3WKHA

Crystal structure of cellobiose 2-epimerase in complex with epilactose
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
410
structure length
410
Chain Sequence
TETIPDVRRLRALQAEVHEELTENILKFWATRTHDPVHGGFVGRVGPDGRPHPEAPRGAILNARILWTFAAAYRQLGTPLYREMAERAYRYFVRHFVDAEHGGVYWMVAADGRPLDTRKHVYAQSFAIYALSEWHRATGGEAALALARSIYDLIETHCADRVHGGYVEACDRAWRPLEDARLSAKDAPEPRSMNTHLHVLEAYANLYRVWPETELAARLQALIELFLRAIYHPATGHLILFFDERWRPRSRAVSFGHDIEASWLLLEAVDVLGQATLRPRVQQASLHLARATLAEGRAPDGSLYYEIGEQGHLDTDRHWWPQAEALVGFLNAYQESGEVLFYEAAEDVWRYIRERQRDTRGGEWFARVRDDGAPYPDDKVDFWKGPYHNGRACLEAIQRLRHLLEHVRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellobiose 2-epimerase
publication title Structural Insights into the Epimerization of beta-1,4-Linked Oligosaccharides Catalyzed by Cellobiose 2-Epimerase, the Sole Enzyme Epimerizing Non-anomeric Hydroxyl Groups of Unmodified Sugars
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Isomerase
total genus 164
structure length 410
sequence length 410
ec nomenclature ec 5.1.3.11: Cellobiose epimerase.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07221 GlcNAc_2-epim N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3wkhA00
3W7SA 2VN7A 3W7XA 1H12A 5M7YA 3W5MA 1CEMA 3S4AA 3ANJA 1KSCA 3EZ8A 2FBAA 3QRYA 1L1YA 2CQTA 5MEHA 1F9OA 4AYQA 3T33A 1IS9A 3D3IA 1V7VA 1KS8A 2B4FA 3S4CA 3ON6A 1FMIA 2FV1A 3W5NA 4AYOA 3GZKA 1H54A 1X9DA 2GH4A 3VXDA 1GAIA 2EABA 1IA7A 1TF4A 1H14A 3QSPA 4DOEA 1NC5A 3W7TA 3W7WA 3QXFA 5GW7A 2P0VA 4TXTA 4Q2BA 3RSYA 1V7XA 1VD5A 3ACTA 2YIKA 4CJ1A 3GT5A 3WIRA 3WKFA 3H7LA 5CD2A 1WU6A 3RX5A 1G9JA 2OKXA 2D8LA 3AFJA 4AYPA 3WKGA 1JS4A 4ZG8A 1KREA 3QT3A 1G9GA 4CE7A 1GA2A 1KKTA 2CQSA 3WKIA 1AGMA 2RI9A 5GY3A 4DODA 3RRSA 3VW5A 3S4DA 2FUZA 1GAHA 5DGRA 1AYXA 2EAEA 1GLMA 3H2WA 4WVAA 1FBOA 4WU0A 4FUSA 2ZZRA 2XFGA 3QT9A 4L0GA 4JJJA 2D5JA 1K72A 2JF4A 3ANKA 1G6IA 1H13A 1XW2A 1WU4A 2RI8A 3K11A 1V7WA 1XWTA 4XUVA 1FP3A 2NVPA 3QFYA 2DRQA 1XWQA 3WKHA 3QDEA 1V5DA 4Z4JA 3GLYA 3TF4A 1KSDA 4WVCA 1FCEA 3WIQA 2JJBA 3ANIA 3ACSA 5DGQA 1NXCA 2EADA 3QG0A 5CZLA 1DOGA 3QWTA 2DRRA 1CLCA 1HCUA 1ULVA 2QNOA 4Z4LA 2A8ZA 2WYNA 3WIWA 1KFGA 3QXQA 3X17A 1UG9A 1FAEA 5M7IA 2F6DA 3EQAA 2DROA 3QFZA 4Q88A 1V5CA 5KKBA 1WZZA 2EACA 3S4BA 2AHFA 2JG0A 4CJ0A 4WVBA 1FBWA 1WU5A 3W7UA 1UT9A 3P2CA 1LF9A 3E73A 1LF6A 2Z07A 3PMMA 2RGKA 3H3KA 3QPFA 4AYRA 5E2JA 1IA6A 2FV0A 2GZ6A 4L6XA 4EL8A 1FO2A 3E6UA 1KRFA 3RENA 1KWFA 3WC3A 1DL2A 3CIHA 3WUXA 1FO3A 3A3VA 1L2AA 5CA3A 3RX7A 2VN4A 4KTRA 4KTPA 4ZH5A 2AHGA 4TF4A 2DRSA 1F9DA 2ZBLA 2AFAA 1G87A 4J5TA 1RQ5A 3RX8A
chains in the Genus database with same CATH superfamily
1HXCA 1D8EB 5M7YA 3W5MA 3ANJA 1KSCA 5C05A 3EZ8A 2V8KA 3QRYA 1O79A 2Q1FA 2B4FA 5ILJA 4MMIA 5FO7B 1GAIA 1N4RB 4EHMB 2EABA 4NEIA 4BOJA 4L9PB 3DSTB 1RWCA 3QXFA 4KKIA 2G02A 5GW7A 3HXCB 3OEDA 1S63B 4OZWA 1N20A 3HXBB 4FXKB 3PYBA 1JCSB 1AGMA 4GTRB 1W6JA 3RRSA 2FUZA 5DGRA 3N0FA 2PMVA 2FUTA 1SA5B 1N24A 2PN5A 3E34B 2ONHA 1JCRB 4L0GA 2JF4A 1H13A 2X03A 2RI8A 1XWTA 2H6HB 1HMUA 2H6IB 1FP3A 3VSNA 4GTPB 3WKHA 4Z4JA 1CB8A 4WVCA 1TNOB 1X81B 2EADA 1DOGA 1N95B 5IK0A 3N0GA 2ZIRB 2A8ZA 2J5CA 3QXQA 1UG9A 2DROA 1W6KA 5KKBA 3S4BA 2BRPA 2NOJA 1WU5A 3E73A 1OJOA 2Z07A 4FNVA 3H3KA 5ILHA 3QPFA 2V3PA 5E2JA 4AYRA 4L6XA 1S64B 1KRFA 2E22A 1DL2A 3KQ4A 5ILDA 1L2AA 3HXEB 5DHIA 4V1SA 3SQCA 4KTRA 3C72B 4ZH5A 2H6FB 1OJMA 4GTVB 4D4DA 2WY7A 1O1TB 5JPNB 3RX8A 3W7SA 1CEMA 2FBAA 3G6JB 5FO8B 1RWAA 2CQTA 1HM3A 4AYQA 2BB6A 1IS9A 1I8QA 1V7VA 3Q75B 1KS8A 5EASA 5FO9B 1QAZA 2FV1A 5IK9A 3E37B 2V8IA 4FJQA 4LNBB 3DSXB 1N7PA 1X9DA 2GH4A 3VXDA 4F10A 3M77A 3QSPA 4DOEA 2A73B 2ONGA 1F1SA 3G4DA 2P0VA 1D8DB 4TXTA 4GTMB 4OK4A 4CJ1A 1N7RA 2WIIB 3WIRA 4F13A 1O6QA 3DSWB 5CD2A 1WU6A 1G9JA 3WKGA 3SDRA 1G9GA 4CE7A 2BRVX 1GA2A 4ONTA 3WKIA 1X1JA 4DODA 5IKHA 3S4DA 3Q7AB 2GOXA 1OJPA 4ZRQA 1N21A 1LXMA 1KZPB 1GHQA 3H2WA 1SA4B 4WU0A 2XFGA 1DCEB 2D5JA 2WY8A 1G6IA 3K11A 1MZCB 5DHKA 5ILYA 2NVPA 5IL3A 1H39A 3HXFB 3AFLA 3QDEA 3DSSB 4YDOB 3GLYA 1H3CA 3OXUA 2F0YB 3WIQA 3ANIA 3ACSA 2WDAA 5IM1A 3E32B 3M72A 3PZ2B 2QNOA 3WIWA 1RW9A 2I07B 3EU8A 4Q88A 1V5CA 4GL3A 4WVBA 3M73A 3W7UA 3DPYB 3P2CA 3PMMA 3K7XA 4D94A 3EUVB 2SQCA 5ILIA 1RWHA 1FO2A 4YDEB 3M7BA 2ZISB 1HM2A 3EU5B 3HXDB 3RJ3A 1O1RB 1FO3A 4QT9A 2WCOA 1QSJA 2VN4A 3Q78B 4TF4A 4ZRPA 2DRSA 1F9DA 1G87A 1HX9A 4J5TA 3E80A 1H3BA 1RQ5A 1X1IA 3P5RA 4OJZA 1H12A 2XQWA 2B39A 1HZFA 4OK2A 1L1YA 5MEHA 1N94B 3KLSA 2BB5A 3T33A 3D5SA 3SFYB 3S4CA 3ON6A 1TNUB 3SAEA 1HXAA 3E7JA 1H54A 2V3NA 1IA7A 1TN7B 1H14A 3W7WA 3Q79B 4GTTB 1H35A 1LOHA 4Q2BA 3DSVB 1O5MB 4GTQB 2OKXA 4AYPA 3PZ3B 3M74A 4ZG8A 4E1YA 1KZOB 1KREA 3QT3A 1N22A 2CQSA 1O6HA 2XWJB 4GAXA 3VW5A 2BBCA 4MBGB 1GAHA 1LTXB 3VSMA 1AYXA 3NFVA 3S9VA 2XWBB 2EAEA 1FBOA 4FUSA 4MU9A 1H3AA 3QT9A 1HMWA 1K72A 1XW2A 4LNGB 1UMPA 1TNBB 1HXGA 3QFYA 2DRQA 1XWQA 3SFXB 1V5DA 3LZ9A 1KSDA 1C82A 1FCEA 2WINB 2JJBA 5DGQA 1NXCA 1X1HA 1LD7B 3M75A 3M7EA 1FT1B 4Z4LA 1LXKA 2WYNA 1KFGA 4ZH1A 2F6DA 3EQAA 3QFZA 5IL8A 1WZZA 2EACA 5JMFA 1FBWA 2V8JA 4DI5A 1LF9A 1LF6A 1GSZA 1RWGA 1TNYB 1IA6A 2FV0A 2FUQA 1GXNA 1N4SB 1TN6B 3NNBA 3KSQB 3RENA 3CIHA 3D5RA 3M7LA 1N4PB 4GTSB 5EAUA 4M76A 2BRWA 3DRAB 2ZBLA 3PZ1B 2VN7A 1FT2B 3W7XA 3P5PA 3S4AA 1J0NA 2BEDB 3SDTA 1EGUA 1H36A 1F9OA 3M7CA 5JMDA 3D3IA 5IKAA 1JCQB 4FXGB 1FMIA 1O6RA 1NL4B 3W5NA 1GXOA 4AYOA 3GZKA 4BOKA 2H6GB 4GTOB 3PZ4B 1TF4A 3W7TA 1NC5A 1NI1B 3M78A 3RSYA 1VD5A 1V7XA 2IEJB 3ACTA 2YIKA 1OJNA 3GT5A 1H37A 3WKFA 3E30B 3H7LA 4D4BA 3RX5A 2D8LA 3AFJA 4LIXA 1JS4A 5FOBB 3G4FA 1KKTA 1O1SB 2RI9A 5GY3A 3A0OA 3M71A 4RNQA 4KKJA 5JPMB 1HN0A 5GZKA 1FPPB 1HV6A 1N23A 2E24A 1GLMA 1N1ZA 5EATA 4WVAA 1TNZB 4LNVA 1N7OA 1QQFA 1F9GA 2ZZRA 3SDUA 1N4QB 1R76A 1N7NA 4JJJA 3ANKA 1GXMA 5IK6A 1C3DA 1WU4A 3KSLB 1V7WA 4XUVA 1QBQB 1N9AB 4OZVA 1TN8B 3TF4A 4MMHA 4D4AA 3SDVA 4YCRA 3M02A 1N7QA 3Q7FB 3QG0A 5CZLA 3QWTA 2DRRA 1RWFA 1CLCA 1HCUA 1ULVA 2R2LB 1N1BA 1J0MA 3Q73B 3X17A 5M7IA 1FAEA 3CU7A 2AHFA 2JG0A 4CJ0A 1UT9A 4V1RA 3M76A 2RGKA 4C1SA 3E33B 5AGDA 1SQCA 2GZ6A 4EL8A 3E6UA 1W3YA 1KWFA 3WC3A 3M01A 3WUXA 2G0DA 3A3VA 4D4CA 1LD8B 5CA3A 3RX7A 5ILZA 3M00A 4KTPA 3SDQA 2AHGA 3DSUB 2AFAA 3PYAA 5ILKA
chains in the Genus database with same CATH topology
1D8EB 5M7YA 3W5MA 3ANJA 1KSCA 3EZ8A 2V8KA 3QRYA 1O79A 2B4FA 5FO7B 1GAIA 1N4RB 4EHMB 2EABA 4BOJA 4L9PB 3DSTB 3QXFA 4KKIA 2G02A 5GW7A 3HXCB 3OEDA 1S63B 3HXBB 4FXKB 3PYBA 1JCSB 1AGMA 4GTRB 1W6JA 3RRSA 2FUZA 5DGRA 2PMVA 1SA5B 2PN5A 3E34B 1JCRB 4L0GA 2JF4A 1H13A 2RI8A 1XWTA 2H6HB 2H6IB 1FP3A 4GTPB 3WKHA 4Z4JA 4WVCA 1TNOB 1X81B 2EADA 1DOGA 1N95B 2ZIRB 2A8ZA 3QXQA 1UG9A 2DROA 1W6KA 5KKBA 3S4BA 2NOJA 1WU5A 3E73A 2Z07A 3H3KA 3QPFA 2V3PA 5E2JA 4AYRA 4L6XA 1S64B 1KRFA 1DL2A 3KQ4A 1L2AA 3HXEB 4V1SA 3SQCA 4KTRA 3C72B 4ZH5A 2H6FB 4GTVB 4D4DA 2WY7A 1O1TB 5JPNB 3RX8A 3W7SA 1CEMA 2FBAA 3G6JB 5FO8B 2CQTA 4AYQA 2BB6A 1IS9A 1V7VA 3Q75B 1KS8A 5FO9B 2FV1A 3E37B 2V8IA 4LNBB 3DSXB 1X9DA 2GH4A 3VXDA 3M77A 3QSPA 4DOEA 2A73B 2P0VA 1D8DB 4TXTA 4GTMB 4CJ1A 2WIIB 3WIRA 1O6QA 3DSWB 5CD2A 1WU6A 1G9JA 3WKGA 3SDRA 1G9GA 4CE7A 1GA2A 4ONTA 3WKIA 4DODA 3S4DA 3Q7AB 2GOXA 4ZRQA 1KZPB 1GHQA 3H2WA 1SA4B 4WU0A 2XFGA 1DCEB 2D5JA 2WY8A 1G6IA 3K11A 1MZCB 2NVPA 1H39A 3HXFB 3QDEA 3DSSB 4YDOB 3GLYA 1H3CA 3OXUA 2F0YB 3WIQA 3ANIA 3ACSA 3E32B 3M72A 3PZ2B 2QNOA 3WIWA 2I07B 3EU8A 4Q88A 1V5CA 4GL3A 4WVBA 3M73A 3W7UA 3DPYB 3P2CA 3PMMA 3K7XA 4D94A 3EUVB 2SQCA 1FO2A 4YDEB 3M7BA 2ZISB 3EU5B 3HXDB 3RJ3A 1O1RB 1FO3A 4QT9A 1QSJA 2VN4A 3Q78B 4TF4A 4ZRPA 2DRSA 1F9DA 1G87A 4J5TA 1H3BA 1RQ5A 3P5RA 1H12A 2XQWA 2B39A 1HZFA 1L1YA 5MEHA 1N94B 3KLSA 2BB5A 3T33A 3D5SA 3SFYB 3S4CA 3ON6A 1TNUB 3SAEA 1H54A 2V3NA 1IA7A 1TN7B 1H14A 3W7WA 3Q79B 4GTTB 1H35A 4Q2BA 3DSVB 1O5MB 4GTQB 2OKXA 4AYPA 3PZ3B 3M74A 4ZG8A 1KZOB 1KREA 3QT3A 2CQSA 1O6HA 2XWJB 3VW5A 2BBCA 4MBGB 1GAHA 1LTXB 1AYXA 3S9VA 2XWBB 2EAEA 1FBOA 4FUSA 4MU9A 1H3AA 3QT9A 1K72A 1XW2A 4LNGB 1UMPA 1TNBB 3QFYA 2DRQA 1XWQA 3SFXB 1V5DA 1KSDA 1FCEA 2WINB 2JJBA 5DGQA 1NXCA 1LD7B 3M75A 3M7EA 1FT1B 4Z4LA 2WYNA 1KFGA 4ZH1A 2F6DA 3EQAA 3QFZA 1WZZA 2EACA 1FBWA 2V8JA 1LF9A 1LF6A 1GSZA 1TNYB 1IA6A 2FV0A 1GXNA 1N4SB 1TN6B 3KSQB 3RENA 3CIHA 3D5RA 3M7LA 1N4PB 4GTSB 4M76A 3DRAB 2ZBLA 3PZ1B 2VN7A 1FT2B 3W7XA 3P5PA 3S4AA 2BEDB 3SDTA 1H36A 1F9OA 3M7CA 3D3IA 1JCQB 4FXGB 1FMIA 1O6RA 1NL4B 3W5NA 1GXOA 4AYOA 3GZKA 4BOKA 2H6GB 4GTOB 3PZ4B 1TF4A 3W7TA 1NC5A 1NI1B 3M78A 3RSYA 1VD5A 1V7XA 2IEJB 3ACTA 2YIKA 3GT5A 1H37A 3WKFA 3E30B 3H7LA 4D4BA 3RX5A 2D8LA 3AFJA 4LIXA 1JS4A 5FOBB 1KKTA 1O1SB 2RI9A 5GY3A 3M71A 4KKJA 5JPMB 5GZKA 1FPPB 1GLMA 4WVAA 1TNZB 4LNVA 1QQFA 2ZZRA 3SDUA 1N4QB 1R76A 4JJJA 3ANKA 1GXMA 1C3DA 1WU4A 3KSLB 1V7WA 4XUVA 1QBQB 1N9AB 1TN8B 3TF4A 4D4AA 3SDVA 4YCRA 3Q7FB 3QG0A 5CZLA 3QWTA 2DRRA 1CLCA 1HCUA 1ULVA 2R2LB 3Q73B 3X17A 5M7IA 1FAEA 3CU7A 2AHFA 2JG0A 4CJ0A 1UT9A 4V1RA 3M76A 2RGKA 4C1SA 3E33B 5AGDA 1SQCA 2GZ6A 4EL8A 3E6UA 1KWFA 3WC3A 3WUXA 2G0DA 3A3VA 4D4CA 1LD8B 5CA3A 3RX7A 4KTPA 3SDQA 2AHGA 3DSUB 2AFAA 3PYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W7S A;  2VN7 A;  3W7X A;  1H12 A;  5M7Y A;  3W5M A;  1CEM A;  3S4A A;  3ANJ A;  1KSC A;  3EZ8 A;  2FBA A;  3QRY A;  1L1Y A;  2CQT A;  5MEH A;  1F9O A;  4AYQ A;  3T33 A;  1IS9 A;  3D3I A;  1V7V A;  1KS8 A;  2B4F A;  3S4C A;  3ON6 A;  1FMI A;  2FV1 A;  3W5N A;  4AYO A;  3GZK A;  1H54 A;  1X9D A;  2GH4 A;  3VXD A;  1GAI A;  2EAB A;  1IA7 A;  1TF4 A;  1H14 A;  3QSP A;  4DOE A;  1NC5 A;  3W7T A;  3W7W A;  3QXF A;  5GW7 A;  2P0V A;  4TXT A;  4Q2B A;  3RSY A;  1V7X A;  1VD5 A;  3ACT A;  2YIK A;  4CJ1 A;  3GT5 A;  3WIR A;  3WKF A;  3H7L A;  5CD2 A;  1WU6 A;  3RX5 A;  1G9J A;  2OKX A;  2D8L A;  3AFJ A;  4AYP A;  3WKG A;  1JS4 A;  4ZG8 A;  1KRE A;  3QT3 A;  1G9G A;  4CE7 A;  1GA2 A;  1KKT A;  2CQS A;  3WKI A;  1AGM A;  2RI9 A;  5GY3 A;  4DOD A;  3RRS A;  3VW5 A;  3S4D A;  2FUZ A;  1GAH A;  5DGR A;  1AYX A;  2EAE A;  1GLM A;  3H2W A;  4WVA A;  1FBO A;  4WU0 A;  4FUS A;  2ZZR A;  2XFG A;  3QT9 A;  4L0G A;  4JJJ A;  2D5J A;  1K72 A;  2JF4 A;  3ANK A;  1G6I A;  1H13 A;  1XW2 A;  1WU4 A;  2RI8 A;  3K11 A;  1V7W A;  1XWT A;  4XUV A;  1FP3 A;  2NVP A;  3QFY A;  2DRQ A;  1XWQ A;  3WKH A;  3QDE A;  1V5D A;  4Z4J A;  3GLY A;  3TF4 A;  1KSD A;  4WVC A;  1FCE A;  3WIQ A;  2JJB A;  3ANI A;  3ACS A;  5DGQ A;  1NXC A;  2EAD A;  3QG0 A;  5CZL A;  1DOG A;  3QWT A;  2DRR A;  1CLC A;  1HCU A;  1ULV A;  2QNO A;  4Z4L A;  2A8Z A;  2WYN A;  3WIW A;  1KFG A;  3QXQ A;  3X17 A;  1UG9 A;  1FAE A;  5M7I A;  2F6D A;  3EQA A;  2DRO A;  3QFZ A;  4Q88 A;  1V5C A;  5KKB A;  1WZZ A;  2EAC A;  3S4B A;  2AHF A;  2JG0 A;  4CJ0 A;  4WVB A;  1FBW A;  1WU5 A;  3W7U A;  1UT9 A;  3P2C A;  1LF9 A;  3E73 A;  1LF6 A;  2Z07 A;  3PMM A;  2RGK A;  3H3K A;  3QPF A;  4AYR A;  5E2J A;  1IA6 A;  2FV0 A;  2GZ6 A;  4L6X A;  4EL8 A;  1FO2 A;  3E6U A;  1KRF A;  3REN A;  1KWF A;  3WC3 A;  1DL2 A;  3CIH A;  3WUX A;  1FO3 A;  3A3V A;  1L2A A;  5CA3 A;  3RX7 A;  2VN4 A;  4KTR A;  4KTP A;  4ZH5 A;  2AHG A;  4TF4 A;  2DRS A;  1F9D A;  2ZBL A;  2AFA A;  1G87 A;  4J5T A;  1RQ5 A;  3RX8 A; 
#chains in the Genus database with same CATH topology
 1HXC A;  1D8E B;  5M7Y A;  3W5M A;  3ANJ A;  1KSC A;  5C05 A;  3EZ8 A;  2V8K A;  3QRY A;  1O79 A;  2Q1F A;  2B4F A;  5ILJ A;  4MMI A;  5FO7 B;  1GAI A;  1N4R B;  4EHM B;  2EAB A;  4NEI A;  4BOJ A;  4L9P B;  3DST B;  1RWC A;  3QXF A;  4KKI A;  2G02 A;  5GW7 A;  3HXC B;  3OED A;  1S63 B;  4OZW A;  1N20 A;  3HXB B;  4FXK B;  3PYB A;  1JCS B;  1AGM A;  4GTR B;  1W6J A;  3RRS A;  2FUZ A;  5DGR A;  3N0F A;  2PMV A;  2FUT A;  1SA5 B;  1N24 A;  2PN5 A;  3E34 B;  2ONH A;  1JCR B;  4L0G A;  2JF4 A;  1H13 A;  2X03 A;  2RI8 A;  1XWT A;  2H6H B;  1HMU A;  2H6I B;  1FP3 A;  3VSN A;  4GTP B;  3WKH A;  4Z4J A;  1CB8 A;  4WVC A;  1TNO B;  1X81 B;  2EAD A;  1DOG A;  1N95 B;  5IK0 A;  3N0G A;  2ZIR B;  2A8Z A;  2J5C A;  3QXQ A;  1UG9 A;  2DRO A;  1W6K A;  5KKB A;  3S4B A;  2BRP A;  2NOJ A;  1WU5 A;  3E73 A;  1OJO A;  2Z07 A;  4FNV A;  3H3K A;  5ILH A;  3QPF A;  2V3P A;  5E2J A;  4AYR A;  4L6X A;  1S64 B;  1KRF A;  2E22 A;  1DL2 A;  3KQ4 A;  5ILD A;  1L2A A;  3HXE B;  5DHI A;  4V1S A;  3SQC A;  4KTR A;  3C72 B;  4ZH5 A;  2H6F B;  1OJM A;  4GTV B;  4D4D A;  2WY7 A;  1O1T B;  5JPN B;  3RX8 A;  3W7S A;  1CEM A;  2FBA A;  3G6J B;  5FO8 B;  1RWA A;  2CQT A;  1HM3 A;  4AYQ A;  2BB6 A;  1IS9 A;  1I8Q A;  1V7V A;  3Q75 B;  1KS8 A;  5EAS A;  5FO9 B;  1QAZ A;  2FV1 A;  5IK9 A;  3E37 B;  2V8I A;  4FJQ A;  4LNB B;  3DSX B;  1N7P A;  1X9D A;  2GH4 A;  3VXD A;  4F10 A;  3M77 A;  3QSP A;  4DOE A;  2A73 B;  2ONG A;  1F1S A;  3G4D A;  2P0V A;  1D8D B;  4TXT A;  4GTM B;  4OK4 A;  4CJ1 A;  1N7R A;  2WII B;  3WIR A;  4F13 A;  1O6Q A;  3DSW B;  5CD2 A;  1WU6 A;  1G9J A;  3WKG A;  3SDR A;  1G9G A;  4CE7 A;  2BRV X;  1GA2 A;  4ONT A;  3WKI A;  1X1J A;  4DOD A;  5IKH A;  3S4D A;  3Q7A B;  2GOX A;  1OJP A;  4ZRQ A;  1N21 A;  1LXM A;  1KZP B;  1GHQ A;  3H2W A;  1SA4 B;  4WU0 A;  2XFG A;  1DCE B;  2D5J A;  2WY8 A;  1G6I A;  3K11 A;  1MZC B;  5DHK A;  5ILY A;  2NVP A;  5IL3 A;  1H39 A;  3HXF B;  3AFL A;  3QDE A;  3DSS B;  4YDO B;  3GLY A;  1H3C A;  3OXU A;  2F0Y B;  3WIQ A;  3ANI A;  3ACS A;  2WDA A;  5IM1 A;  3E32 B;  3M72 A;  3PZ2 B;  2QNO A;  3WIW A;  1RW9 A;  2I07 B;  3EU8 A;  4Q88 A;  1V5C A;  4GL3 A;  4WVB A;  3M73 A;  3W7U A;  3DPY B;  3P2C A;  3PMM A;  3K7X A;  4D94 A;  3EUV B;  2SQC A;  5ILI A;  1RWH A;  1FO2 A;  4YDE B;  3M7B A;  2ZIS B;  1HM2 A;  3EU5 B;  3HXD B;  3RJ3 A;  1O1R B;  1FO3 A;  4QT9 A;  2WCO A;  1QSJ A;  2VN4 A;  3Q78 B;  4TF4 A;  4ZRP A;  2DRS A;  1F9D A;  1G87 A;  1HX9 A;  4J5T A;  3E80 A;  1H3B A;  1RQ5 A;  1X1I A;  3P5R A;  4OJZ A;  1H12 A;  2XQW A;  2B39 A;  1HZF A;  4OK2 A;  1L1Y A;  5MEH A;  1N94 B;  3KLS A;  2BB5 A;  3T33 A;  3D5S A;  3SFY B;  3S4C A;  3ON6 A;  1TNU B;  3SAE A;  1HXA A;  3E7J A;  1H54 A;  2V3N A;  1IA7 A;  1TN7 B;  1H14 A;  3W7W A;  3Q79 B;  4GTT B;  1H35 A;  1LOH A;  4Q2B A;  3DSV B;  1O5M B;  4GTQ B;  2OKX A;  4AYP A;  3PZ3 B;  3M74 A;  4ZG8 A;  4E1Y A;  1KZO B;  1KRE A;  3QT3 A;  1N22 A;  2CQS A;  1O6H A;  2XWJ B;  4GAX A;  3VW5 A;  2BBC A;  4MBG B;  1GAH A;  1LTX B;  3VSM A;  1AYX A;  3NFV A;  3S9V A;  2XWB B;  2EAE A;  1FBO A;  4FUS A;  4MU9 A;  1H3A A;  3QT9 A;  1HMW A;  1K72 A;  1XW2 A;  4LNG B;  1UMP A;  1TNB B;  1HXG A;  3QFY A;  2DRQ A;  1XWQ A;  3SFX B;  1V5D A;  3LZ9 A;  1KSD A;  1C82 A;  1FCE A;  2WIN B;  2JJB A;  5DGQ A;  1NXC A;  1X1H A;  1LD7 B;  3M75 A;  3M7E A;  1FT1 B;  4Z4L A;  1LXK A;  2WYN A;  1KFG A;  4ZH1 A;  2F6D A;  3EQA A;  3QFZ A;  5IL8 A;  1WZZ A;  2EAC A;  5JMF A;  1FBW A;  2V8J A;  4DI5 A;  1LF9 A;  1LF6 A;  1GSZ A;  1RWG A;  1TNY B;  1IA6 A;  2FV0 A;  2FUQ A;  1GXN A;  1N4S B;  1TN6 B;  3NNB A;  3KSQ B;  3REN A;  3CIH A;  3D5R A;  3M7L A;  1N4P B;  4GTS B;  5EAU A;  4M76 A;  2BRW A;  3DRA B;  2ZBL A;  3PZ1 B;  2VN7 A;  1FT2 B;  3W7X A;  3P5P A;  3S4A A;  1J0N A;  2BED B;  3SDT A;  1EGU A;  1H36 A;  1F9O A;  3M7C A;  5JMD A;  3D3I A;  5IKA A;  1JCQ B;  4FXG B;  1FMI A;  1O6R A;  1NL4 B;  3W5N A;  1GXO A;  4AYO A;  3GZK A;  4BOK A;  2H6G B;  4GTO B;  3PZ4 B;  1TF4 A;  3W7T A;  1NC5 A;  1NI1 B;  3M78 A;  3RSY A;  1VD5 A;  1V7X A;  2IEJ B;  3ACT A;  2YIK A;  1OJN A;  3GT5 A;  1H37 A;  3WKF A;  3E30 B;  3H7L A;  4D4B A;  3RX5 A;  2D8L A;  3AFJ A;  4LIX A;  1JS4 A;  5FOB B;  3G4F A;  1KKT A;  1O1S B;  2RI9 A;  5GY3 A;  3A0O A;  3M71 A;  4RNQ A;  4KKJ A;  5JPM B;  1HN0 A;  5GZK A;  1FPP B;  1HV6 A;  1N23 A;  2E24 A;  1GLM A;  1N1Z A;  5EAT A;  4WVA A;  1TNZ B;  4LNV A;  1N7O A;  1QQF A;  1F9G A;  2ZZR A;  3SDU A;  1N4Q B;  1R76 A;  1N7N A;  4JJJ A;  3ANK A;  1GXM A;  5IK6 A;  1C3D A;  1WU4 A;  3KSL B;  1V7W A;  4XUV A;  1QBQ B;  1N9A B;  4OZV A;  1TN8 B;  3TF4 A;  4MMH A;  4D4A A;  3SDV A;  4YCR A;  3M02 A;  1N7Q A;  3Q7F B;  3QG0 A;  5CZL A;  3QWT A;  2DRR A;  1RWF A;  1CLC A;  1HCU A;  1ULV A;  2R2L B;  1N1B A;  1J0M A;  3Q73 B;  3X17 A;  5M7I A;  1FAE A;  3CU7 A;  2AHF A;  2JG0 A;  4CJ0 A;  1UT9 A;  4V1R A;  3M76 A;  2RGK A;  4C1S A;  3E33 B;  5AGD A;  1SQC A;  2GZ6 A;  4EL8 A;  3E6U A;  1W3Y A;  1KWF A;  3WC3 A;  3M01 A;  3WUX A;  2G0D A;  3A3V A;  4D4C A;  1LD8 B;  5CA3 A;  3RX7 A;  5ILZ A;  3M00 A;  4KTP A;  3SDQ A;  2AHG A;  3DSU B;  2AFA A;  3PYA A;  5ILK A; 
#chains in the Genus database with same CATH homology
 1D8E B;  5M7Y A;  3W5M A;  3ANJ A;  1KSC A;  3EZ8 A;  2V8K A;  3QRY A;  1O79 A;  2B4F A;  5FO7 B;  1GAI A;  1N4R B;  4EHM B;  2EAB A;  4BOJ A;  4L9P B;  3DST B;  3QXF A;  4KKI A;  2G02 A;  5GW7 A;  3HXC B;  3OED A;  1S63 B;  3HXB B;  4FXK B;  3PYB A;  1JCS B;  1AGM A;  4GTR B;  1W6J A;  3RRS A;  2FUZ A;  5DGR A;  2PMV A;  1SA5 B;  2PN5 A;  3E34 B;  1JCR B;  4L0G A;  2JF4 A;  1H13 A;  2RI8 A;  1XWT A;  2H6H B;  2H6I B;  1FP3 A;  4GTP B;  3WKH A;  4Z4J A;  4WVC A;  1TNO B;  1X81 B;  2EAD A;  1DOG A;  1N95 B;  2ZIR B;  2A8Z A;  3QXQ A;  1UG9 A;  2DRO A;  1W6K A;  5KKB A;  3S4B A;  2NOJ A;  1WU5 A;  3E73 A;  2Z07 A;  3H3K A;  3QPF A;  2V3P A;  5E2J A;  4AYR A;  4L6X A;  1S64 B;  1KRF A;  1DL2 A;  3KQ4 A;  1L2A A;  3HXE B;  4V1S A;  3SQC A;  4KTR A;  3C72 B;  4ZH5 A;  2H6F B;  4GTV B;  4D4D A;  2WY7 A;  1O1T B;  5JPN B;  3RX8 A;  3W7S A;  1CEM A;  2FBA A;  3G6J B;  5FO8 B;  2CQT A;  4AYQ A;  2BB6 A;  1IS9 A;  1V7V A;  3Q75 B;  1KS8 A;  5FO9 B;  2FV1 A;  3E37 B;  2V8I A;  4LNB B;  3DSX B;  1X9D A;  2GH4 A;  3VXD A;  3M77 A;  3QSP A;  4DOE A;  2A73 B;  2P0V A;  1D8D B;  4TXT A;  4GTM B;  4CJ1 A;  2WII B;  3WIR A;  1O6Q A;  3DSW B;  5CD2 A;  1WU6 A;  1G9J A;  3WKG A;  3SDR A;  1G9G A;  4CE7 A;  1GA2 A;  4ONT A;  3WKI A;  4DOD A;  3S4D A;  3Q7A B;  2GOX A;  4ZRQ A;  1KZP B;  1GHQ A;  3H2W A;  1SA4 B;  4WU0 A;  2XFG A;  1DCE B;  2D5J A;  2WY8 A;  1G6I A;  3K11 A;  1MZC B;  2NVP A;  1H39 A;  3HXF B;  3QDE A;  3DSS B;  4YDO B;  3GLY A;  1H3C A;  3OXU A;  2F0Y B;  3WIQ A;  3ANI A;  3ACS A;  3E32 B;  3M72 A;  3PZ2 B;  2QNO A;  3WIW A;  2I07 B;  3EU8 A;  4Q88 A;  1V5C A;  4GL3 A;  4WVB A;  3M73 A;  3W7U A;  3DPY B;  3P2C A;  3PMM A;  3K7X A;  4D94 A;  3EUV B;  2SQC A;  1FO2 A;  4YDE B;  3M7B A;  2ZIS B;  3EU5 B;  3HXD B;  3RJ3 A;  1O1R B;  1FO3 A;  4QT9 A;  1QSJ A;  2VN4 A;  3Q78 B;  4TF4 A;  4ZRP A;  2DRS A;  1F9D A;  1G87 A;  4J5T A;  1H3B A;  1RQ5 A;  3P5R A;  1H12 A;  2XQW A;  2B39 A;  1HZF A;  1L1Y A;  5MEH A;  1N94 B;  3KLS A;  2BB5 A;  3T33 A;  3D5S A;  3SFY B;  3S4C A;  3ON6 A;  1TNU B;  3SAE A;  1H54 A;  2V3N A;  1IA7 A;  1TN7 B;  1H14 A;  3W7W A;  3Q79 B;  4GTT B;  1H35 A;  4Q2B A;  3DSV B;  1O5M B;  4GTQ B;  2OKX A;  4AYP A;  3PZ3 B;  3M74 A;  4ZG8 A;  1KZO B;  1KRE A;  3QT3 A;  2CQS A;  1O6H A;  2XWJ B;  3VW5 A;  2BBC A;  4MBG B;  1GAH A;  1LTX B;  1AYX A;  3S9V A;  2XWB B;  2EAE A;  1FBO A;  4FUS A;  4MU9 A;  1H3A A;  3QT9 A;  1K72 A;  1XW2 A;  4LNG B;  1UMP A;  1TNB B;  3QFY A;  2DRQ A;  1XWQ A;  3SFX B;  1V5D A;  1KSD A;  1FCE A;  2WIN B;  2JJB A;  5DGQ A;  1NXC A;  1LD7 B;  3M75 A;  3M7E A;  1FT1 B;  4Z4L A;  2WYN A;  1KFG A;  4ZH1 A;  2F6D A;  3EQA A;  3QFZ A;  1WZZ A;  2EAC A;  1FBW A;  2V8J A;  1LF9 A;  1LF6 A;  1GSZ A;  1TNY B;  1IA6 A;  2FV0 A;  1GXN A;  1N4S B;  1TN6 B;  3KSQ B;  3REN A;  3CIH A;  3D5R A;  3M7L A;  1N4P B;  4GTS B;  4M76 A;  3DRA B;  2ZBL A;  3PZ1 B;  2VN7 A;  1FT2 B;  3W7X A;  3P5P A;  3S4A A;  2BED B;  3SDT A;  1H36 A;  1F9O A;  3M7C A;  3D3I A;  1JCQ B;  4FXG B;  1FMI A;  1O6R A;  1NL4 B;  3W5N A;  1GXO A;  4AYO A;  3GZK A;  4BOK A;  2H6G B;  4GTO B;  3PZ4 B;  1TF4 A;  3W7T A;  1NC5 A;  1NI1 B;  3M78 A;  3RSY A;  1VD5 A;  1V7X A;  2IEJ B;  3ACT A;  2YIK A;  3GT5 A;  1H37 A;  3WKF A;  3E30 B;  3H7L A;  4D4B A;  3RX5 A;  2D8L A;  3AFJ A;  4LIX A;  1JS4 A;  5FOB B;  1KKT A;  1O1S B;  2RI9 A;  5GY3 A;  3M71 A;  4KKJ A;  5JPM B;  5GZK A;  1FPP B;  1GLM A;  4WVA A;  1TNZ B;  4LNV A;  1QQF A;  2ZZR A;  3SDU A;  1N4Q B;  1R76 A;  4JJJ A;  3ANK A;  1GXM A;  1C3D A;  1WU4 A;  3KSL B;  1V7W A;  4XUV A;  1QBQ B;  1N9A B;  1TN8 B;  3TF4 A;  4D4A A;  3SDV A;  4YCR A;  3Q7F B;  3QG0 A;  5CZL A;  3QWT A;  2DRR A;  1CLC A;  1HCU A;  1ULV A;  2R2L B;  3Q73 B;  3X17 A;  5M7I A;  1FAE A;  3CU7 A;  2AHF A;  2JG0 A;  4CJ0 A;  1UT9 A;  4V1R A;  3M76 A;  2RGK A;  4C1S A;  3E33 B;  5AGD A;  1SQC A;  2GZ6 A;  4EL8 A;  3E6U A;  1KWF A;  3WC3 A;  3WUX A;  2G0D A;  3A3V A;  4D4C A;  1LD8 B;  5CA3 A;  3RX7 A;  4KTP A;  3SDQ A;  2AHG A;  3DSU B;  2AFA A;  3PYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...