A;  1N21 A;  3M02 A;  5DGR A;  3WIQ A;  1NI1 B;  1O6H A;  2AHF A;  3WUX A;  1KRF A;  3M75 A;  2WYN A;  1LF9 A;  2FUZ A;  4ZH5 A;  3AFJ A;  3EUV B;  3QT9 A;  4NEI A;  3TF4 A;  5KKB A;  3REN A;  1SA5 B;  2BRW A;  1HCU A;  1SQC A;  3K11 A;  1CB8 A;  1N7N A;  4D94 A;  3W7X A;  5GZK A;  3M7C A;  4ZG8 A;  3E37 B;  3K7X A;  2A73 B;  3CU7 A;  2G0D A;  4GTR B;  3T33 A;  3E32 B;  3M72 A;  2B4F A;  5JPN B;  1C82 A;  1TNB B;  1DOG A;  1O1S B;  1ULV A;  3QSP A;  1GLM A;  1H3A A;  3M74 A;  3QRY A;  1H54 A;  4CJ1 A;  3S9V A;  4TXT A;  3WKF A;  1HXG A;  3QT3 A;  3GZK A;  1UT9 A;  3E34 B;  3NFV A;  4L0G A;  1L1Y A;  1XWQ A;  3RJ3 A;  3W7S A;  4ZH1 A;  2I07 B;  2PMV A;  1IA6 A;  2AFA A;  3H2W A;  1O6Q A;  1SA4 B;  4MMH A;  2QNO A;  1G9J A;  1H37 A;  4DOE A;  4MMI A;  1LXM A;  2BBC A;  1QBQ B;  1N4R B;  1JCQ B;  1WU6 A;  2V3P A;  4GTO B;  2BB6 A;  5E2J A;  1RWH A;  2F0Y B;  3SFX B;  3Q78 B;  1S63 B;  4EL8 A;  1HXC A;  2P0V A;  3QFZ A;  3H7L A;  4MBG B;  2ZIS B;  1LOH A;  5C05 A;  1HXA A;  4MU9 A;  4J5T A;  1N7P A;  3RRS A;  1CEM A;  1OJM A;  3W5M A;  2V8J A;  4AYQ A;  3GT5 A;  3WKH A;  1TNO B;  1GA2 A;  2V8K A;  3SDV A;  2CQT A;  2NOJ A;  5CD2 A;  1CLC A;  2VN7 A;  2V3N A;  1X81 B;  1WU4 A;  4YDO B;  5IKA A;  3S4C A;  3M77 A;  1N1B A;  3KSQ B;  1GAH A;  2DRQ A;  3S4D A;  3P5P A;  1FCE A;  2E22 A;  1N22 A;  2EAE A;  1N94 B;  1XW2 A;  3SAE A;  1RWG A;  1TNU B;  1JCR B;  1X1J A;  2XWB B;  2WDA A;  1FMI A;  1F9O A;  2B39 A;  4WVA A;  4ZRQ A;  2WII B;  1W3Y A;  4FXK B;  5FOB B;  1IS9 A;  2ZBL A;  1AYX A;  1QQF A;  1RW9 A;  3W7T A;  1N4Q B;  3QWT A;  3S4A A;  1C3D A;  1GAI A;  1X9D A;  1FT1 B;  1RQ5 A;  4LNG B;  3QG0 A;  4GL3 A;  1FT2 B;  1TNY B;  3E73 A;  1K72 A;  2FV0 A;  2DRS A;  1OJO A; 
#chains in the Genus database with same CATH homology
 1O6R A;  1TF4 A;  3M7E A;  3OXU A;  3PZ3 B;  5FO8 B;  4TF4 A;  4Z4J A;  3SDU A;  4M76 A;  3QFY A;  1F9D A;  2A8Z A;  3M71 A;  4KTP A;  1FAE A;  2H6I B;  3RX8 A;  2EAC A;  1KZO B;  3DRA B;  4KKI A;  2D5J A;  1H3B A;  3QXF A;  4EHM B;  1KZP B;  4JJJ A;  5JPM B;  1UMP A;  1H14 A;  1H12 A;  3HXB B;  4ONT A;  3DSU B;  2RI9 A;  1QSJ A;  2RGK A;  3ANJ A;  1W6K A;  1V7V A;  1WU5 A;  1VD5 A;  1V5C A;  1KFG A;  3QDE A;  2JJB A;  4GTS B;  1GSZ A;  2R2L B;  1GXM A;  3M7L A;  3G6J B;  2F6D A;  1NXC A;  4AYP A;  2WY8 A;  2OKX A;  1NL4 B;  2XWJ B;  5M7I A;  4WU0 A;  4WVC A;  3RX5 A;  5CA3 A;  1LF6 A;  1DL2 A;  3QXQ A;  5M7Y A;  4QT9 A;  4LIX A;  1R76 A;  5AGD A;  3ANI A;  3E33 B;  1TN8 B;  3ANK A;  2JF4 A;  1FO3 A;  2YIK A;  2DRR A;  1L2A A;  3SDR A;  3Q7F B;  3WIR A;  3DST B;  2H6F B;  1G87 A;  2GOX A;  3ACT A;  1H13 A;  1FPP B;  3C72 B;  1KRE A;  1O79 A;  1WZZ A;  4GTQ B;  3W7W A;  2H6H B;  4D4A A;  2AHG A;  1D8D B;  3SQC A;  4D4D A;  1FBO A;  2FBA A;  3PYB A;  2SQC A;  3D3I A;  3VW5 A;  4AYR A;  1UG9 A;  3HXF B;  1HZF A;  5CZL A;  2ZIR B;  4D4B A;  3M73 A;  1KSC A;  1TN7 B;  1FP3 A;  1DCE B;  4FUS A;  1G6I A;  3KSL B;  4KKJ A;  1GXO A;  4C1S A;  1GXN A;  3Q73 B;  4AYO A;  3Q7A B;  3CIH A;  2RI8 A;  1H3C A;  4YCR A;  3DSV B;  1H36 A;  4L9P B;  3W5N A;  3M7B A;  1LTX B;  4D4C A;  4YDE B;  1GHQ A;  2D8L A;  2IEJ B;  2ZZR A;  3VXD A;  3W7U A;  1V5D A;  4Z4L A;  4XUV A;  1TN6 B;  3DSS B;  3A3V A;  1IA7 A;  2XQW A;  3PMM A;  2DRO A;  2EAB A;  3P2C A;  2V8I A;  3E6U A;  2WY7 A;  1FBW A;  3X17 A;  3EZ8 A;  3M76 A;  2WIN B;  1V7W A;  1V7X A;  3H3K A;  1XWT A;  3DSW B;  4L6X A;  3M78 A;  2BED B;  1LD8 B;  4LNV A;  4GTP B;  3EU5 B;  3HXC B;  1O1R B;  3PZ2 B;  2G02 A;  4Q2B A;  1D8E B;  3WKI A;  1O1T B;  1MZC B;  1KS8 A;  1N4S B;  2FV1 A;  5DGQ A;  4V1R A;  4ZRP A;  4CJ0 A;  4BOK A;  3DPY B;  5GY3 A;  3WKG A;  1NC5 A;  2EAD A;  3WIW A;  4GTM B;  2H6G B;  1N95 B;  1LD7 B;  3Q75 B;  4GTV B;  3S4B A;  2PN5 A;  2CQS A;  3D5R A;  3EQA A;  1G9G A;  1H39 A;  1FO2 A;  2GH4 A;  3PZ1 B;  5FO9 B;  3RX7 A;  1TNZ B;  3ACS A;  3Q79 B;  5MEH A;  1H35 A;  4GTT B;  1KKT A;  2GZ6 A;  4CE7 A;  4BOJ A;  3OED A;  3GLY A;  5GW7 A;  4KTR A;  1JCS B;  3PYA A;  1N4P B;  1W6J A;  3PZ4 B;  3QPF A;  3D5S A;  2JG0 A;  3HXD B;  3RSY A;  4Q88 A;  3EU8 A;  3KQ4 A;  3E30 B;  4DOD A;  1KWF A;  3SDT A;  3KLS A;  1N9A B;  4FXG B;  1S64 B;  2NVP A;  1AGM A;  3P5R A;  4V1S A;  3DSX B;  5FO7 B;  3SDQ A;  3WC3 A;  1O5M B;  2VN4 A;  3SFY B;  1KSD A;  2Z07 A;  1JS4 A;  2BB5 A;  3ON6 A;  3HXE B;  4WVB A;  4LNB B;  2XFG A;  5DGR A;  3WIQ A;  1NI1 B;  1O6H A;  2AHF A;  3WUX A;  1KRF A;  3M75 A;  2WYN A;  1LF9 A;  2FUZ A;  4ZH5 A;  3AFJ A;  3EUV B;  3QT9 A;  3TF4 A;  5KKB A;  3REN A;  1SA5 B;  1HCU A;  1SQC A;  3K11 A;  4D94 A;  3W7X A;  5GZK A;  3M7C A;  4ZG8 A;  3E37 B;  3K7X A;  2A73 B;  3CU7 A;  2G0D A;  4GTR B;  3T33 A;  3E32 B;  3M72 A;  2B4F A;  5JPN B;  1TNB B;  1DOG A;  1O1S B;  1ULV A;  3QSP A;  1GLM A;  1H3A A;  3M74 A;  3QRY A;  1H54 A;  4CJ1 A;  3S9V A;  4TXT A;  3WKF A;  3QT3 A;  3GZK A;  1UT9 A;  3E34 B;  4L0G A;  1L1Y A;  1XWQ A;  3RJ3 A;  3W7S A;  4ZH1 A;  2I07 B;  2PMV A;  1IA6 A;  2AFA A;  3H2W A;  1O6Q A;  1SA4 B;  2QNO A;  1G9J A;  1H37 A;  4DOE A;  2BBC A;  1QBQ B;  1N4R B;  1JCQ B;  1WU6 A;  2V3P A;  4GTO B;  2BB6 A;  5E2J A;  2F0Y B;  3SFX B;  3Q78 B;  1S63 B;  4EL8 A;  2P0V A;  3QFZ A;  3H7L A;  4MBG B;  2ZIS B;  4MU9 A;  4J5T A;  3RRS A;  1CEM A;  3W5M A;  2V8J A;  4AYQ A;  3GT5 A;  3WKH A;  1TNO B;  1GA2 A;  2V8K A;  3SDV A;  2CQT A;  2NOJ A;  5CD2 A;  1CLC A;  2VN7 A;  2V3N A;  1X81 B;  1WU4 A;  4YDO B;  3S4C A;  3M77 A;  3KSQ B;  1GAH A;  2DRQ A;  3S4D A;  3P5P A;  1FCE A;  2EAE A;  1N94 B;  1XW2 A;  3SAE A;  1TNU B;  1JCR B;  2XWB B;  1FMI A;  1F9O A;  2B39 A;  4WVA A;  4ZRQ A;  2WII B;  4FXK B;  5FOB B;  1IS9 A;  2ZBL A;  1AYX A;  1QQF A;  3W7T A;  1N4Q B;  3QWT A;  3S4A A;  1C3D A;  1GAI A;  1X9D A;  1FT1 B;  1RQ5 A;  4LNG B;  3QG0 A;  4GL3 A;  1FT2 B;  1TNY B;  3E73 A;  1K72 A;  2FV0 A;  2DRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...