1RIQA

The crystal structure of the catalytic fragment of the alanyl-trna synthetase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alanyl-tRNA Synthetase Crystal Structure and Design for Acceptor-Stem Recognition
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 152
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1riqA01
2IY5B 1KMNA 4TVWA 2ZXFA 5C52B 1SERA 1PYSB 4XU2A 4XEMA 4G84A 2FYKA 3TUPA 2ODRD 1X2GA 3LSSA 2CJBA 1Z7NA 3CMQA 4EO4A 3HXUA 3ERRA 4YCWA 3A7RA 2Q5HA 4RQFA 4XU1A 3WQZA 2J3LA 3VQWA 3OD1A 2E5AA 5KNNA 3HY0A 2ZNIA 4HWOA 1USYA 2QHSA 1IL2A 4YCVA 4HWPA 3P8VA 1JJCA 4YRJA 1ATIA 4TQFA 5ELOA 2Q7EA 1WNLA 4XTYA 2PMFA 4O2DA 1NJ2A 3RKYA 4CH6A 3V8KA 5C53B 2C7IA 4WJ4A 1YFTA 4YRIA 2CIMA 2EJFA 4TVAB 2EJGA 4H2XA 4HVCA 3QO5A 5C51B 4TTVA 3UGQA 3RKXA 3L4GA 1WLEA 4P75A 3NEMA 3RACA 3LSQA 3HFZB 4YYEA 1VQZA 3W3SA 1E24A 3NETA 1X55A 4K87A 3UH0A 3NENA 2ODRC 4P72A 2RHSB 2Q7GA 3BJUA 3VQXA 11ASA 1ASYA 2DXTA 2DZCA 2I4LA 3RIRA 4H2VA 3QTCA 1B70B 4L87A 2DVEA 4XEOA 1YB3A 2QHVA 3BFMA 4CH4A 3A5ZA 1WYDA 4H2SA 4YREA 4UP7A 1SETA 1FYFA 3MF2A 1G5IA 2ZCEA 4LNSA 1WQ7A 1WU7A 3HRKA 4H2UA 2QHTA 4P74C 1X54A 2RHSA 4HWTA 2DQ0A 2ALYA 1HTTA 1HXDA 4YDQA 4TQDA 3NELA 3V8LA 1ASZA 2AMCB 2P0LA 1USYC 2DZ9A 2Q7HA 4H2TA 2DJZA 1HC7A 3A32A 3M4PA 3V7SA 4E51A 4UP9A 3L2ZA 1EFWA 4YPFA 3HY1A 3REXA 1EIYA 3MF1A 4KR3A 2AKWB 4G85A 3IG2A 1B70A 4P74A 2DU5A 1G51A 3E9HA 2C8MA 3PZCA 4BWAA 4J15A 2AKWA 2XTIA 2ZIOA 3PCOA 4XU3A 4XTZA 2ZT7A 1NJ5A 4TVYA 4K86A 3IKLA 2G4CA 2QHUA 5F5WA 2ZT8A 1E22A 1J5WA 3TEGA 4ZTZB 4HWRA 4HWSA 4WI1A 2Q5IA 1N9WA 3HXYA 1B8AA 5ELNA 1EQRA 2E64A 4PHCA 3EFSA 4YRMA 4DQ2A 4H2YA 1QE0A 4XTUA 2DDZA 4TVAA 4ZTUB 3QO7A 1BBUA 3A7AA 4KQEA 2E41A 3I7FA 1H4TA 3HTZA 12ASA 3RKWA 1YGBA 2ARUA 2ZGWA 4YP0A 4NCXA 3HXWA 3RF1A 4P73A 3VQVA 1LYLA 4YRFA 1X2HA 4P71A 2ARSA 4CS3A 1EIYB 2CJ9A 4YRQA 4DPGA 5K1XA 1YFSA 3E9IA 3TEHA 1NJ1A 4WF2A 2HNIA 3A31A 3FJPA 3G1ZA 4P3OA 4YRSA 1WPYA 1NJ6A 1YFRA 3P8TA 1BIBA 3HFZA 1JJCB 2ZIMA 2ZR3A 4YROA 1C0AA 2RHQB 2ALYB 4P73C 1SRYA 2ZZFA 1B76A 4YRGA 1QF6A 4P71C 4CS4A 4EX5A 4RDXA 4H2XB 3VQYA 1NYQA 4P3PA 2CGHA 1G5HA 4Q15A 2DKGA 2ZT5A 4YRRA 2CJAA 2E65A 2DU7A 4XU0A 3PCOB 4XTWA 3LC0A 2ZINA 4CS2A 3A5YA 3L1AA 3HXVA 2DQ3A 4P72C 3UGTA 2DTHA 1X01A 2EWNA 3HRIA 2DTIA 1H4SA 3V7RA 4YRPA 1B7YA 3DSQA 1WQWA 2ZZEA 2DEQA 2RHQA 4RMFA 1RIQA 4TWAA 4BW9A 3VBBA 3HFVA 1ADYA 4RQEA 1H4QA 1X56A 2ZR2A 3RL6A 5HGQA 4H2WA 1PYSA 1NNHA 2EJ9A 1E1OA 4YCUA 1ADJA 2ZT6A 2ARTA 4YRLA 3A74A 2IY5A 4CH3A 1NJ8A 3EFRA 2XGTA 2J3MA 1Z7MA 4CH5A 1EOVA 4YRKA 2ZNJA 4OP0A 4YRTA 1KMMA 3L4GB 5E3IA 4YRCA 3MEYA 3IKMB 2PMEA 1EVLA 3TEHB 4YRNA 2ZTGA 3A7UA 3QO8A 4XTXA 1H4VB 3V7CA 4X5OA 3ICAA 4HA8A 1BIAA 3HXZA 3IALA 4OLFA 1KOGA 1GGMA 1SESA 3M4QA 2ZZGA 3RUXA 3V8JA 2EL9A 2I4NA 4WJ3M 4P3NA 2E3CA 3HXXA 1EVKA 1W66A 3P8YA 4PG3A 4UP8A 2DXUA 2DTOA 3QNEA 4AH6A 5K1PA 4UPAA 3RGLA 3UFGA 4P75C 4KR2A 4Q6GA 4H02A 1L0WA 1NYRA 2E10A 2EAYA 1E1TA 1B7YB 2E1HA 3R07A 2AMCA 2I4OA 2P5IA 3KFUA 1BBWA 4XTVA 3REUA 4ZIBA 2I4MA 4K88A
chains in the Genus database with same CATH superfamily
2IY5B 1KMNA 4TVWA 4LVKA 2ZXFA 5C52B 1SERA 1PYSB 4XU2A 4XEMA 4G84A 2FYKA 3TUPA 2ODRD 1X2GA 3LSSA 2CJBA 1Z7NA 3CMQA 4EO4A 3HXUA 3ERRA 4YCWA 3A7RA 2Q5HA 4HT4A 4RQFA 4XU1A 3WQZA 2J3LA 3VQWA 3OD1A 2E5AA 5KNNA 3HY0A 2ZNIA 4HWOA 1USYA 2QHSA 1IL2A 4YCVA 4HWPA 3P8VA 1JJCA 4YRJA 1ATIA 4TQFA 5ELOA 2Q7EA 1WNLA 4XTYA 2PMFA 4O2DA 1NJ2A 3RKYA 4CH6A 3V8KA 5C53B 2C7IA 4WJ4A 1YFTA 4YRIA 2CIMA 2EJFA 4TVAB 2EJGA 4H2XA 4HVCA 3QO5A 5C51B 4TTVA 3UGQA 3RKXA 3L4GA 1WLEA 4P75A 3NEMA 3RACA 3LSQA 3HFZB 4YYEA 1VQZA 3W3SA 1E24A 3NETA 1X55A 4K87A 3UH0A 3NENA 2ODRC 4P72A 2RHSB 2Q7GA 3BJUA 3VQXA 11ASA 1ASYA 2DXTA 2DZCA 2I4LA 3RIRA 4H2VA 3QTCA 1B70B 4L87A 2DVEA 4XEOA 1YB3A 2QHVA 3BFMA 4CH4A 3A5ZA 1WYDA 4H2SA 4YREA 4UP7A 1SETA 1FYFA 4LVMA 3MF2A 1G5IA 2ZCEA 4LNSA 1WQ7A 1WU7A 3HRKA 4H2UA 2QHTA 4P74C 1X54A 2RHSA 4HWTA 2DQ0A 2ALYA 1HTTA 1HXDA 4YDQA 4TQDA 3NELA 3V8LA 1ASZA 2AMCB 2P0LA 1USYC 2DZ9A 2Q7HA 4H2TA 2DJZA 1HC7A 3A32A 3M4PA 3V7SA 4E51A 4UP9A 3L2ZA 1EFWA 4YPFA 3HY1A 3REXA 2NS6A 1EIYA 3MF1A 4KR3A 2AKWB 4G85A 3IG2A 1B70A 4P74A 2DU5A 1G51A 3E9HA 2C8MA 3PZCA 4BWAA 4J15A 2AKWA 2XTIA 2ZIOA 3PCOA 4LVLA 4XU3A 4XTZA 2ZT7A 1NJ5A 4TVYA 4K86A 3IKLA 2G4CA 4LVIA 2QHUA 5F5WA 2ZT8A 1E22A 1J5WA 3TEGA 4ZTZB 4HWRA 4HWSA 4WI1A 2Q5IA 1N9WA 3HXYA 1B8AA 5ELNA 1EQRA 2E64A 4PHCA 3EFSA 4YRMA 4DQ2A 4H2YA 1QE0A 4XTUA 2DDZA 4TVAA 4ZTUB 3QO7A 1BBUA 3A7AA 4KQEA 2E41A 3I7FA 1H4TA 3HTZA 12ASA 3RKWA 1YGBA 4LVJA 2ARUA 2ZGWA 4YP0A 4NCXA 3HXWA 3RF1A 4P73A 3VQVA 1LYLA 4YRFA 1X2HA 4P71A 2ARSA 4CS3A 1EIYB 2CJ9A 4YRQA 4DPGA 5K1XA 1YFSA 3E9IA 3TEHA 1NJ1A 4WF2A 2HNIA 3A31A 3FJPA 3G1ZA 4P3OA 4YRSA 1WPYA 1NJ6A 1YFRA 3P8TA 1BIBA 3HFZA 1JJCB 2ZIMA 2ZR3A 4YROA 1C0AA 2RHQB 2ALYB 4P73C 1SRYA 2ZZFA 1B76A 4YRGA 1QF6A 3MQZA 4P71C 4CS4A 4EX5A 4RDXA 4H2XB 3VQYA 1NYQA 4P3PA 2CGHA 1G5HA 4Q15A 2DKGA 2ZT5A 4YRRA 2CJAA 2E65A 2DU7A 4XU0A 3PCOB 4XTWA 3LC0A 2ZINA 4CS2A 3A5YA 3L1AA 3HXVA 2DQ3A 4P72C 3UGTA 2DTHA 1X01A 2EWNA 3HRIA 2DTIA 1H4SA 3V7RA 4YRPA 1B7YA 3DSQA 1WQWA 2ZZEA 2DEQA 2RHQA 4RMFA 1RIQA 4TWAA 4BW9A 3VBBA 3HFVA 1ADYA 4RQEA 1H4QA 1X56A 2ZR2A 3RL6A 5HGQA 4H2WA 1PYSA 1NNHA 2EJ9A 1E1OA 4YCUA 1ADJA 2ZT6A 2ARTA 4YRLA 3A74A 2IY5A 4CH3A 1NJ8A 3EFRA 2XGTA 2J3MA 1Z7MA 4CH5A 1EOVA 4YRKA 2ZNJA 4OP0A 4YRTA 1KMMA 3L4GB 5E3IA 4YRCA 3MEYA 3IKMB 2PMEA 1EVLA 3TEHB 4YRNA 2ZTGA 3A7UA 3QO8A 4XTXA 1H4VB 3V7CA 4X5OA 3ICAA 4HA8A 1BIAA 3HXZA 3IALA 4OLFA 1KOGA 1GGMA 1SESA 3M4QA 2ZZGA 3RUXA 3V8JA 2EL9A 2I4NA 4WJ3M 4P3NA 2E3CA 3HXXA 1EVKA 1W66A 2A8EA 3P8YA 4PG3A 4UP8A 2DXUA 2DTOA 3QNEA 4AH6A 5K1PA 4UPAA 3RGLA 3UFGA 4P75C 4KR2A 4Q6GA 4H02A 1L0WA 1NYRA 2E10A 2EAYA 1E1TA 1B7YB 2E1HA 3R07A 2AMCA 2I4OA 2P5IA 3KFUA 1BBWA 4XTVA 3REUA 4ZIBA 2I4MA 4K88A
chains in the Genus database with same CATH topology
2IY5B 1KMNA 4TVWA 4LVKA 2ZXFA 5C52B 1SERA 1PYSB 4XU2A 4XEMA 4G84A 2FYKA 3TUPA 2ODRD 1X2GA 3LSSA 2CJBA 1Z7NA 3CMQA 4EO4A 3HXUA 3ERRA 4YCWA 3A7RA 2Q5HA 4HT4A 4RQFA 4XU1A 3WQZA 2J3LA 3VQWA 3OD1A 2E5AA 5KNNA 3HY0A 2ZNIA 4HWOA 1USYA 2QHSA 1IL2A 4YCVA 4HWPA 3P8VA 1JJCA 4YRJA 1ATIA 4TQFA 5ELOA 2Q7EA 1WNLA 4XTYA 2PMFA 4O2DA 1NJ2A 3RKYA 4CH6A 3V8KA 5C53B 2C7IA 4WJ4A 1YFTA 4YRIA 2CIMA 2EJFA 4TVAB 2EJGA 4H2XA 4HVCA 3QO5A 5C51B 4TTVA 3UGQA 3RKXA 3L4GA 1WLEA 4P75A 3NEMA 3RACA 3LSQA 3HFZB 4YYEA 1VQZA 3W3SA 1E24A 3NETA 1X55A 4K87A 3UH0A 3NENA 2ODRC 4P72A 2RHSB 2Q7GA 3BJUA 3VQXA 11ASA 1ASYA 2DXTA 2DZCA 2I4LA 3RIRA 4H2VA 3QTCA 1B70B 4L87A 2DVEA 4XEOA 1YB3A 2QHVA 3BFMA 4CH4A 3A5ZA 1WYDA 4H2SA 4YREA 4UP7A 1SETA 1FYFA 4LVMA 3MF2A 1G5IA 2ZCEA 4LNSA 1WQ7A 1WU7A 3HRKA 4H2UA 2QHTA 4P74C 1X54A 2RHSA 4HWTA 2DQ0A 2ALYA 1HTTA 1HXDA 4YDQA 4TQDA 3NELA 3V8LA 1ASZA 2AMCB 2P0LA 1USYC 2DZ9A 2Q7HA 4H2TA 2DJZA 1HC7A 3A32A 3M4PA 3V7SA 4E51A 4UP9A 3L2ZA 1EFWA 4YPFA 3HY1A 3REXA 2NS6A 1EIYA 3MF1A 4KR3A 2AKWB 4G85A 3IG2A 1B70A 4P74A 2DU5A 1G51A 3E9HA 2C8MA 3PZCA 4BWAA 4J15A 2AKWA 2XTIA 2ZIOA 3PCOA 4LVLA 4XU3A 4XTZA 2ZT7A 1NJ5A 4TVYA 4K86A 3IKLA 2G4CA 4LVIA 2QHUA 5F5WA 2ZT8A 1E22A 1J5WA 3TEGA 4ZTZB 4HWRA 4HWSA 4WI1A 2Q5IA 1N9WA 3HXYA 1B8AA 5ELNA 1EQRA 2E64A 4PHCA 3EFSA 4YRMA 4DQ2A 4H2YA 1QE0A 4XTUA 2DDZA 4TVAA 4ZTUB 3QO7A 1BBUA 3A7AA 4KQEA 2E41A 3I7FA 1H4TA 3HTZA 12ASA 3RKWA 1YGBA 4LVJA 2ARUA 2ZGWA 4YP0A 4NCXA 3HXWA 3RF1A 4P73A 3VQVA 1LYLA 4YRFA 1X2HA 4P71A 2ARSA 4CS3A 1EIYB 2CJ9A 4YRQA 4DPGA 5K1XA 1YFSA 3E9IA 3TEHA 1NJ1A 4WF2A 2HNIA 3A31A 3FJPA 3G1ZA 4P3OA 4YRSA 1WPYA 1NJ6A 1YFRA 3P8TA 1BIBA 3HFZA 1JJCB 2ZIMA 2ZR3A 4YROA 1C0AA 2RHQB 2ALYB 4P73C 1SRYA 2ZZFA 1B76A 4YRGA 1QF6A 3MQZA 4P71C 4CS4A 4EX5A 4RDXA 4H2XB 3VQYA 1NYQA 4P3PA 2CGHA 1G5HA 4Q15A 2DKGA 2ZT5A 4YRRA 2CJAA 2E65A 2DU7A 4XU0A 3PCOB 4XTWA 3LC0A 2ZINA 4CS2A 3A5YA 3L1AA 3HXVA 2DQ3A 4P72C 3UGTA 2DTHA 1X01A 2EWNA 3HRIA 2DTIA 1H4SA 3V7RA 4YRPA 1B7YA 3DSQA 1WQWA 2ZZEA 2DEQA 2RHQA 4RMFA 1RIQA 4TWAA 4BW9A 3VBBA 3HFVA 1ADYA 4RQEA 1H4QA 1X56A 2ZR2A 3RL6A 5HGQA 4H2WA 1PYSA 1NNHA 2EJ9A 1E1OA 4YCUA 1ADJA 2ZT6A 2ARTA 4YRLA 3A74A 2IY5A 4CH3A 1NJ8A 3EFRA 2XGTA 2J3MA 1Z7MA 4CH5A 1EOVA 4YRKA 2ZNJA 4OP0A 4YRTA 1KMMA 3L4GB 5E3IA 4YRCA 3MEYA 3IKMB 2PMEA 1EVLA 3TEHB 4YRNA 2ZTGA 3A7UA 3QO8A 4XTXA 1H4VB 3V7CA 4X5OA 3ICAA 4HA8A 1BIAA 3HXZA 3IALA 4OLFA 1KOGA 1GGMA 1SESA 3M4QA 2ZZGA 3RUXA 3V8JA 2EL9A 2I4NA 4WJ3M 4P3NA 2E3CA 3HXXA 1EVKA 1W66A 2A8EA 3P8YA 4PG3A 4UP8A 2DXUA 2DTOA 3QNEA 4AH6A 5K1PA 4UPAA 3RGLA 3UFGA 4P75C 4KR2A 4Q6GA 4H02A 1L0WA 1NYRA 2E10A 2EAYA 1E1TA 1B7YB 2E1HA 3R07A 2AMCA 2I4OA 2P5IA 3KFUA 1BBWA 4XTVA 3REUA 4ZIBA 2I4MA 4K88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY5 B;  1KMN A;  4TVW A;  2ZXF A;  5C52 B;  1SER A;  1PYS B;  4XU2 A;  4XEM A;  4G84 A;  2FYK A;  3TUP A;  2ODR D;  1X2G A;  3LSS A;  2CJB A;  1Z7N A;  3CMQ A;  4EO4 A;  3HXU A;  3ERR A;  4YCW A;  3A7R A;  2Q5H A;  4RQF A;  4XU1 A;  3WQZ A;  2J3L A;  3VQW A;  3OD1 A;  2E5A A;  5KNN A;  3HY0 A;  2ZNI A;  4HWO A;  1USY A;  2QHS A;  1IL2 A;  4YCV A;  4HWP A;  3P8V A;  1JJC A;  4YRJ A;  1ATI A;  4TQF A;  5ELO A;  2Q7E A;  1WNL A;  4XTY A;  2PMF A;  4O2D A;  1NJ2 A;  3RKY A;  4CH6 A;  3V8K A;  5C53 B;  2C7I A;  4WJ4 A;  1YFT A;  4YRI A;  2CIM A;  2EJF A;  4TVA B;  2EJG A;  4H2X A;  4HVC A;  3QO5 A;  5C51 B;  4TTV A;  3UGQ A;  3RKX A;  3L4G A;  1WLE A;  4P75 A;  3NEM A;  3RAC A;  3LSQ A;  3HFZ B;  4YYE A;  1VQZ A;  3W3S A;  1E24 A;  3NET A;  1X55 A;  4K87 A;  3UH0 A;  3NEN A;  2ODR C;  4P72 A;  2RHS B;  2Q7G A;  3BJU A;  3VQX A;  11AS A;  1ASY A;  2DXT A;  2DZC A;  2I4L A;  3RIR A;  4H2V A;  3QTC A;  1B70 B;  4L87 A;  2DVE A;  4XEO A;  1YB3 A;  2QHV A;  3BFM A;  4CH4 A;  3A5Z A;  1WYD A;  4H2S A;  4YRE A;  4UP7 A;  1SET A;  1FYF A;  3MF2 A;  1G5I A;  2ZCE A;  4LNS A;  1WQ7 A;  1WU7 A;  3HRK A;  4H2U A;  2QHT A;  4P74 C;  1X54 A;  2RHS A;  4HWT A;  2DQ0 A;  2ALY A;  1HTT A;  1HXD A;  4YDQ A;  4TQD A;  3NEL A;  3V8L A;  1ASZ A;  2AMC B;  2P0L A;  1USY C;  2DZ9 A;  2Q7H A;  4H2T A;  2DJZ A;  1HC7 A;  3A32 A;  3M4P A;  3V7S A;  4E51 A;  4UP9 A;  3L2Z A;  1EFW A;  4YPF A;  3HY1 A;  3REX A;  1EIY A;  3MF1 A;  4KR3 A;  2AKW B;  4G85 A;  3IG2 A;  1B70 A;  4P74 A;  2DU5 A;  1G51 A;  3E9H A;  2C8M A;  3PZC A;  4BWA A;  4J15 A;  2AKW A;  2XTI A;  2ZIO A;  3PCO A;  4XU3 A;  4XTZ A;  2ZT7 A;  1NJ5 A;  4TVY A;  4K86 A;  3IKL A;  2G4C A;  2QHU A;  5F5W A;  2ZT8 A;  1E22 A;  1J5W A;  3TEG A;  4ZTZ B;  4HWR A;  4HWS A;  4WI1 A;  2Q5I A;  1N9W A;  3HXY A;  1B8A A;  5ELN A;  1EQR A;  2E64 A;  4PHC A;  3EFS A;  4YRM A;  4DQ2 A;  4H2Y A;  1QE0 A;  4XTU A;  2DDZ A;  4TVA A;  4ZTU B;  3QO7 A;  1BBU A;  3A7A A;  4KQE A;  2E41 A;  3I7F A;  1H4T A;  3HTZ A;  12AS A;  3RKW A;  1YGB A;  2ARU A;  2ZGW A;  4YP0 A;  4NCX A;  3HXW A;  3RF1 A;  4P73 A;  3VQV A;  1LYL A;  4YRF A;  1X2H A;  4P71 A;  2ARS A;  4CS3 A;  1EIY B;  2CJ9 A;  4YRQ A;  4DPG A;  5K1X A;  1YFS A;  3E9I A;  3TEH A;  1NJ1 A;  4WF2 A;  2HNI A;  3A31 A;  3FJP A;  3G1Z A;  4P3O A;  4YRS A;  1WPY A;  1NJ6 A;  1YFR A;  3P8T A;  1BIB A;  3HFZ A;  1JJC B;  2ZIM A;  2ZR3 A;  4YRO A;  1C0A A;  2RHQ B;  2ALY B;  4P73 C;  1SRY A;  2ZZF A;  1B76 A;  4YRG A;  1QF6 A;  4P71 C;  4CS4 A;  4EX5 A;  4RDX A;  4H2X B;  3VQY A;  1NYQ A;  4P3P A;  2CGH A;  1G5H A;  4Q15 A;  2DKG A;  2ZT5 A;  4YRR A;  2CJA A;  2E65 A;  2DU7 A;  4XU0 A;  3PCO B;  4XTW A;  3LC0 A;  2ZIN A;  4CS2 A;  3A5Y A;  3L1A A;  3HXV A;  2DQ3 A;  4P72 C;  3UGT A;  2DTH A;  1X01 A;  2EWN A;  3HRI A;  2DTI A;  1H4S A;  3V7R A;  4YRP A;  1B7Y A;  3DSQ A;  1WQW A;  2ZZE A;  2DEQ A;  2RHQ A;  4RMF A;  1RIQ A;  4TWA A;  4BW9 A;  3VBB A;  3HFV A;  1ADY A;  4RQE A;  1H4Q A;  1X56 A;  2ZR2 A;  3RL6 A;  5HGQ A;  4H2W A;  1PYS A;  1NNH A;  2EJ9 A;  1E1O A;  4YCU A;  1ADJ A;  2ZT6 A;  2ART A;  4YRL A;  3A74 A;  2IY5 A;  4CH3 A;  1NJ8 A;  3EFR A;  2XGT A;  2J3M A;  1Z7M A;  4CH5 A;  1EOV A;  4YRK A;  2ZNJ A;  4OP0 A;  4YRT A;  1KMM A;  3L4G B;  5E3I A;  4YRC A;  3MEY A;  3IKM B;  2PME A;  1EVL A;  3TEH B;  4YRN A;  2ZTG A;  3A7U A;  3QO8 A;  4XTX A;  1H4V B;  3V7C A;  4X5O A;  3ICA A;  4HA8 A;  1BIA A;  3HXZ A;  3IAL A;  4OLF A;  1KOG A;  1GGM A;  1SES A;  3M4Q A;  2ZZG A;  3RUX A;  3V8J A;  2EL9 A;  2I4N A;  4WJ3 M;  4P3N A;  2E3C A;  3HXX A;  1EVK A;  1W66 A;  3P8Y A;  4PG3 A;  4UP8 A;  2DXU A;  2DTO A;  3QNE A;  4AH6 A;  5K1P A;  4UPA A;  3RGL A;  3UFG A;  4P75 C;  4KR2 A;  4Q6G A;  4H02 A;  1L0W A;  1NYR A;  2E10 A;  2EAY A;  1E1T A;  1B7Y B;  2E1H A;  3R07 A;  2AMC A;  2I4O A;  2P5I A;  3KFU A;  1BBW A;  4XTV A;  3REU A;  4ZIB A;  2I4M A;  4K88 A; 
#chains in the Genus database with same CATH topology
 2IY5 B;  1KMN A;  4TVW A;  4LVK A;  2ZXF A;  5C52 B;  1SER A;  1PYS B;  4XU2 A;  4XEM A;  4G84 A;  2FYK A;  3TUP A;  2ODR D;  1X2G A;  3LSS A;  2CJB A;  1Z7N A;  3CMQ A;  4EO4 A;  3HXU A;  3ERR A;  4YCW A;  3A7R A;  2Q5H A;  4HT4 A;  4RQF A;  4XU1 A;  3WQZ A;  2J3L A;  3VQW A;  3OD1 A;  2E5A A;  5KNN A;  3HY0 A;  2ZNI A;  4HWO A;  1USY A;  2QHS A;  1IL2 A;  4YCV A;  4HWP A;  3P8V A;  1JJC A;  4YRJ A;  1ATI A;  4TQF A;  5ELO A;  2Q7E A;  1WNL A;  4XTY A;  2PMF A;  4O2D A;  1NJ2 A;  3RKY A;  4CH6 A;  3V8K A;  5C53 B;  2C7I A;  4WJ4 A;  1YFT A;  4YRI A;  2CIM A;  2EJF A;  4TVA B;  2EJG A;  4H2X A;  4HVC A;  3QO5 A;  5C51 B;  4TTV A;  3UGQ A;  3RKX A;  3L4G A;  1WLE A;  4P75 A;  3NEM A;  3RAC A;  3LSQ A;  3HFZ B;  4YYE A;  1VQZ A;  3W3S A;  1E24 A;  3NET A;  1X55 A;  4K87 A;  3UH0 A;  3NEN A;  2ODR C;  4P72 A;  2RHS B;  2Q7G A;  3BJU A;  3VQX A;  11AS A;  1ASY A;  2DXT A;  2DZC A;  2I4L A;  3RIR A;  4H2V A;  3QTC A;  1B70 B;  4L87 A;  2DVE A;  4XEO A;  1YB3 A;  2QHV A;  3BFM A;  4CH4 A;  3A5Z A;  1WYD A;  4H2S A;  4YRE A;  4UP7 A;  1SET A;  1FYF A;  4LVM A;  3MF2 A;  1G5I A;  2ZCE A;  4LNS A;  1WQ7 A;  1WU7 A;  3HRK A;  4H2U A;  2QHT A;  4P74 C;  1X54 A;  2RHS A;  4HWT A;  2DQ0 A;  2ALY A;  1HTT A;  1HXD A;  4YDQ A;  4TQD A;  3NEL A;  3V8L A;  1ASZ A;  2AMC B;  2P0L A;  1USY C;  2DZ9 A;  2Q7H A;  4H2T A;  2DJZ A;  1HC7 A;  3A32 A;  3M4P A;  3V7S A;  4E51 A;  4UP9 A;  3L2Z A;  1EFW A;  4YPF A;  3HY1 A;  3REX A;  2NS6 A;  1EIY A;  3MF1 A;  4KR3 A;  2AKW B;  4G85 A;  3IG2 A;  1B70 A;  4P74 A;  2DU5 A;  1G51 A;  3E9H A;  2C8M A;  3PZC A;  4BWA A;  4J15 A;  2AKW A;  2XTI A;  2ZIO A;  3PCO A;  4LVL A;  4XU3 A;  4XTZ A;  2ZT7 A;  1NJ5 A;  4TVY A;  4K86 A;  3IKL A;  2G4C A;  4LVI A;  2QHU A;  5F5W A;  2ZT8 A;  1E22 A;  1J5W A;  3TEG A;  4ZTZ B;  4HWR A;  4HWS A;  4WI1 A;  2Q5I A;  1N9W A;  3HXY A;  1B8A A;  5ELN A;  1EQR A;  2E64 A;  4PHC A;  3EFS A;  4YRM A;  4DQ2 A;  4H2Y A;  1QE0 A;  4XTU A;  2DDZ A;  4TVA A;  4ZTU B;  3QO7 A;  1BBU A;  3A7A A;  4KQE A;  2E41 A;  3I7F A;  1H4T A;  3HTZ A;  12AS A;  3RKW A;  1YGB A;  4LVJ A;  2ARU A;  2ZGW A;  4YP0 A;  4NCX A;  3HXW A;  3RF1 A;  4P73 A;  3VQV A;  1LYL A;  4YRF A;  1X2H A;  4P71 A;  2ARS A;  4CS3 A;  1EIY B;  2CJ9 A;  4YRQ A;  4DPG A;  5K1X A;  1YFS A;  3E9I A;  3TEH A;  1NJ1 A;  4WF2 A;  2HNI A;  3A31 A;  3FJP A;  3G1Z A;  4P3O A;  4YRS A;  1WPY A;  1NJ6 A;  1YFR A;  3P8T A;  1BIB A;  3HFZ A;  1JJC B;  2ZIM A;  2ZR3 A;  4YRO A;  1C0A A;  2RHQ B;  2ALY B;  4P73 C;  1SRY A;  2ZZF A;  1B76 A;  4YRG A;  1QF6 A;  3MQZ A;  4P71 C;  4CS4 A;  4EX5 A;  4RDX A;  4H2X B;  3VQY A;  1NYQ A;  4P3P A;  2CGH A;  1G5H A;  4Q15 A;  2DKG A;  2ZT5 A;  4YRR A;  2CJA A;  2E65 A;  2DU7 A;  4XU0 A;  3PCO B;  4XTW A;  3LC0 A;  2ZIN A;  4CS2 A;  3A5Y A;  3L1A A;  3HXV A;  2DQ3 A;  4P72 C;  3UGT A;  2DTH A;  1X01 A;  2EWN A;  3HRI A;  2DTI A;  1H4S A;  3V7R A;  4YRP A;  1B7Y A;  3DSQ A;  1WQW A;  2ZZE A;  2DEQ A;  2RHQ A;  4RMF A;  1RIQ A;  4TWA A;  4BW9 A;  3VBB A;  3HFV A;  1ADY A;  4RQE A;  1H4Q A;  1X56 A;  2ZR2 A;  3RL6 A;  5HGQ A;  4H2W A;  1PYS A;  1NNH A;  2EJ9 A;  1E1O A;  4YCU A;  1ADJ A;  2ZT6 A;  2ART A;  4YRL A;  3A74 A;  2IY5 A;  4CH3 A;  1NJ8 A;  3EFR A;  2XGT A;  2J3M A;  1Z7M A;  4CH5 A;  1EOV A;  4YRK A;  2ZNJ A;  4OP0 A;  4YRT A;  1KMM A;  3L4G B;  5E3I A;  4YRC A;  3MEY A;  3IKM B;  2PME A;  1EVL A;  3TEH B;  4YRN A;  2ZTG A;  3A7U A;  3QO8 A;  4XTX A;  1H4V B;  3V7C A;  4X5O A;  3ICA A;  4HA8 A;  1BIA A;  3HXZ A;  3IAL A;  4OLF A;  1KOG A;  1GGM A;  1SES A;  3M4Q A;  2ZZG A;  3RUX A;  3V8J A;  2EL9 A;  2I4N A;  4WJ3 M;  4P3N A;  2E3C A;  3HXX A;  1EVK A;  1W66 A;  2A8E A;  3P8Y A;  4PG3 A;  4UP8 A;  2DXU A;  2DTO A;  3QNE A;  4AH6 A;  5K1P A;  4UPA A;  3RGL A;  3UFG A;  4P75 C;  4KR2 A;  4Q6G A;  4H02 A;  1L0W A;  1NYR A;  2E10 A;  2EAY A;  1E1T A;  1B7Y B;  2E1H A;  3R07 A;  2AMC A;  2I4O A;  2P5I A;  3KFU A;  1BBW A;  4XTV A;  3REU A;  4ZIB A;  2I4M A;  4K88 A; 
#chains in the Genus database with same CATH homology
 2IY5 B;  1KMN A;  4TVW A;  4LVK A;  2ZXF A;  5C52 B;  1SER A;  1PYS B;  4XU2 A;  4XEM A;  4G84 A;  2FYK A;  3TUP A;  2ODR D;  1X2G A;  3LSS A;  2CJB A;  1Z7N A;  3CMQ A;  4EO4 A;  3HXU A;  3ERR A;  4YCW A;  3A7R A;  2Q5H A;  4HT4 A;  4RQF A;  4XU1 A;  3WQZ A;  2J3L A;  3VQW A;  3OD1 A;  2E5A A;  5KNN A;  3HY0 A;  2ZNI A;  4HWO A;  1USY A;  2QHS A;  1IL2 A;  4YCV A;  4HWP A;  3P8V A;  1JJC A;  4YRJ A;  1ATI A;  4TQF A;  5ELO A;  2Q7E A;  1WNL A;  4XTY A;  2PMF A;  4O2D A;  1NJ2 A;  3RKY A;  4CH6 A;  3V8K A;  5C53 B;  2C7I A;  4WJ4 A;  1YFT A;  4YRI A;  2CIM A;  2EJF A;  4TVA B;  2EJG A;  4H2X A;  4HVC A;  3QO5 A;  5C51 B;  4TTV A;  3UGQ A;  3RKX A;  3L4G A;  1WLE A;  4P75 A;  3NEM A;  3RAC A;  3LSQ A;  3HFZ B;  4YYE A;  1VQZ A;  3W3S A;  1E24 A;  3NET A;  1X55 A;  4K87 A;  3UH0 A;  3NEN A;  2ODR C;  4P72 A;  2RHS B;  2Q7G A;  3BJU A;  3VQX A;  11AS A;  1ASY A;  2DXT A;  2DZC A;  2I4L A;  3RIR A;  4H2V A;  3QTC A;  1B70 B;  4L87 A;  2DVE A;  4XEO A;  1YB3 A;  2QHV A;  3BFM A;  4CH4 A;  3A5Z A;  1WYD A;  4H2S A;  4YRE A;  4UP7 A;  1SET A;  1FYF A;  4LVM A;  3MF2 A;  1G5I A;  2ZCE A;  4LNS A;  1WQ7 A;  1WU7 A;  3HRK A;  4H2U A;  2QHT A;  4P74 C;  1X54 A;  2RHS A;  4HWT A;  2DQ0 A;  2ALY A;  1HTT A;  1HXD A;  4YDQ A;  4TQD A;  3NEL A;  3V8L A;  1ASZ A;  2AMC B;  2P0L A;  1USY C;  2DZ9 A;  2Q7H A;  4H2T A;  2DJZ A;  1HC7 A;  3A32 A;  3M4P A;  3V7S A;  4E51 A;  4UP9 A;  3L2Z A;  1EFW A;  4YPF A;  3HY1 A;  3REX A;  2NS6 A;  1EIY A;  3MF1 A;  4KR3 A;  2AKW B;  4G85 A;  3IG2 A;  1B70 A;  4P74 A;  2DU5 A;  1G51 A;  3E9H A;  2C8M A;  3PZC A;  4BWA A;  4J15 A;  2AKW A;  2XTI A;  2ZIO A;  3PCO A;  4LVL A;  4XU3 A;  4XTZ A;  2ZT7 A;  1NJ5 A;  4TVY A;  4K86 A;  3IKL A;  2G4C A;  4LVI A;  2QHU A;  5F5W A;  2ZT8 A;  1E22 A;  1J5W A;  3TEG A;  4ZTZ B;  4HWR A;  4HWS A;  4WI1 A;  2Q5I A;  1N9W A;  3HXY A;  1B8A A;  5ELN A;  1EQR A;  2E64 A;  4PHC A;  3EFS A;  4YRM A;  4DQ2 A;  4H2Y A;  1QE0 A;  4XTU A;  2DDZ A;  4TVA A;  4ZTU B;  3QO7 A;  1BBU A;  3A7A A;  4KQE A;  2E41 A;  3I7F A;  1H4T A;  3HTZ A;  12AS A;  3RKW A;  1YGB A;  4LVJ A;  2ARU A;  2ZGW A;  4YP0 A;  4NCX A;  3HXW A;  3RF1 A;  4P73 A;  3VQV A;  1LYL A;  4YRF A;  1X2H A;  4P71 A;  2ARS A;  4CS3 A;  1EIY B;  2CJ9 A;  4YRQ A;  4DPG A;  5K1X A;  1YFS A;  3E9I A;  3TEH A;  1NJ1 A;  4WF2 A;  2HNI A;  3A31 A;  3FJP A;  3G1Z A;  4P3O A;  4YRS A;  1WPY A;  1NJ6 A;  1YFR A;  3P8T A;  1BIB A;  3HFZ A;  1JJC B;  2ZIM A;  2ZR3 A;  4YRO A;  1C0A A;  2RHQ B;  2ALY B;  4P73 C;  1SRY A;  2ZZF A;  1B76 A;  4YRG A;  1QF6 A;  3MQZ A;  4P71 C;  4CS4 A;  4EX5 A;  4RDX A;  4H2X B;  3VQY A;  1NYQ A;  4P3P A;  2CGH A;  1G5H A;  4Q15 A;  2DKG A;  2ZT5 A;  4YRR A;  2CJA A;  2E65 A;  2DU7 A;  4XU0 A;  3PCO B;  4XTW A;  3LC0 A;  2ZIN A;  4CS2 A;  3A5Y A;  3L1A A;  3HXV A;  2DQ3 A;  4P72 C;  3UGT A;  2DTH A;  1X01 A;  2EWN A;  3HRI A;  2DTI A;  1H4S A;  3V7R A;  4YRP A;  1B7Y A;  3DSQ A;  1WQW A;  2ZZE A;  2DEQ A;  2RHQ A;  4RMF A;  1RIQ A;  4TWA A;  4BW9 A;  3VBB A;  3HFV A;  1ADY A;  4RQE A;  1H4Q A;  1X56 A;  2ZR2 A;  3RL6 A;  5HGQ A;  4H2W A;  1PYS A;  1NNH A;  2EJ9 A;  1E1O A;  4YCU A;  1ADJ A;  2ZT6 A;  2ART A;  4YRL A;  3A74 A;  2IY5 A;  4CH3 A;  1NJ8 A;  3EFR A;  2XGT A;  2J3M A;  1Z7M A;  4CH5 A;  1EOV A;  4YRK A;  2ZNJ A;  4OP0 A;  4YRT A;  1KMM A;  3L4G B;  5E3I A;  4YRC A;  3MEY A;  3IKM B;  2PME A;  1EVL A;  3TEH B;  4YRN A;  2ZTG A;  3A7U A;  3QO8 A;  4XTX A;  1H4V B;  3V7C A;  4X5O A;  3ICA A;  4HA8 A;  1BIA A;  3HXZ A;  3IAL A;  4OLF A;  1KOG A;  1GGM A;  1SES A;  3M4Q A;  2ZZG A;  3RUX A;  3V8J A;  2EL9 A;  2I4N A;  4WJ3 M;  4P3N A;  2E3C A;  3HXX A;  1EVK A;  1W66 A;  2A8E A;  3P8Y A;  4PG3 A;  4UP8 A;  2DXU A;  2DTO A;  3QNE A;  4AH6 A;  5K1P A;  4UPA A;  3RGL A;  3UFG A;  4P75 C;  4KR2 A;  4Q6G A;  4H02 A;  1L0W A;  1NYR A;  2E10 A;  2EAY A;  1E1T A;  1B7Y B;  2E1H A;  3R07 A;  2AMC A;  2I4O A;  2P5I A;  3KFU A;  1BBW A;  4XTV A;  3REU A;  4ZIB A;  2I4M A;  4K88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...