1RIQA

The crystal structure of the catalytic fragment of the alanyl-trna synthetase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
publication title Alanyl-tRNA Synthetase Crystal Structure and Design for Acceptor-Stem Recognition
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 152
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1riqA01
2Q7GA 2C7IA 2G4CA 3V8JA 3V7RA 5K1PA 4YCUA 3UH0A 4PHCA 1H4VB 3A31A 3ICAA 4EX5A 1H4TA 2E1HA 4G84A 1YFTA 1E22A 4HWOA 4P75C 1EVKA 12ASA 3V8LA 5C52B 3MF1A 3MF2A 4H2YA 4TQFA 1HTTA 3IG2A 5ELNA 2DDZA 3HFZA 1ADJA 3RIRA 1KMMA 4L87A 1H4SA 3RL6A 1HC7A 2ZT7A 4K87A 2ZZEA 1HXDA 2DQ0A 4KR2A 2CGHA 3VQWA 4J15A 4HWTA 4P73C 2EJ9A 2Q5IA 2ZIOA 5KNNA 2I4OA 3V7SA 1H4QA 4YCVA 2ALYB 1NJ5A 4H02A 4Q15A 1G51A 4HWRA 5HGQA 11ASA 4ZTZB 4XU3A 1GGMA 4OLFA 2I4MA 1YFSA 1QF6A 3HXWA 1Z7MA 3VBBA 1C0AA 2ARSA 4P3NA 2ZIMA 2RHQA 4XTVA 1USYC 4ZIBA 2DVEA 2AKWB 2PMEA 1B7YB 2XGTA 3A32A 3HY1A 4TVAB 4H2XA 1PYSB 4YP0A 4YRQA 4TVYA 3HXUA 4YCWA 3TEHB 3QNEA 2Q7HA 2E10A 4TWAA 4WJ4A 1NJ6A 3DSQA 4CH4A 3NETA 3UGQA 2XTIA 2AMCB 1ATIA 3HXVA 2ZXFA 3V8KA 2ODRC 3EFRA 3HRKA 1X2GA 4CH6A 4AH6A 4DQ2A 3QO5A 1BBWA 2QHUA 4YYEA 3IALA 1X2HA 1E1TA 3BFMA 4RMFA 4YRGA 2EAYA 1B70B 3A5ZA 1WPYA 3WQZA 3KFUA 1Z7NA 2ZT6A 2DKGA 1L0WA 2CJAA 1J5WA 2C8MA 4YROA 2EWNA 3HTZA 2ZGWA 2FYKA 1NJ1A 2RHSB 1WU7A 4YRKA 3BJUA 3A7AA 4WI1A 1X01A 4WF2A 5K1XA 2E3CA 4K86A 1X56A 2ZZGA 3HY0A 4KR3A 3RUXA 4UP7A 1YB3A 1SETA 2EL9A 3NELA 3L2ZA 3L4GB 2DTIA 3MEYA 3QTCA 2P5IA 1BIBA 3LSSA 3HXXA 2E64A 4NCXA 2DTHA 1E1OA 1ADYA 3LSQA 2ZZFA 4HWSA 2DU7A 4TQDA 3E9IA 1JJCA 4P74A 2ARTA 1WNLA 3R07A 3PZCA 2J3MA 1X54A 4H2UA 4YPFA 3NEMA 4LNSA 4ZTUB 2IY5B 3PCOB 1G5IA 3HXZA 4UP9A 2ODRD 4P72A 2EJGA 5E3IA 3RKWA 1B8AA 3RKYA 1EIYB 2DXTA 1BBUA 4YRSA 4XU2A 4CH5A 4P71A 1NYRA 2DZ9A 3I7FA 3P8VA 3REXA 1FYFA 2P0LA 1ASYA 1WLEA 3L1AA 4UP8A 2DU5A 4HVCA 3P8TA 1NNHA 4UPAA 1ASZA 1N9WA 4RDXA 5ELOA 4G85A 4P3PA 1E24A 1WQWA 2QHVA 3HXYA 2DTOA 3HFZB 1KMNA 3RACA 2ALYA 4BWAA 2DJZA 1WYDA 4X5OA 2CIMA 1IL2A 3OD1A 2ZR2A 2ARUA 5C51B 3QO8A 1BIAA 1LYLA 2I4LA 2AKWA 1B7YA 1QE0A 3W3SA 2PMFA 4TVAA 2DXUA 4YRCA 1PYSA 4TTVA 1EOVA 2ZTGA 1VQZA 2RHQB 3TEHA 2Q7EA 3TUPA 4P73A 4H2WA 2AMCA 4TVWA 4H2XB 3RKXA 3M4QA 2QHSA 3A7RA 1SERA 3IKMB 2ZR3A 3VQYA 4YRTA 4YREA 4CH3A 2DQ3A 2ZINA 3VQXA 2E41A 4BW9A 2EJFA 4YRPA 1SESA 1NYQA 3HRIA 4YRIA 4KQEA 1EQRA 3CMQA 3REUA 1B70A 3A74A 2DZCA 4YRRA 4YRJA 1USYA 1B76A 1YFRA 2E5AA 3NENA 2ZNJA 4XTYA 3G1ZA 4CS4A 2CJ9A 4H2TA 2ZCEA 4CS3A 4XEOA 1YGBA 4XTUA 3UFGA 4DPGA 2RHSA 3UGTA 3TEGA 1EVLA 4K88A 4HWPA 3A5YA 2CJBA 3IKLA 4P74C 4XTXA 4YRNA 3EFSA 2Q5HA 2J3LA 2E65A 4XU1A 4PG3A 4RQFA 1WQ7A 1W66A 3RF1A 4YRLA 4XEMA 5F5WA 3LC0A 5C53B 3A7UA 1RIQA 3QO7A 4OP0A 4WJ3M 1EFWA 4Q6GA 4E51A 3L4GA 4YRMA 4H2VA 2I4NA 4HA8A 4P72C 2ZT5A 4XU0A 4RQEA 3E9HA 4XTWA 3VQVA 4O2DA 4P71C 2ZT8A 3ERRA 2HNIA 4XTZA 3V7CA 2DEQA 1NJ8A 2QHTA 4EO4A 4YDQA 1SRYA 4H2SA 3RGLA 3FJPA 4P75A 2IY5A 1JJCB 4P3OA 3PCOA 1KOGA 3M4PA 1G5HA 3P8YA 2ZNIA 4CS2A 4YRFA 3HFVA 1EIYA 1NJ2A 1X55A
chains in the Genus database with same CATH superfamily
2Q7GA 2C7IA 2G4CA 3V8JA 3V7RA 5K1PA 4YCUA 3UH0A 4PHCA 1H4VB 3A31A 3ICAA 4EX5A 1H4TA 2E1HA 4G84A 1YFTA 1E22A 4HWOA 4P75C 1EVKA 12ASA 3V8LA 5C52B 3MF1A 3MF2A 4H2YA 4TQFA 4LVLA 1HTTA 3IG2A 5ELNA 2DDZA 3HFZA 1ADJA 3RIRA 1KMMA 4L87A 1H4SA 3RL6A 1HC7A 2ZT7A 4K87A 2ZZEA 1HXDA 2DQ0A 4KR2A 2CGHA 3VQWA 4J15A 4HWTA 4P73C 2EJ9A 2Q5IA 2ZIOA 5KNNA 2I4OA 3V7SA 1H4QA 4YCVA 2ALYB 1NJ5A 4H02A 4Q15A 1G51A 4HWRA 5HGQA 11ASA 4ZTZB 4XU3A 1GGMA 4OLFA 2I4MA 1YFSA 1QF6A 3HXWA 1Z7MA 3VBBA 1C0AA 2ARSA 4P3NA 2ZIMA 2RHQA 4XTVA 1USYC 4ZIBA 2DVEA 2AKWB 2PMEA 1B7YB 2XGTA 3A32A 4HT4A 3HY1A 3MQZA 4TVAB 4H2XA 1PYSB 4YP0A 4YRQA 4TVYA 3HXUA 4YCWA 3TEHB 3QNEA 2Q7HA 2E10A 4TWAA 4WJ4A 1NJ6A 3DSQA 4CH4A 3NETA 3UGQA 2XTIA 2AMCB 1ATIA 3HXVA 2ZXFA 3V8KA 2ODRC 3EFRA 3HRKA 1X2GA 2A8EA 4CH6A 4AH6A 4DQ2A 4LVKA 3QO5A 1BBWA 2QHUA 4YYEA 3IALA 1X2HA 1E1TA 3BFMA 4RMFA 4YRGA 2EAYA 1B70B 3A5ZA 1WPYA 3WQZA 3KFUA 1Z7NA 2ZT6A 2DKGA 1L0WA 2CJAA 1J5WA 2C8MA 4YROA 4LVIA 2EWNA 3HTZA 2ZGWA 2FYKA 1NJ1A 2RHSB 1WU7A 4YRKA 3BJUA 3A7AA 4WI1A 1X01A 4WF2A 5K1XA 2E3CA 4K86A 1X56A 2ZZGA 3HY0A 4KR3A 3RUXA 4UP7A 1YB3A 1SETA 2EL9A 3NELA 3L2ZA 3L4GB 2DTIA 3MEYA 3QTCA 2P5IA 1BIBA 3LSSA 3HXXA 2E64A 4NCXA 2DTHA 1E1OA 1ADYA 3LSQA 2ZZFA 4HWSA 2DU7A 4TQDA 3E9IA 1JJCA 4P74A 2ARTA 1WNLA 3R07A 3PZCA 2J3MA 1X54A 4H2UA 4YPFA 3NEMA 4LNSA 4ZTUB 2IY5B 3PCOB 1G5IA 3HXZA 4UP9A 2NS6A 2ODRD 4P72A 2EJGA 5E3IA 3RKWA 1B8AA 3RKYA 1EIYB 2DXTA 1BBUA 4YRSA 4XU2A 4CH5A 4P71A 1NYRA 2DZ9A 3I7FA 3P8VA 3REXA 1FYFA 2P0LA 1ASYA 1WLEA 3L1AA 4UP8A 2DU5A 4HVCA 3P8TA 1NNHA 4UPAA 1ASZA 1N9WA 4RDXA 5ELOA 4G85A 4P3PA 1E24A 1WQWA 2QHVA 4LVMA 3HXYA 2DTOA 3HFZB 1KMNA 3RACA 2ALYA 4BWAA 2DJZA 1WYDA 4X5OA 2CIMA 1IL2A 3OD1A 4LVJA 2ZR2A 2ARUA 5C51B 3QO8A 1BIAA 1LYLA 2I4LA 2AKWA 1B7YA 1QE0A 3W3SA 2PMFA 4TVAA 2DXUA 4YRCA 1PYSA 4TTVA 1EOVA 2ZTGA 1VQZA 2RHQB 3TEHA 2Q7EA 3TUPA 4P73A 4H2WA 2AMCA 4TVWA 4H2XB 3RKXA 3M4QA 2QHSA 3A7RA 1SERA 3IKMB 2ZR3A 3VQYA 4YRTA 4YREA 4CH3A 2DQ3A 2ZINA 3VQXA 2E41A 4BW9A 2EJFA 4YRPA 1SESA 1NYQA 3HRIA 4YRIA 4KQEA 1EQRA 3CMQA 3REUA 1B70A 3A74A 2DZCA 4YRRA 4YRJA 1USYA 1B76A 1YFRA 2E5AA 3NENA 2ZNJA 4XTYA 3G1ZA 4CS4A 2CJ9A 4H2TA 2ZCEA 4CS3A 4XEOA 1YGBA 4XTUA 3UFGA 4DPGA 2RHSA 3UGTA 3TEGA 1EVLA 4K88A 4HWPA 3A5YA 2CJBA 3IKLA 4P74C 4XTXA 4YRNA 3EFSA 2Q5HA 2J3LA 2E65A 4XU1A 4PG3A 4RQFA 1WQ7A 1W66A 3RF1A 4YRLA 4XEMA 5F5WA 3LC0A 5C53B 3A7UA 1RIQA 3QO7A 4OP0A 4WJ3M 1EFWA 4Q6GA 4E51A 3L4GA 4YRMA 4H2VA 2I4NA 4HA8A 4P72C 2ZT5A 4XU0A 4RQEA 3E9HA 4XTWA 3VQVA 4O2DA 4P71C 2ZT8A 3ERRA 2HNIA 4XTZA 3V7CA 2DEQA 1NJ8A 2QHTA 4EO4A 4YDQA 1SRYA 4H2SA 3RGLA 3FJPA 4P75A 2IY5A 1JJCB 4P3OA 3PCOA 1KOGA 3M4PA 1G5HA 3P8YA 2ZNIA 4CS2A 4YRFA 3HFVA 1EIYA 1NJ2A 1X55A
chains in the Genus database with same CATH topology
2Q7GA 2C7IA 2G4CA 3V8JA 3V7RA 5K1PA 4YCUA 3UH0A 4PHCA 1H4VB 3A31A 3ICAA 4EX5A 1H4TA 2E1HA 4G84A 1YFTA 1E22A 4HWOA 4P75C 1EVKA 12ASA 3V8LA 5C52B 3MF1A 3MF2A 4H2YA 4TQFA 4LVLA 1HTTA 3IG2A 5ELNA 2DDZA 3HFZA 1ADJA 3RIRA 1KMMA 4L87A 1H4SA 3RL6A 1HC7A 2ZT7A 4K87A 2ZZEA 1HXDA 2DQ0A 4KR2A 2CGHA 3VQWA 4J15A 4HWTA 4P73C 2EJ9A 2Q5IA 2ZIOA 5KNNA 2I4OA 3V7SA 1H4QA 4YCVA 2ALYB 1NJ5A 4H02A 4Q15A 1G51A 4HWRA 5HGQA 11ASA 4ZTZB 4XU3A 1GGMA 4OLFA 2I4MA 1YFSA 1QF6A 3HXWA 1Z7MA 3VBBA 1C0AA 2ARSA 4P3NA 2ZIMA 2RHQA 4XTVA 1USYC 4ZIBA 2DVEA 2AKWB 2PMEA 1B7YB 2XGTA 3A32A 4HT4A 3HY1A 3MQZA 4TVAB 4H2XA 1PYSB 4YP0A 4YRQA 4TVYA 3HXUA 4YCWA 3TEHB 3QNEA 2Q7HA 2E10A 4TWAA 4WJ4A 1NJ6A 3DSQA 4CH4A 3NETA 3UGQA 2XTIA 2AMCB 1ATIA 3HXVA 2ZXFA 3V8KA 2ODRC 3EFRA 3HRKA 1X2GA 2A8EA 4CH6A 4AH6A 4DQ2A 4LVKA 3QO5A 1BBWA 2QHUA 4YYEA 3IALA 1X2HA 1E1TA 3BFMA 4RMFA 4YRGA 2EAYA 1B70B 3A5ZA 1WPYA 3WQZA 3KFUA 1Z7NA 2ZT6A 2DKGA 1L0WA 2CJAA 1J5WA 2C8MA 4YROA 4LVIA 2EWNA 3HTZA 2ZGWA 2FYKA 1NJ1A 2RHSB 1WU7A 4YRKA 3BJUA 3A7AA 4WI1A 1X01A 4WF2A 5K1XA 2E3CA 4K86A 1X56A 2ZZGA 3HY0A 4KR3A 3RUXA 4UP7A 1YB3A 1SETA 2EL9A 3NELA 3L2ZA 3L4GB 2DTIA 3MEYA 3QTCA 2P5IA 1BIBA 3LSSA 3HXXA 2E64A 4NCXA 2DTHA 1E1OA 1ADYA 3LSQA 2ZZFA 4HWSA 2DU7A 4TQDA 3E9IA 1JJCA 4P74A 2ARTA 1WNLA 3R07A 3PZCA 2J3MA 1X54A 4H2UA 4YPFA 3NEMA 4LNSA 4ZTUB 2IY5B 3PCOB 1G5IA 3HXZA 4UP9A 2NS6A 2ODRD 4P72A 2EJGA 5E3IA 3RKWA 1B8AA 3RKYA 1EIYB 2DXTA 1BBUA 4YRSA 4XU2A 4CH5A 4P71A 1NYRA 2DZ9A 3I7FA 3P8VA 3REXA 1FYFA 2P0LA 1ASYA 1WLEA 3L1AA 4UP8A 2DU5A 4HVCA 3P8TA 1NNHA 4UPAA 1ASZA 1N9WA 4RDXA 5ELOA 4G85A 4P3PA 1E24A 1WQWA 2QHVA 4LVMA 3HXYA 2DTOA 3HFZB 1KMNA 3RACA 2ALYA 4BWAA 2DJZA 1WYDA 4X5OA 2CIMA 1IL2A 3OD1A 4LVJA 2ZR2A 2ARUA 5C51B 3QO8A 1BIAA 1LYLA 2I4LA 2AKWA 1B7YA 1QE0A 3W3SA 2PMFA 4TVAA 2DXUA 4YRCA 1PYSA 4TTVA 1EOVA 2ZTGA 1VQZA 2RHQB 3TEHA 2Q7EA 3TUPA 4P73A 4H2WA 2AMCA 4TVWA 4H2XB 3RKXA 3M4QA 2QHSA 3A7RA 1SERA 3IKMB 2ZR3A 3VQYA 4YRTA 4YREA 4CH3A 2DQ3A 2ZINA 3VQXA 2E41A 4BW9A 2EJFA 4YRPA 1SESA 1NYQA 3HRIA 4YRIA 4KQEA 1EQRA 3CMQA 3REUA 1B70A 3A74A 2DZCA 4YRRA 4YRJA 1USYA 1B76A 1YFRA 2E5AA 3NENA 2ZNJA 4XTYA 3G1ZA 4CS4A 2CJ9A 4H2TA 2ZCEA 4CS3A 4XEOA 1YGBA 4XTUA 3UFGA 4DPGA 2RHSA 3UGTA 3TEGA 1EVLA 4K88A 4HWPA 3A5YA 2CJBA 3IKLA 4P74C 4XTXA 4YRNA 3EFSA 2Q5HA 2J3LA 2E65A 4XU1A 4PG3A 4RQFA 1WQ7A 1W66A 3RF1A 4YRLA 4XEMA 5F5WA 3LC0A 5C53B 3A7UA 1RIQA 3QO7A 4OP0A 4WJ3M 1EFWA 4Q6GA 4E51A 3L4GA 4YRMA 4H2VA 2I4NA 4HA8A 4P72C 2ZT5A 4XU0A 4RQEA 3E9HA 4XTWA 3VQVA 4O2DA 4P71C 2ZT8A 3ERRA 2HNIA 4XTZA 3V7CA 2DEQA 1NJ8A 2QHTA 4EO4A 4YDQA 1SRYA 4H2SA 3RGLA 3FJPA 4P75A 2IY5A 1JJCB 4P3OA 3PCOA 1KOGA 3M4PA 1G5HA 3P8YA 2ZNIA 4CS2A 4YRFA 3HFVA 1EIYA 1NJ2A 1X55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7G A;  2C7I A;  2G4C A;  3V8J A;  3V7R A;  5K1P A;  4YCU A;  3UH0 A;  4PHC A;  1H4V B;  3A31 A;  3ICA A;  4EX5 A;  1H4T A;  2E1H A;  4G84 A;  1YFT A;  1E22 A;  4HWO A;  4P75 C;  1EVK A;  12AS A;  3V8L A;  5C52 B;  3MF1 A;  3MF2 A;  4H2Y A;  4TQF A;  1HTT A;  3IG2 A;  5ELN A;  2DDZ A;  3HFZ A;  1ADJ A;  3RIR A;  1KMM A;  4L87 A;  1H4S A;  3RL6 A;  1HC7 A;  2ZT7 A;  4K87 A;  2ZZE A;  1HXD A;  2DQ0 A;  4KR2 A;  2CGH A;  3VQW A;  4J15 A;  4HWT A;  4P73 C;  2EJ9 A;  2Q5I A;  2ZIO A;  5KNN A;  2I4O A;  3V7S A;  1H4Q A;  4YCV A;  2ALY B;  1NJ5 A;  4H02 A;  4Q15 A;  1G51 A;  4HWR A;  5HGQ A;  11AS A;  4ZTZ B;  4XU3 A;  1GGM A;  4OLF A;  2I4M A;  1YFS A;  1QF6 A;  3HXW A;  1Z7M A;  3VBB A;  1C0A A;  2ARS A;  4P3N A;  2ZIM A;  2RHQ A;  4XTV A;  1USY C;  4ZIB A;  2DVE A;  2AKW B;  2PME A;  1B7Y B;  2XGT A;  3A32 A;  3HY1 A;  4TVA B;  4H2X A;  1PYS B;  4YP0 A;  4YRQ A;  4TVY A;  3HXU A;  4YCW A;  3TEH B;  3QNE A;  2Q7H A;  2E10 A;  4TWA A;  4WJ4 A;  1NJ6 A;  3DSQ A;  4CH4 A;  3NET A;  3UGQ A;  2XTI A;  2AMC B;  1ATI A;  3HXV A;  2ZXF A;  3V8K A;  2ODR C;  3EFR A;  3HRK A;  1X2G A;  4CH6 A;  4AH6 A;  4DQ2 A;  3QO5 A;  1BBW A;  2QHU A;  4YYE A;  3IAL A;  1X2H A;  1E1T A;  3BFM A;  4RMF A;  4YRG A;  2EAY A;  1B70 B;  3A5Z A;  1WPY A;  3WQZ A;  3KFU A;  1Z7N A;  2ZT6 A;  2DKG A;  1L0W A;  2CJA A;  1J5W A;  2C8M A;  4YRO A;  2EWN A;  3HTZ A;  2ZGW A;  2FYK A;  1NJ1 A;  2RHS B;  1WU7 A;  4YRK A;  3BJU A;  3A7A A;  4WI1 A;  1X01 A;  4WF2 A;  5K1X A;  2E3C A;  4K86 A;  1X56 A;  2ZZG A;  3HY0 A;  4KR3 A;  3RUX A;  4UP7 A;  1YB3 A;  1SET A;  2EL9 A;  3NEL A;  3L2Z A;  3L4G B;  2DTI A;  3MEY A;  3QTC A;  2P5I A;  1BIB A;  3LSS A;  3HXX A;  2E64 A;  4NCX A;  2DTH A;  1E1O A;  1ADY A;  3LSQ A;  2ZZF A;  4HWS A;  2DU7 A;  4TQD A;  3E9I A;  1JJC A;  4P74 A;  2ART A;  1WNL A;  3R07 A;  3PZC A;  2J3M A;  1X54 A;  4H2U A;  4YPF A;  3NEM A;  4LNS A;  4ZTU B;  2IY5 B;  3PCO B;  1G5I A;  3HXZ A;  4UP9 A;  2ODR D;  4P72 A;  2EJG A;  5E3I A;  3RKW A;  1B8A A;  3RKY A;  1EIY B;  2DXT A;  1BBU A;  4YRS A;  4XU2 A;  4CH5 A;  4P71 A;  1NYR A;  2DZ9 A;  3I7F A;  3P8V A;  3REX A;  1FYF A;  2P0L A;  1ASY A;  1WLE A;  3L1A A;  4UP8 A;  2DU5 A;  4HVC A;  3P8T A;  1NNH A;  4UPA A;  1ASZ A;  1N9W A;  4RDX A;  5ELO A;  4G85 A;  4P3P A;  1E24 A;  1WQW A;  2QHV A;  3HXY A;  2DTO A;  3HFZ B;  1KMN A;  3RAC A;  2ALY A;  4BWA A;  2DJZ A;  1WYD A;  4X5O A;  2CIM A;  1IL2 A;  3OD1 A;  2ZR2 A;  2ARU A;  5C51 B;  3QO8 A;  1BIA A;  1LYL A;  2I4L A;  2AKW A;  1B7Y A;  1QE0 A;  3W3S A;  2PMF A;  4TVA A;  2DXU A;  4YRC A;  1PYS A;  4TTV A;  1EOV A;  2ZTG A;  1VQZ A;  2RHQ B;  3TEH A;  2Q7E A;  3TUP A;  4P73 A;  4H2W A;  2AMC A;  4TVW A;  4H2X B;  3RKX A;  3M4Q A;  2QHS A;  3A7R A;  1SER A;  3IKM B;  2ZR3 A;  3VQY A;  4YRT A;  4YRE A;  4CH3 A;  2DQ3 A;  2ZIN A;  3VQX A;  2E41 A;  4BW9 A;  2EJF A;  4YRP A;  1SES A;  1NYQ A;  3HRI A;  4YRI A;  4KQE A;  1EQR A;  3CMQ A;  3REU A;  1B70 A;  3A74 A;  2DZC A;  4YRR A;  4YRJ A;  1USY A;  1B76 A;  1YFR A;  2E5A A;  3NEN A;  2ZNJ A;  4XTY A;  3G1Z A;  4CS4 A;  2CJ9 A;  4H2T A;  2ZCE A;  4CS3 A;  4XEO A;  1YGB A;  4XTU A;  3UFG A;  4DPG A;  2RHS A;  3UGT A;  3TEG A;  1EVL A;  4K88 A;  4HWP A;  3A5Y A;  2CJB A;  3IKL A;  4P74 C;  4XTX A;  4YRN A;  3EFS A;  2Q5H A;  2J3L A;  2E65 A;  4XU1 A;  4PG3 A;  4RQF A;  1WQ7 A;  1W66 A;  3RF1 A;  4YRL A;  4XEM A;  5F5W A;  3LC0 A;  5C53 B;  3A7U A;  1RIQ A;  3QO7 A;  4OP0 A;  4WJ3 M;  1EFW A;  4Q6G A;  4E51 A;  3L4G A;  4YRM A;  4H2V A;  2I4N A;  4HA8 A;  4P72 C;  2ZT5 A;  4XU0 A;  4RQE A;  3E9H A;  4XTW A;  3VQV A;  4O2D A;  4P71 C;  2ZT8 A;  3ERR A;  2HNI A;  4XTZ A;  3V7C A;  2DEQ A;  1NJ8 A;  2QHT A;  4EO4 A;  4YDQ A;  1SRY A;  4H2S A;  3RGL A;  3FJP A;  4P75 A;  2IY5 A;  1JJC B;  4P3O A;  3PCO A;  1KOG A;  3M4P A;  1G5H A;  3P8Y A;  2ZNI A;  4CS2 A;  4YRF A;  3HFV A;  1EIY A;  1NJ2 A;  1X55 A; 
#chains in the Genus database with same CATH topology
 2Q7G A;  2C7I A;  2G4C A;  3V8J A;  3V7R A;  5K1P A;  4YCU A;  3UH0 A;  4PHC A;  1H4V B;  3A31 A;  3ICA A;  4EX5 A;  1H4T A;  2E1H A;  4G84 A;  1YFT A;  1E22 A;  4HWO A;  4P75 C;  1EVK A;  12AS A;  3V8L A;  5C52 B;  3MF1 A;  3MF2 A;  4H2Y A;  4TQF A;  4LVL A;  1HTT A;  3IG2 A;  5ELN A;  2DDZ A;  3HFZ A;  1ADJ A;  3RIR A;  1KMM A;  4L87 A;  1H4S A;  3RL6 A;  1HC7 A;  2ZT7 A;  4K87 A;  2ZZE A;  1HXD A;  2DQ0 A;  4KR2 A;  2CGH A;  3VQW A;  4J15 A;  4HWT A;  4P73 C;  2EJ9 A;  2Q5I A;  2ZIO A;  5KNN A;  2I4O A;  3V7S A;  1H4Q A;  4YCV A;  2ALY B;  1NJ5 A;  4H02 A;  4Q15 A;  1G51 A;  4HWR A;  5HGQ A;  11AS A;  4ZTZ B;  4XU3 A;  1GGM A;  4OLF A;  2I4M A;  1YFS A;  1QF6 A;  3HXW A;  1Z7M A;  3VBB A;  1C0A A;  2ARS A;  4P3N A;  2ZIM A;  2RHQ A;  4XTV A;  1USY C;  4ZIB A;  2DVE A;  2AKW B;  2PME A;  1B7Y B;  2XGT A;  3A32 A;  4HT4 A;  3HY1 A;  3MQZ A;  4TVA B;  4H2X A;  1PYS B;  4YP0 A;  4YRQ A;  4TVY A;  3HXU A;  4YCW A;  3TEH B;  3QNE A;  2Q7H A;  2E10 A;  4TWA A;  4WJ4 A;  1NJ6 A;  3DSQ A;  4CH4 A;  3NET A;  3UGQ A;  2XTI A;  2AMC B;  1ATI A;  3HXV A;  2ZXF A;  3V8K A;  2ODR C;  3EFR A;  3HRK A;  1X2G A;  2A8E A;  4CH6 A;  4AH6 A;  4DQ2 A;  4LVK A;  3QO5 A;  1BBW A;  2QHU A;  4YYE A;  3IAL A;  1X2H A;  1E1T A;  3BFM A;  4RMF A;  4YRG A;  2EAY A;  1B70 B;  3A5Z A;  1WPY A;  3WQZ A;  3KFU A;  1Z7N A;  2ZT6 A;  2DKG A;  1L0W A;  2CJA A;  1J5W A;  2C8M A;  4YRO A;  4LVI A;  2EWN A;  3HTZ A;  2ZGW A;  2FYK A;  1NJ1 A;  2RHS B;  1WU7 A;  4YRK A;  3BJU A;  3A7A A;  4WI1 A;  1X01 A;  4WF2 A;  5K1X A;  2E3C A;  4K86 A;  1X56 A;  2ZZG A;  3HY0 A;  4KR3 A;  3RUX A;  4UP7 A;  1YB3 A;  1SET A;  2EL9 A;  3NEL A;  3L2Z A;  3L4G B;  2DTI A;  3MEY A;  3QTC A;  2P5I A;  1BIB A;  3LSS A;  3HXX A;  2E64 A;  4NCX A;  2DTH A;  1E1O A;  1ADY A;  3LSQ A;  2ZZF A;  4HWS A;  2DU7 A;  4TQD A;  3E9I A;  1JJC A;  4P74 A;  2ART A;  1WNL A;  3R07 A;  3PZC A;  2J3M A;  1X54 A;  4H2U A;  4YPF A;  3NEM A;  4LNS A;  4ZTU B;  2IY5 B;  3PCO B;  1G5I A;  3HXZ A;  4UP9 A;  2NS6 A;  2ODR D;  4P72 A;  2EJG A;  5E3I A;  3RKW A;  1B8A A;  3RKY A;  1EIY B;  2DXT A;  1BBU A;  4YRS A;  4XU2 A;  4CH5 A;  4P71 A;  1NYR A;  2DZ9 A;  3I7F A;  3P8V A;  3REX A;  1FYF A;  2P0L A;  1ASY A;  1WLE A;  3L1A A;  4UP8 A;  2DU5 A;  4HVC A;  3P8T A;  1NNH A;  4UPA A;  1ASZ A;  1N9W A;  4RDX A;  5ELO A;  4G85 A;  4P3P A;  1E24 A;  1WQW A;  2QHV A;  4LVM A;  3HXY A;  2DTO A;  3HFZ B;  1KMN A;  3RAC A;  2ALY A;  4BWA A;  2DJZ A;  1WYD A;  4X5O A;  2CIM A;  1IL2 A;  3OD1 A;  4LVJ A;  2ZR2 A;  2ARU A;  5C51 B;  3QO8 A;  1BIA A;  1LYL A;  2I4L A;  2AKW A;  1B7Y A;  1QE0 A;  3W3S A;  2PMF A;  4TVA A;  2DXU A;  4YRC A;  1PYS A;  4TTV A;  1EOV A;  2ZTG A;  1VQZ A;  2RHQ B;  3TEH A;  2Q7E A;  3TUP A;  4P73 A;  4H2W A;  2AMC A;  4TVW A;  4H2X B;  3RKX A;  3M4Q A;  2QHS A;  3A7R A;  1SER A;  3IKM B;  2ZR3 A;  3VQY A;  4YRT A;  4YRE A;  4CH3 A;  2DQ3 A;  2ZIN A;  3VQX A;  2E41 A;  4BW9 A;  2EJF A;  4YRP A;  1SES A;  1NYQ A;  3HRI A;  4YRI A;  4KQE A;  1EQR A;  3CMQ A;  3REU A;  1B70 A;  3A74 A;  2DZC A;  4YRR A;  4YRJ A;  1USY A;  1B76 A;  1YFR A;  2E5A A;  3NEN A;  2ZNJ A;  4XTY A;  3G1Z A;  4CS4 A;  2CJ9 A;  4H2T A;  2ZCE A;  4CS3 A;  4XEO A;  1YGB A;  4XTU A;  3UFG A;  4DPG A;  2RHS A;  3UGT A;  3TEG A;  1EVL A;  4K88 A;  4HWP A;  3A5Y A;  2CJB A;  3IKL A;  4P74 C;  4XTX A;  4YRN A;  3EFS A;  2Q5H A;  2J3L A;  2E65 A;  4XU1 A;  4PG3 A;  4RQF A;  1WQ7 A;  1W66 A;  3RF1 A;  4YRL A;  4XEM A;  5F5W A;  3LC0 A;  5C53 B;  3A7U A;  1RIQ A;  3QO7 A;  4OP0 A;  4WJ3 M;  1EFW A;  4Q6G A;  4E51 A;  3L4G A;  4YRM A;  4H2V A;  2I4N A;  4HA8 A;  4P72 C;  2ZT5 A;  4XU0 A;  4RQE A;  3E9H A;  4XTW A;  3VQV A;  4O2D A;  4P71 C;  2ZT8 A;  3ERR A;  2HNI A;  4XTZ A;  3V7C A;  2DEQ A;  1NJ8 A;  2QHT A;  4EO4 A;  4YDQ A;  1SRY A;  4H2S A;  3RGL A;  3FJP A;  4P75 A;  2IY5 A;  1JJC B;  4P3O A;  3PCO A;  1KOG A;  3M4P A;  1G5H A;  3P8Y A;  2ZNI A;  4CS2 A;  4YRF A;  3HFV A;  1EIY A;  1NJ2 A;  1X55 A; 
#chains in the Genus database with same CATH homology
 2Q7G A;  2C7I A;  2G4C A;  3V8J A;  3V7R A;  5K1P A;  4YCU A;  3UH0 A;  4PHC A;  1H4V B;  3A31 A;  3ICA A;  4EX5 A;  1H4T A;  2E1H A;  4G84 A;  1YFT A;  1E22 A;  4HWO A;  4P75 C;  1EVK A;  12AS A;  3V8L A;  5C52 B;  3MF1 A;  3MF2 A;  4H2Y A;  4TQF A;  4LVL A;  1HTT A;  3IG2 A;  5ELN A;  2DDZ A;  3HFZ A;  1ADJ A;  3RIR A;  1KMM A;  4L87 A;  1H4S A;  3RL6 A;  1HC7 A;  2ZT7 A;  4K87 A;  2ZZE A;  1HXD A;  2DQ0 A;  4KR2 A;  2CGH A;  3VQW A;  4J15 A;  4HWT A;  4P73 C;  2EJ9 A;  2Q5I A;  2ZIO A;  5KNN A;  2I4O A;  3V7S A;  1H4Q A;  4YCV A;  2ALY B;  1NJ5 A;  4H02 A;  4Q15 A;  1G51 A;  4HWR A;  5HGQ A;  11AS A;  4ZTZ B;  4XU3 A;  1GGM A;  4OLF A;  2I4M A;  1YFS A;  1QF6 A;  3HXW A;  1Z7M A;  3VBB A;  1C0A A;  2ARS A;  4P3N A;  2ZIM A;  2RHQ A;  4XTV A;  1USY C;  4ZIB A;  2DVE A;  2AKW B;  2PME A;  1B7Y B;  2XGT A;  3A32 A;  4HT4 A;  3HY1 A;  3MQZ A;  4TVA B;  4H2X A;  1PYS B;  4YP0 A;  4YRQ A;  4TVY A;  3HXU A;  4YCW A;  3TEH B;  3QNE A;  2Q7H A;  2E10 A;  4TWA A;  4WJ4 A;  1NJ6 A;  3DSQ A;  4CH4 A;  3NET A;  3UGQ A;  2XTI A;  2AMC B;  1ATI A;  3HXV A;  2ZXF A;  3V8K A;  2ODR C;  3EFR A;  3HRK A;  1X2G A;  2A8E A;  4CH6 A;  4AH6 A;  4DQ2 A;  4LVK A;  3QO5 A;  1BBW A;  2QHU A;  4YYE A;  3IAL A;  1X2H A;  1E1T A;  3BFM A;  4RMF A;  4YRG A;  2EAY A;  1B70 B;  3A5Z A;  1WPY A;  3WQZ A;  3KFU A;  1Z7N A;  2ZT6 A;  2DKG A;  1L0W A;  2CJA A;  1J5W A;  2C8M A;  4YRO A;  4LVI A;  2EWN A;  3HTZ A;  2ZGW A;  2FYK A;  1NJ1 A;  2RHS B;  1WU7 A;  4YRK A;  3BJU A;  3A7A A;  4WI1 A;  1X01 A;  4WF2 A;  5K1X A;  2E3C A;  4K86 A;  1X56 A;  2ZZG A;  3HY0 A;  4KR3 A;  3RUX A;  4UP7 A;  1YB3 A;  1SET A;  2EL9 A;  3NEL A;  3L2Z A;  3L4G B;  2DTI A;  3MEY A;  3QTC A;  2P5I A;  1BIB A;  3LSS A;  3HXX A;  2E64 A;  4NCX A;  2DTH A;  1E1O A;  1ADY A;  3LSQ A;  2ZZF A;  4HWS A;  2DU7 A;  4TQD A;  3E9I A;  1JJC A;  4P74 A;  2ART A;  1WNL A;  3R07 A;  3PZC A;  2J3M A;  1X54 A;  4H2U A;  4YPF A;  3NEM A;  4LNS A;  4ZTU B;  2IY5 B;  3PCO B;  1G5I A;  3HXZ A;  4UP9 A;  2NS6 A;  2ODR D;  4P72 A;  2EJG A;  5E3I A;  3RKW A;  1B8A A;  3RKY A;  1EIY B;  2DXT A;  1BBU A;  4YRS A;  4XU2 A;  4CH5 A;  4P71 A;  1NYR A;  2DZ9 A;  3I7F A;  3P8V A;  3REX A;  1FYF A;  2P0L A;  1ASY A;  1WLE A;  3L1A A;  4UP8 A;  2DU5 A;  4HVC A;  3P8T A;  1NNH A;  4UPA A;  1ASZ A;  1N9W A;  4RDX A;  5ELO A;  4G85 A;  4P3P A;  1E24 A;  1WQW A;  2QHV A;  4LVM A;  3HXY A;  2DTO A;  3HFZ B;  1KMN A;  3RAC A;  2ALY A;  4BWA A;  2DJZ A;  1WYD A;  4X5O A;  2CIM A;  1IL2 A;  3OD1 A;  4LVJ A;  2ZR2 A;  2ARU A;  5C51 B;  3QO8 A;  1BIA A;  1LYL A;  2I4L A;  2AKW A;  1B7Y A;  1QE0 A;  3W3S A;  2PMF A;  4TVA A;  2DXU A;  4YRC A;  1PYS A;  4TTV A;  1EOV A;  2ZTG A;  1VQZ A;  2RHQ B;  3TEH A;  2Q7E A;  3TUP A;  4P73 A;  4H2W A;  2AMC A;  4TVW A;  4H2X B;  3RKX A;  3M4Q A;  2QHS A;  3A7R A;  1SER A;  3IKM B;  2ZR3 A;  3VQY A;  4YRT A;  4YRE A;  4CH3 A;  2DQ3 A;  2ZIN A;  3VQX A;  2E41 A;  4BW9 A;  2EJF A;  4YRP A;  1SES A;  1NYQ A;  3HRI A;  4YRI A;  4KQE A;  1EQR A;  3CMQ A;  3REU A;  1B70 A;  3A74 A;  2DZC A;  4YRR A;  4YRJ A;  1USY A;  1B76 A;  1YFR A;  2E5A A;  3NEN A;  2ZNJ A;  4XTY A;  3G1Z A;  4CS4 A;  2CJ9 A;  4H2T A;  2ZCE A;  4CS3 A;  4XEO A;  1YGB A;  4XTU A;  3UFG A;  4DPG A;  2RHS A;  3UGT A;  3TEG A;  1EVL A;  4K88 A;  4HWP A;  3A5Y A;  2CJB A;  3IKL A;  4P74 C;  4XTX A;  4YRN A;  3EFS A;  2Q5H A;  2J3L A;  2E65 A;  4XU1 A;  4PG3 A;  4RQF A;  1WQ7 A;  1W66 A;  3RF1 A;  4YRL A;  4XEM A;  5F5W A;  3LC0 A;  5C53 B;  3A7U A;  1RIQ A;  3QO7 A;  4OP0 A;  4WJ3 M;  1EFW A;  4Q6G A;  4E51 A;  3L4G A;  4YRM A;  4H2V A;  2I4N A;  4HA8 A;  4P72 C;  2ZT5 A;  4XU0 A;  4RQE A;  3E9H A;  4XTW A;  3VQV A;  4O2D A;  4P71 C;  2ZT8 A;  3ERR A;  2HNI A;  4XTZ A;  3V7C A;  2DEQ A;  1NJ8 A;  2QHT A;  4EO4 A;  4YDQ A;  1SRY A;  4H2S A;  3RGL A;  3FJP A;  4P75 A;  2IY5 A;  1JJC B;  4P3O A;  3PCO A;  1KOG A;  3M4P A;  1G5H A;  3P8Y A;  2ZNI A;  4CS2 A;  4YRF A;  3HFV A;  1EIY A;  1NJ2 A;  1X55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...