1RIQA

The crystal structure of the catalytic fragment of the alanyl-trna synthetase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Alanyl-tRNA Synthetase Crystal Structure and Design for Acceptor-Stem Recognition
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 152
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1riqA01
3L4GB 4PG3A 4YRKA 3V7CA 2ARUA 2E64A 2EWNA 3QO7A 4P3PA 2ZGWA 4ZIBA 2E3CA 3VQYA 3LSSA 4YREA 1ASZA 4CH4A 1USYA 4L87A 4HVCA 1HC7A 3VQVA 1B7YA 3REXA 2EJFA 2ODRC 1BBUA 1X2HA 3UFGA 3HXYA 2CGHA 2RHQB 3L4GA 3HXXA 2RHSB 3HFVA 4YRMA 4HWTA 1WQWA 2ZIMA 2E5AA 2QHSA 2ZT6A 2CJ9A 2PMFA 4H2VA 1G5HA 4LNSA 2Q5HA 3RACA 1X55A 3RKYA 3UH0A 11ASA 4H02A 3FJPA 4WI1A 3PCOB 2ZT5A 4YRRA 3E9IA 2DU5A 1BBWA 3WQZA 1NYQA 2ZR3A 2RHQA 2CJAA 4P72A 2RHSA 1X54A 3MF2A 1X2GA 2ZZGA 3HRIA 3HXUA 4BWAA 4TQFA 4P3OA 4DQ2A 1KMMA 4RQEA 1NJ8A 2E65A 2DEQA 5E3IA 4HWSA 4TWAA 4YRSA 4H2XB 1KMNA 2XGTA 2AMCB 4P71C 3A5YA 3RKWA 2DKGA 1C0AA 1PYSB 3G1ZA 4XTZA 1WU7A 3PCOA 3VQWA 2DTIA 1KOGA 2DTHA 4OLFA 4H2SA 1SERA 4H2YA 4XU1A 3TEHB 2ZNIA 2DDZA 3MF1A 4OP0A 1YB3A 1SESA 5K1PA 4Q6GA 4YCVA 3QO8A 1L0WA 1NNHA 2QHTA 2ZR2A 3A5ZA 4O2DA 4BW9A 1EVKA 2QHVA 4H2XA 4YRIA 2AMCA 1PYSA 4XTVA 1B76A 3HY1A 2Q5IA 3A7UA 2XTIA 2I4LA 1YFSA 4H2TA 1WLEA 3TEHA 5K1XA 1WYDA 3UGTA 3IALA 3EFRA 3VQXA 2DZCA 4XTUA 2ZT7A 1VQZA 4XEMA 1H4TA 1NJ6A 5C52B 2ZIOA 3HXVA 4K86A 2P0LA 4KQEA 4TQDA 1ATIA 2DVEA 2ZXFA 3PZCA 1W66A 3IG2A 3QO5A 4TVYA 2DZ9A 2E10A 4WJ4A 4E51A 2DQ0A 1LYLA 3TEGA 4P3NA 3REUA 4CS3A 4CH5A 3QTCA 4P75A 2CJBA 4YRQA 1USYC 3ERRA 4NCXA 3V7RA 4YRPA 2EJGA 4K88A 1NYRA 5HGQA 4P73C 2ZZFA 2Q7GA 1QF6A 4WJ3M 2FYKA 2I4OA 4UPAA 4XU3A 4P74A 3M4QA 4KR2A 2ARSA 4YRLA 4Q15A 3W3SA 5C53B 3NELA 1IL2A 5C51B 3P8YA 5KNNA 3CMQA 1J5WA 3A7RA 4XU2A 4YCWA 3BFMA 4UP7A 2CIMA 3IKMB 2I4NA 3BJUA 2DXUA 4YP0A 4HA8A 4RMFA 1H4QA 4WF2A 3L2ZA 3IKLA 4YYEA 4RQFA 4YRNA 4TVAB 2EAYA 4YRCA 1X01A 2IY5B 4UP9A 3HFZB 4J15A 2E1HA 2PMEA 2ZTGA 3HTZA 4XU0A 1Z7NA 4HWRA 4HWPA 3HRKA 4YROA 1B8AA 1E24A 2C7IA 1RIQA 1X56A 3RF1A 3E9HA 3ICAA 3I7FA 4PHCA 4XTWA 3RIRA 2ZNJA 4YCUA 1E1OA 1HXDA 3KFUA 2AKWB 3A7AA 3TUPA 3UGQA 3LC0A 2EL9A 3NENA 2QHUA 4G85A 1NJ2A 4CS4A 3HXZA 4TVAA 3P8VA 1ADJA 2IY5A 1BIAA 3HFZA 3RKXA 3A31A 4HWOA 1H4SA 1G5IA 3QNEA 1SRYA 5ELNA 4YRJA 4RDXA 1H4VB 3R07A 1EVLA 4TVWA 1E22A 3OD1A 2J3LA 4X5OA 2ZT8A 2ALYB 2AKWA 4DPGA 3V7SA 4P73A 1N9WA 2G4CA 5F5WA 2ARTA 1FYFA 4UP8A 2DJZA 4KR3A 4H2WA 4YRFA 1NJ5A 1EQRA 2ZCEA 4AH6A 2I4MA 2Q7HA 4P71A 4ZTUB 2ZZEA 1JJCB 2ODRD 1WPYA 2P5IA 3DSQA 3RUXA 1YFRA 4CS2A 2DXTA 4YRGA 2EJ9A 2ZINA 4CH3A 1G51A 1Z7MA 1WNLA 4CH6A 3MEYA 2ALYA 1YGBA 3L1AA 4K87A 2Q7EA 4H2UA 3NETA 4XEOA 2HNIA 3V8KA 3A74A 1EIYB 3NEMA 1SETA 3RL6A 4YRTA 4ZTZB 1YFTA 3HY0A 3V8JA 4YDQA 1B70B 12ASA 4XTYA 4P75C 1JJCA 1EOVA 3VBBA 3V8LA 1GGMA 1ADYA 2C8MA 4EO4A 1HTTA 1E1TA 4P72C 3M4PA 2J3MA 1WQ7A 1ASYA 4YPFA 4G84A 4P74C 5ELOA 3A32A 2DQ3A 3LSQA 2E41A 1EIYA 3HXWA 2DU7A 1EFWA 1B7YB 4XTXA 1BIBA 1B70A 1NJ1A 4TTVA 4EX5A 3EFSA 1QE0A 3RGLA 2DTOA 3P8TA
chains in the Genus database with same CATH superfamily
3L4GB 4PG3A 4LVLA 4YRKA 3V7CA 2ARUA 2E64A 2EWNA 3QO7A 4P3PA 2ZGWA 4ZIBA 2E3CA 3VQYA 3LSSA 4YREA 1ASZA 4CH4A 1USYA 4L87A 4HVCA 1HC7A 3VQVA 1B7YA 3REXA 2EJFA 2ODRC 1BBUA 1X2HA 3UFGA 3HXYA 2CGHA 2RHQB 3L4GA 3HXXA 2RHSB 3HFVA 4YRMA 4HWTA 1WQWA 2ZIMA 2E5AA 2QHSA 2ZT6A 2CJ9A 2PMFA 4H2VA 1G5HA 4LNSA 2Q5HA 3RACA 1X55A 3RKYA 3UH0A 11ASA 4H02A 3FJPA 4WI1A 3PCOB 2ZT5A 4YRRA 3E9IA 2DU5A 1BBWA 3WQZA 1NYQA 2ZR3A 2RHQA 2CJAA 4P72A 2RHSA 1X54A 3MF2A 1X2GA 2ZZGA 3HRIA 3HXUA 4BWAA 4TQFA 4P3OA 4DQ2A 1KMMA 4RQEA 1NJ8A 2E65A 2DEQA 5E3IA 4HWSA 4TWAA 3MQZA 4YRSA 4H2XB 1KMNA 2XGTA 2AMCB 4P71C 3A5YA 3RKWA 2DKGA 1C0AA 1PYSB 3G1ZA 4XTZA 1WU7A 4LVKA 3PCOA 3VQWA 2DTIA 1KOGA 2DTHA 4OLFA 4H2SA 1SERA 4H2YA 4XU1A 3TEHB 2ZNIA 2DDZA 3MF1A 4OP0A 1YB3A 1SESA 5K1PA 4Q6GA 4YCVA 3QO8A 1L0WA 1NNHA 2QHTA 2ZR2A 3A5ZA 4O2DA 4BW9A 1EVKA 2QHVA 4H2XA 4YRIA 2AMCA 1PYSA 4XTVA 1B76A 3HY1A 2Q5IA 3A7UA 2XTIA 2I4LA 1YFSA 4H2TA 1WLEA 3TEHA 5K1XA 1WYDA 3UGTA 3IALA 3EFRA 3VQXA 2DZCA 4XTUA 2ZT7A 1VQZA 4XEMA 1H4TA 1NJ6A 5C52B 2ZIOA 3HXVA 4K86A 2P0LA 4KQEA 4TQDA 1ATIA 2DVEA 2ZXFA 3PZCA 1W66A 3IG2A 3QO5A 4TVYA 2DZ9A 2E10A 4WJ4A 4E51A 2DQ0A 1LYLA 3TEGA 4P3NA 3REUA 4CS3A 4CH5A 3QTCA 4P75A 2CJBA 4YRQA 4LVIA 1USYC 3ERRA 4NCXA 3V7RA 4YRPA 2EJGA 4K88A 1NYRA 5HGQA 4P73C 2ZZFA 2Q7GA 1QF6A 4WJ3M 2FYKA 2I4OA 4UPAA 4XU3A 4P74A 3M4QA 4KR2A 2ARSA 4YRLA 4Q15A 3W3SA 5C53B 3NELA 1IL2A 5C51B 3P8YA 5KNNA 3CMQA 1J5WA 3A7RA 4XU2A 4YCWA 3BFMA 4UP7A 2CIMA 3IKMB 2I4NA 3BJUA 2DXUA 4YP0A 4HA8A 4RMFA 1H4QA 4WF2A 3L2ZA 3IKLA 4YYEA 4RQFA 4YRNA 4TVAB 2EAYA 4YRCA 1X01A 2IY5B 4UP9A 3HFZB 4J15A 2E1HA 2PMEA 2ZTGA 3HTZA 4XU0A 1Z7NA 4HWRA 4HWPA 3HRKA 4YROA 1B8AA 1E24A 2C7IA 1RIQA 1X56A 3RF1A 3E9HA 2A8EA 3ICAA 3I7FA 4PHCA 4XTWA 3RIRA 2ZNJA 4YCUA 1E1OA 1HXDA 3KFUA 2AKWB 3A7AA 3TUPA 3UGQA 3LC0A 2EL9A 3NENA 2QHUA 4G85A 1NJ2A 4CS4A 3HXZA 4TVAA 3P8VA 1ADJA 2IY5A 1BIAA 3HFZA 3RKXA 3A31A 4HWOA 1H4SA 1G5IA 3QNEA 1SRYA 2NS6A 5ELNA 4YRJA 4RDXA 1H4VB 3R07A 1EVLA 4TVWA 1E22A 3OD1A 2J3LA 4X5OA 2ZT8A 2ALYB 2AKWA 4DPGA 3V7SA 4P73A 1N9WA 2G4CA 5F5WA 2ARTA 1FYFA 4UP8A 2DJZA 4KR3A 4HT4A 4H2WA 4YRFA 1NJ5A 1EQRA 2ZCEA 4LVMA 4AH6A 2I4MA 2Q7HA 4P71A 4ZTUB 2ZZEA 1JJCB 2ODRD 1WPYA 2P5IA 3DSQA 3RUXA 1YFRA 4CS2A 2DXTA 4YRGA 2EJ9A 2ZINA 4CH3A 1G51A 1Z7MA 1WNLA 4CH6A 3MEYA 2ALYA 1YGBA 3L1AA 4K87A 2Q7EA 4H2UA 3NETA 4XEOA 2HNIA 3V8KA 3A74A 1EIYB 3NEMA 1SETA 3RL6A 4YRTA 4ZTZB 1YFTA 3HY0A 3V8JA 4YDQA 1B70B 12ASA 4XTYA 4P75C 1JJCA 1EOVA 3VBBA 3V8LA 1GGMA 1ADYA 2C8MA 4EO4A 1HTTA 1E1TA 4P72C 3M4PA 2J3MA 1WQ7A 1ASYA 4YPFA 4G84A 4P74C 5ELOA 3A32A 2DQ3A 3LSQA 2E41A 1EIYA 3HXWA 2DU7A 1EFWA 1B7YB 4XTXA 1BIBA 1B70A 1NJ1A 4TTVA 4EX5A 3EFSA 1QE0A 3RGLA 2DTOA 4LVJA 3P8TA
chains in the Genus database with same CATH topology
3L4GB 4PG3A 4LVLA 4YRKA 3V7CA 2ARUA 2E64A 2EWNA 3QO7A 4P3PA 2ZGWA 4ZIBA 2E3CA 3VQYA 3LSSA 4YREA 1ASZA 4CH4A 1USYA 4L87A 4HVCA 1HC7A 3VQVA 1B7YA 3REXA 2EJFA 2ODRC 1BBUA 1X2HA 3UFGA 3HXYA 2CGHA 2RHQB 3L4GA 3HXXA 2RHSB 3HFVA 4YRMA 4HWTA 1WQWA 2ZIMA 2E5AA 2QHSA 2ZT6A 2CJ9A 2PMFA 4H2VA 1G5HA 4LNSA 2Q5HA 3RACA 1X55A 3RKYA 3UH0A 11ASA 4H02A 3FJPA 4WI1A 3PCOB 2ZT5A 4YRRA 3E9IA 2DU5A 1BBWA 3WQZA 1NYQA 2ZR3A 2RHQA 2CJAA 4P72A 2RHSA 1X54A 3MF2A 1X2GA 2ZZGA 3HRIA 3HXUA 4BWAA 4TQFA 4P3OA 4DQ2A 1KMMA 4RQEA 1NJ8A 2E65A 2DEQA 5E3IA 4HWSA 4TWAA 3MQZA 4YRSA 4H2XB 1KMNA 2XGTA 2AMCB 4P71C 3A5YA 3RKWA 2DKGA 1C0AA 1PYSB 3G1ZA 4XTZA 1WU7A 4LVKA 3PCOA 3VQWA 2DTIA 1KOGA 2DTHA 4OLFA 4H2SA 1SERA 4H2YA 4XU1A 3TEHB 2ZNIA 2DDZA 3MF1A 4OP0A 1YB3A 1SESA 5K1PA 4Q6GA 4YCVA 3QO8A 1L0WA 1NNHA 2QHTA 2ZR2A 3A5ZA 4O2DA 4BW9A 1EVKA 2QHVA 4H2XA 4YRIA 2AMCA 1PYSA 4XTVA 1B76A 3HY1A 2Q5IA 3A7UA 2XTIA 2I4LA 1YFSA 4H2TA 1WLEA 3TEHA 5K1XA 1WYDA 3UGTA 3IALA 3EFRA 3VQXA 2DZCA 4XTUA 2ZT7A 1VQZA 4XEMA 1H4TA 1NJ6A 5C52B 2ZIOA 3HXVA 4K86A 2P0LA 4KQEA 4TQDA 1ATIA 2DVEA 2ZXFA 3PZCA 1W66A 3IG2A 3QO5A 4TVYA 2DZ9A 2E10A 4WJ4A 4E51A 2DQ0A 1LYLA 3TEGA 4P3NA 3REUA 4CS3A 4CH5A 3QTCA 4P75A 2CJBA 4YRQA 4LVIA 1USYC 3ERRA 4NCXA 3V7RA 4YRPA 2EJGA 4K88A 1NYRA 5HGQA 4P73C 2ZZFA 2Q7GA 1QF6A 4WJ3M 2FYKA 2I4OA 4UPAA 4XU3A 4P74A 3M4QA 4KR2A 2ARSA 4YRLA 4Q15A 3W3SA 5C53B 3NELA 1IL2A 5C51B 3P8YA 5KNNA 3CMQA 1J5WA 3A7RA 4XU2A 4YCWA 3BFMA 4UP7A 2CIMA 3IKMB 2I4NA 3BJUA 2DXUA 4YP0A 4HA8A 4RMFA 1H4QA 4WF2A 3L2ZA 3IKLA 4YYEA 4RQFA 4YRNA 4TVAB 2EAYA 4YRCA 1X01A 2IY5B 4UP9A 3HFZB 4J15A 2E1HA 2PMEA 2ZTGA 3HTZA 4XU0A 1Z7NA 4HWRA 4HWPA 3HRKA 4YROA 1B8AA 1E24A 2C7IA 1RIQA 1X56A 3RF1A 3E9HA 2A8EA 3ICAA 3I7FA 4PHCA 4XTWA 3RIRA 2ZNJA 4YCUA 1E1OA 1HXDA 3KFUA 2AKWB 3A7AA 3TUPA 3UGQA 3LC0A 2EL9A 3NENA 2QHUA 4G85A 1NJ2A 4CS4A 3HXZA 4TVAA 3P8VA 1ADJA 2IY5A 1BIAA 3HFZA 3RKXA 3A31A 4HWOA 1H4SA 1G5IA 3QNEA 1SRYA 2NS6A 5ELNA 4YRJA 4RDXA 1H4VB 3R07A 1EVLA 4TVWA 1E22A 3OD1A 2J3LA 4X5OA 2ZT8A 2ALYB 2AKWA 4DPGA 3V7SA 4P73A 1N9WA 2G4CA 5F5WA 2ARTA 1FYFA 4UP8A 2DJZA 4KR3A 4HT4A 4H2WA 4YRFA 1NJ5A 1EQRA 2ZCEA 4LVMA 4AH6A 2I4MA 2Q7HA 4P71A 4ZTUB 2ZZEA 1JJCB 2ODRD 1WPYA 2P5IA 3DSQA 3RUXA 1YFRA 4CS2A 2DXTA 4YRGA 2EJ9A 2ZINA 4CH3A 1G51A 1Z7MA 1WNLA 4CH6A 3MEYA 2ALYA 1YGBA 3L1AA 4K87A 2Q7EA 4H2UA 3NETA 4XEOA 2HNIA 3V8KA 3A74A 1EIYB 3NEMA 1SETA 3RL6A 4YRTA 4ZTZB 1YFTA 3HY0A 3V8JA 4YDQA 1B70B 12ASA 4XTYA 4P75C 1JJCA 1EOVA 3VBBA 3V8LA 1GGMA 1ADYA 2C8MA 4EO4A 1HTTA 1E1TA 4P72C 3M4PA 2J3MA 1WQ7A 1ASYA 4YPFA 4G84A 4P74C 5ELOA 3A32A 2DQ3A 3LSQA 2E41A 1EIYA 3HXWA 2DU7A 1EFWA 1B7YB 4XTXA 1BIBA 1B70A 1NJ1A 4TTVA 4EX5A 3EFSA 1QE0A 3RGLA 2DTOA 4LVJA 3P8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4G B;  4PG3 A;  4YRK A;  3V7C A;  2ARU A;  2E64 A;  2EWN A;  3QO7 A;  4P3P A;  2ZGW A;  4ZIB A;  2E3C A;  3VQY A;  3LSS A;  4YRE A;  1ASZ A;  4CH4 A;  1USY A;  4L87 A;  4HVC A;  1HC7 A;  3VQV A;  1B7Y A;  3REX A;  2EJF A;  2ODR C;  1BBU A;  1X2H A;  3UFG A;  3HXY A;  2CGH A;  2RHQ B;  3L4G A;  3HXX A;  2RHS B;  3HFV A;  4YRM A;  4HWT A;  1WQW A;  2ZIM A;  2E5A A;  2QHS A;  2ZT6 A;  2CJ9 A;  2PMF A;  4H2V A;  1G5H A;  4LNS A;  2Q5H A;  3RAC A;  1X55 A;  3RKY A;  3UH0 A;  11AS A;  4H02 A;  3FJP A;  4WI1 A;  3PCO B;  2ZT5 A;  4YRR A;  3E9I A;  2DU5 A;  1BBW A;  3WQZ A;  1NYQ A;  2ZR3 A;  2RHQ A;  2CJA A;  4P72 A;  2RHS A;  1X54 A;  3MF2 A;  1X2G A;  2ZZG A;  3HRI A;  3HXU A;  4BWA A;  4TQF A;  4P3O A;  4DQ2 A;  1KMM A;  4RQE A;  1NJ8 A;  2E65 A;  2DEQ A;  5E3I A;  4HWS A;  4TWA A;  4YRS A;  4H2X B;  1KMN A;  2XGT A;  2AMC B;  4P71 C;  3A5Y A;  3RKW A;  2DKG A;  1C0A A;  1PYS B;  3G1Z A;  4XTZ A;  1WU7 A;  3PCO A;  3VQW A;  2DTI A;  1KOG A;  2DTH A;  4OLF A;  4H2S A;  1SER A;  4H2Y A;  4XU1 A;  3TEH B;  2ZNI A;  2DDZ A;  3MF1 A;  4OP0 A;  1YB3 A;  1SES A;  5K1P A;  4Q6G A;  4YCV A;  3QO8 A;  1L0W A;  1NNH A;  2QHT A;  2ZR2 A;  3A5Z A;  4O2D A;  4BW9 A;  1EVK A;  2QHV A;  4H2X A;  4YRI A;  2AMC A;  1PYS A;  4XTV A;  1B76 A;  3HY1 A;  2Q5I A;  3A7U A;  2XTI A;  2I4L A;  1YFS A;  4H2T A;  1WLE A;  3TEH A;  5K1X A;  1WYD A;  3UGT A;  3IAL A;  3EFR A;  3VQX A;  2DZC A;  4XTU A;  2ZT7 A;  1VQZ A;  4XEM A;  1H4T A;  1NJ6 A;  5C52 B;  2ZIO A;  3HXV A;  4K86 A;  2P0L A;  4KQE A;  4TQD A;  1ATI A;  2DVE A;  2ZXF A;  3PZC A;  1W66 A;  3IG2 A;  3QO5 A;  4TVY A;  2DZ9 A;  2E10 A;  4WJ4 A;  4E51 A;  2DQ0 A;  1LYL A;  3TEG A;  4P3N A;  3REU A;  4CS3 A;  4CH5 A;  3QTC A;  4P75 A;  2CJB A;  4YRQ A;  1USY C;  3ERR A;  4NCX A;  3V7R A;  4YRP A;  2EJG A;  4K88 A;  1NYR A;  5HGQ A;  4P73 C;  2ZZF A;  2Q7G A;  1QF6 A;  4WJ3 M;  2FYK A;  2I4O A;  4UPA A;  4XU3 A;  4P74 A;  3M4Q A;  4KR2 A;  2ARS A;  4YRL A;  4Q15 A;  3W3S A;  5C53 B;  3NEL A;  1IL2 A;  5C51 B;  3P8Y A;  5KNN A;  3CMQ A;  1J5W A;  3A7R A;  4XU2 A;  4YCW A;  3BFM A;  4UP7 A;  2CIM A;  3IKM B;  2I4N A;  3BJU A;  2DXU A;  4YP0 A;  4HA8 A;  4RMF A;  1H4Q A;  4WF2 A;  3L2Z A;  3IKL A;  4YYE A;  4RQF A;  4YRN A;  4TVA B;  2EAY A;  4YRC A;  1X01 A;  2IY5 B;  4UP9 A;  3HFZ B;  4J15 A;  2E1H A;  2PME A;  2ZTG A;  3HTZ A;  4XU0 A;  1Z7N A;  4HWR A;  4HWP A;  3HRK A;  4YRO A;  1B8A A;  1E24 A;  2C7I A;  1RIQ A;  1X56 A;  3RF1 A;  3E9H A;  3ICA A;  3I7F A;  4PHC A;  4XTW A;  3RIR A;  2ZNJ A;  4YCU A;  1E1O A;  1HXD A;  3KFU A;  2AKW B;  3A7A A;  3TUP A;  3UGQ A;  3LC0 A;  2EL9 A;  3NEN A;  2QHU A;  4G85 A;  1NJ2 A;  4CS4 A;  3HXZ A;  4TVA A;  3P8V A;  1ADJ A;  2IY5 A;  1BIA A;  3HFZ A;  3RKX A;  3A31 A;  4HWO A;  1H4S A;  1G5I A;  3QNE A;  1SRY A;  5ELN A;  4YRJ A;  4RDX A;  1H4V B;  3R07 A;  1EVL A;  4TVW A;  1E22 A;  3OD1 A;  2J3L A;  4X5O A;  2ZT8 A;  2ALY B;  2AKW A;  4DPG A;  3V7S A;  4P73 A;  1N9W A;  2G4C A;  5F5W A;  2ART A;  1FYF A;  4UP8 A;  2DJZ A;  4KR3 A;  4H2W A;  4YRF A;  1NJ5 A;  1EQR A;  2ZCE A;  4AH6 A;  2I4M A;  2Q7H A;  4P71 A;  4ZTU B;  2ZZE A;  1JJC B;  2ODR D;  1WPY A;  2P5I A;  3DSQ A;  3RUX A;  1YFR A;  4CS2 A;  2DXT A;  4YRG A;  2EJ9 A;  2ZIN A;  4CH3 A;  1G51 A;  1Z7M A;  1WNL A;  4CH6 A;  3MEY A;  2ALY A;  1YGB A;  3L1A A;  4K87 A;  2Q7E A;  4H2U A;  3NET A;  4XEO A;  2HNI A;  3V8K A;  3A74 A;  1EIY B;  3NEM A;  1SET A;  3RL6 A;  4YRT A;  4ZTZ B;  1YFT A;  3HY0 A;  3V8J A;  4YDQ A;  1B70 B;  12AS A;  4XTY A;  4P75 C;  1JJC A;  1EOV A;  3VBB A;  3V8L A;  1GGM A;  1ADY A;  2C8M A;  4EO4 A;  1HTT A;  1E1T A;  4P72 C;  3M4P A;  2J3M A;  1WQ7 A;  1ASY A;  4YPF A;  4G84 A;  4P74 C;  5ELO A;  3A32 A;  2DQ3 A;  3LSQ A;  2E41 A;  1EIY A;  3HXW A;  2DU7 A;  1EFW A;  1B7Y B;  4XTX A;  1BIB A;  1B70 A;  1NJ1 A;  4TTV A;  4EX5 A;  3EFS A;  1QE0 A;  3RGL A;  2DTO A;  3P8T A; 
#chains in the Genus database with same CATH topology
 3L4G B;  4PG3 A;  4LVL A;  4YRK A;  3V7C A;  2ARU A;  2E64 A;  2EWN A;  3QO7 A;  4P3P A;  2ZGW A;  4ZIB A;  2E3C A;  3VQY A;  3LSS A;  4YRE A;  1ASZ A;  4CH4 A;  1USY A;  4L87 A;  4HVC A;  1HC7 A;  3VQV A;  1B7Y A;  3REX A;  2EJF A;  2ODR C;  1BBU A;  1X2H A;  3UFG A;  3HXY A;  2CGH A;  2RHQ B;  3L4G A;  3HXX A;  2RHS B;  3HFV A;  4YRM A;  4HWT A;  1WQW A;  2ZIM A;  2E5A A;  2QHS A;  2ZT6 A;  2CJ9 A;  2PMF A;  4H2V A;  1G5H A;  4LNS A;  2Q5H A;  3RAC A;  1X55 A;  3RKY A;  3UH0 A;  11AS A;  4H02 A;  3FJP A;  4WI1 A;  3PCO B;  2ZT5 A;  4YRR A;  3E9I A;  2DU5 A;  1BBW A;  3WQZ A;  1NYQ A;  2ZR3 A;  2RHQ A;  2CJA A;  4P72 A;  2RHS A;  1X54 A;  3MF2 A;  1X2G A;  2ZZG A;  3HRI A;  3HXU A;  4BWA A;  4TQF A;  4P3O A;  4DQ2 A;  1KMM A;  4RQE A;  1NJ8 A;  2E65 A;  2DEQ A;  5E3I A;  4HWS A;  4TWA A;  3MQZ A;  4YRS A;  4H2X B;  1KMN A;  2XGT A;  2AMC B;  4P71 C;  3A5Y A;  3RKW A;  2DKG A;  1C0A A;  1PYS B;  3G1Z A;  4XTZ A;  1WU7 A;  4LVK A;  3PCO A;  3VQW A;  2DTI A;  1KOG A;  2DTH A;  4OLF A;  4H2S A;  1SER A;  4H2Y A;  4XU1 A;  3TEH B;  2ZNI A;  2DDZ A;  3MF1 A;  4OP0 A;  1YB3 A;  1SES A;  5K1P A;  4Q6G A;  4YCV A;  3QO8 A;  1L0W A;  1NNH A;  2QHT A;  2ZR2 A;  3A5Z A;  4O2D A;  4BW9 A;  1EVK A;  2QHV A;  4H2X A;  4YRI A;  2AMC A;  1PYS A;  4XTV A;  1B76 A;  3HY1 A;  2Q5I A;  3A7U A;  2XTI A;  2I4L A;  1YFS A;  4H2T A;  1WLE A;  3TEH A;  5K1X A;  1WYD A;  3UGT A;  3IAL A;  3EFR A;  3VQX A;  2DZC A;  4XTU A;  2ZT7 A;  1VQZ A;  4XEM A;  1H4T A;  1NJ6 A;  5C52 B;  2ZIO A;  3HXV A;  4K86 A;  2P0L A;  4KQE A;  4TQD A;  1ATI A;  2DVE A;  2ZXF A;  3PZC A;  1W66 A;  3IG2 A;  3QO5 A;  4TVY A;  2DZ9 A;  2E10 A;  4WJ4 A;  4E51 A;  2DQ0 A;  1LYL A;  3TEG A;  4P3N A;  3REU A;  4CS3 A;  4CH5 A;  3QTC A;  4P75 A;  2CJB A;  4YRQ A;  4LVI A;  1USY C;  3ERR A;  4NCX A;  3V7R A;  4YRP A;  2EJG A;  4K88 A;  1NYR A;  5HGQ A;  4P73 C;  2ZZF A;  2Q7G A;  1QF6 A;  4WJ3 M;  2FYK A;  2I4O A;  4UPA A;  4XU3 A;  4P74 A;  3M4Q A;  4KR2 A;  2ARS A;  4YRL A;  4Q15 A;  3W3S A;  5C53 B;  3NEL A;  1IL2 A;  5C51 B;  3P8Y A;  5KNN A;  3CMQ A;  1J5W A;  3A7R A;  4XU2 A;  4YCW A;  3BFM A;  4UP7 A;  2CIM A;  3IKM B;  2I4N A;  3BJU A;  2DXU A;  4YP0 A;  4HA8 A;  4RMF A;  1H4Q A;  4WF2 A;  3L2Z A;  3IKL A;  4YYE A;  4RQF A;  4YRN A;  4TVA B;  2EAY A;  4YRC A;  1X01 A;  2IY5 B;  4UP9 A;  3HFZ B;  4J15 A;  2E1H A;  2PME A;  2ZTG A;  3HTZ A;  4XU0 A;  1Z7N A;  4HWR A;  4HWP A;  3HRK A;  4YRO A;  1B8A A;  1E24 A;  2C7I A;  1RIQ A;  1X56 A;  3RF1 A;  3E9H A;  2A8E A;  3ICA A;  3I7F A;  4PHC A;  4XTW A;  3RIR A;  2ZNJ A;  4YCU A;  1E1O A;  1HXD A;  3KFU A;  2AKW B;  3A7A A;  3TUP A;  3UGQ A;  3LC0 A;  2EL9 A;  3NEN A;  2QHU A;  4G85 A;  1NJ2 A;  4CS4 A;  3HXZ A;  4TVA A;  3P8V A;  1ADJ A;  2IY5 A;  1BIA A;  3HFZ A;  3RKX A;  3A31 A;  4HWO A;  1H4S A;  1G5I A;  3QNE A;  1SRY A;  2NS6 A;  5ELN A;  4YRJ A;  4RDX A;  1H4V B;  3R07 A;  1EVL A;  4TVW A;  1E22 A;  3OD1 A;  2J3L A;  4X5O A;  2ZT8 A;  2ALY B;  2AKW A;  4DPG A;  3V7S A;  4P73 A;  1N9W A;  2G4C A;  5F5W A;  2ART A;  1FYF A;  4UP8 A;  2DJZ A;  4KR3 A;  4HT4 A;  4H2W A;  4YRF A;  1NJ5 A;  1EQR A;  2ZCE A;  4LVM A;  4AH6 A;  2I4M A;  2Q7H A;  4P71 A;  4ZTU B;  2ZZE A;  1JJC B;  2ODR D;  1WPY A;  2P5I A;  3DSQ A;  3RUX A;  1YFR A;  4CS2 A;  2DXT A;  4YRG A;  2EJ9 A;  2ZIN A;  4CH3 A;  1G51 A;  1Z7M A;  1WNL A;  4CH6 A;  3MEY A;  2ALY A;  1YGB A;  3L1A A;  4K87 A;  2Q7E A;  4H2U A;  3NET A;  4XEO A;  2HNI A;  3V8K A;  3A74 A;  1EIY B;  3NEM A;  1SET A;  3RL6 A;  4YRT A;  4ZTZ B;  1YFT A;  3HY0 A;  3V8J A;  4YDQ A;  1B70 B;  12AS A;  4XTY A;  4P75 C;  1JJC A;  1EOV A;  3VBB A;  3V8L A;  1GGM A;  1ADY A;  2C8M A;  4EO4 A;  1HTT A;  1E1T A;  4P72 C;  3M4P A;  2J3M A;  1WQ7 A;  1ASY A;  4YPF A;  4G84 A;  4P74 C;  5ELO A;  3A32 A;  2DQ3 A;  3LSQ A;  2E41 A;  1EIY A;  3HXW A;  2DU7 A;  1EFW A;  1B7Y B;  4XTX A;  1BIB A;  1B70 A;  1NJ1 A;  4TTV A;  4EX5 A;  3EFS A;  1QE0 A;  3RGL A;  2DTO A;  4LVJ A;  3P8T A; 
#chains in the Genus database with same CATH homology
 3L4G B;  4PG3 A;  4LVL A;  4YRK A;  3V7C A;  2ARU A;  2E64 A;  2EWN A;  3QO7 A;  4P3P A;  2ZGW A;  4ZIB A;  2E3C A;  3VQY A;  3LSS A;  4YRE A;  1ASZ A;  4CH4 A;  1USY A;  4L87 A;  4HVC A;  1HC7 A;  3VQV A;  1B7Y A;  3REX A;  2EJF A;  2ODR C;  1BBU A;  1X2H A;  3UFG A;  3HXY A;  2CGH A;  2RHQ B;  3L4G A;  3HXX A;  2RHS B;  3HFV A;  4YRM A;  4HWT A;  1WQW A;  2ZIM A;  2E5A A;  2QHS A;  2ZT6 A;  2CJ9 A;  2PMF A;  4H2V A;  1G5H A;  4LNS A;  2Q5H A;  3RAC A;  1X55 A;  3RKY A;  3UH0 A;  11AS A;  4H02 A;  3FJP A;  4WI1 A;  3PCO B;  2ZT5 A;  4YRR A;  3E9I A;  2DU5 A;  1BBW A;  3WQZ A;  1NYQ A;  2ZR3 A;  2RHQ A;  2CJA A;  4P72 A;  2RHS A;  1X54 A;  3MF2 A;  1X2G A;  2ZZG A;  3HRI A;  3HXU A;  4BWA A;  4TQF A;  4P3O A;  4DQ2 A;  1KMM A;  4RQE A;  1NJ8 A;  2E65 A;  2DEQ A;  5E3I A;  4HWS A;  4TWA A;  3MQZ A;  4YRS A;  4H2X B;  1KMN A;  2XGT A;  2AMC B;  4P71 C;  3A5Y A;  3RKW A;  2DKG A;  1C0A A;  1PYS B;  3G1Z A;  4XTZ A;  1WU7 A;  4LVK A;  3PCO A;  3VQW A;  2DTI A;  1KOG A;  2DTH A;  4OLF A;  4H2S A;  1SER A;  4H2Y A;  4XU1 A;  3TEH B;  2ZNI A;  2DDZ A;  3MF1 A;  4OP0 A;  1YB3 A;  1SES A;  5K1P A;  4Q6G A;  4YCV A;  3QO8 A;  1L0W A;  1NNH A;  2QHT A;  2ZR2 A;  3A5Z A;  4O2D A;  4BW9 A;  1EVK A;  2QHV A;  4H2X A;  4YRI A;  2AMC A;  1PYS A;  4XTV A;  1B76 A;  3HY1 A;  2Q5I A;  3A7U A;  2XTI A;  2I4L A;  1YFS A;  4H2T A;  1WLE A;  3TEH A;  5K1X A;  1WYD A;  3UGT A;  3IAL A;  3EFR A;  3VQX A;  2DZC A;  4XTU A;  2ZT7 A;  1VQZ A;  4XEM A;  1H4T A;  1NJ6 A;  5C52 B;  2ZIO A;  3HXV A;  4K86 A;  2P0L A;  4KQE A;  4TQD A;  1ATI A;  2DVE A;  2ZXF A;  3PZC A;  1W66 A;  3IG2 A;  3QO5 A;  4TVY A;  2DZ9 A;  2E10 A;  4WJ4 A;  4E51 A;  2DQ0 A;  1LYL A;  3TEG A;  4P3N A;  3REU A;  4CS3 A;  4CH5 A;  3QTC A;  4P75 A;  2CJB A;  4YRQ A;  4LVI A;  1USY C;  3ERR A;  4NCX A;  3V7R A;  4YRP A;  2EJG A;  4K88 A;  1NYR A;  5HGQ A;  4P73 C;  2ZZF A;  2Q7G A;  1QF6 A;  4WJ3 M;  2FYK A;  2I4O A;  4UPA A;  4XU3 A;  4P74 A;  3M4Q A;  4KR2 A;  2ARS A;  4YRL A;  4Q15 A;  3W3S A;  5C53 B;  3NEL A;  1IL2 A;  5C51 B;  3P8Y A;  5KNN A;  3CMQ A;  1J5W A;  3A7R A;  4XU2 A;  4YCW A;  3BFM A;  4UP7 A;  2CIM A;  3IKM B;  2I4N A;  3BJU A;  2DXU A;  4YP0 A;  4HA8 A;  4RMF A;  1H4Q A;  4WF2 A;  3L2Z A;  3IKL A;  4YYE A;  4RQF A;  4YRN A;  4TVA B;  2EAY A;  4YRC A;  1X01 A;  2IY5 B;  4UP9 A;  3HFZ B;  4J15 A;  2E1H A;  2PME A;  2ZTG A;  3HTZ A;  4XU0 A;  1Z7N A;  4HWR A;  4HWP A;  3HRK A;  4YRO A;  1B8A A;  1E24 A;  2C7I A;  1RIQ A;  1X56 A;  3RF1 A;  3E9H A;  2A8E A;  3ICA A;  3I7F A;  4PHC A;  4XTW A;  3RIR A;  2ZNJ A;  4YCU A;  1E1O A;  1HXD A;  3KFU A;  2AKW B;  3A7A A;  3TUP A;  3UGQ A;  3LC0 A;  2EL9 A;  3NEN A;  2QHU A;  4G85 A;  1NJ2 A;  4CS4 A;  3HXZ A;  4TVA A;  3P8V A;  1ADJ A;  2IY5 A;  1BIA A;  3HFZ A;  3RKX A;  3A31 A;  4HWO A;  1H4S A;  1G5I A;  3QNE A;  1SRY A;  2NS6 A;  5ELN A;  4YRJ A;  4RDX A;  1H4V B;  3R07 A;  1EVL A;  4TVW A;  1E22 A;  3OD1 A;  2J3L A;  4X5O A;  2ZT8 A;  2ALY B;  2AKW A;  4DPG A;  3V7S A;  4P73 A;  1N9W A;  2G4C A;  5F5W A;  2ART A;  1FYF A;  4UP8 A;  2DJZ A;  4KR3 A;  4HT4 A;  4H2W A;  4YRF A;  1NJ5 A;  1EQR A;  2ZCE A;  4LVM A;  4AH6 A;  2I4M A;  2Q7H A;  4P71 A;  4ZTU B;  2ZZE A;  1JJC B;  2ODR D;  1WPY A;  2P5I A;  3DSQ A;  3RUX A;  1YFR A;  4CS2 A;  2DXT A;  4YRG A;  2EJ9 A;  2ZIN A;  4CH3 A;  1G51 A;  1Z7M A;  1WNL A;  4CH6 A;  3MEY A;  2ALY A;  1YGB A;  3L1A A;  4K87 A;  2Q7E A;  4H2U A;  3NET A;  4XEO A;  2HNI A;  3V8K A;  3A74 A;  1EIY B;  3NEM A;  1SET A;  3RL6 A;  4YRT A;  4ZTZ B;  1YFT A;  3HY0 A;  3V8J A;  4YDQ A;  1B70 B;  12AS A;  4XTY A;  4P75 C;  1JJC A;  1EOV A;  3VBB A;  3V8L A;  1GGM A;  1ADY A;  2C8M A;  4EO4 A;  1HTT A;  1E1T A;  4P72 C;  3M4P A;  2J3M A;  1WQ7 A;  1ASY A;  4YPF A;  4G84 A;  4P74 C;  5ELO A;  3A32 A;  2DQ3 A;  3LSQ A;  2E41 A;  1EIY A;  3HXW A;  2DU7 A;  1EFW A;  1B7Y B;  4XTX A;  1BIB A;  1B70 A;  1NJ1 A;  4TTV A;  4EX5 A;  3EFS A;  1QE0 A;  3RGL A;  2DTO A;  4LVJ A;  3P8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...