1RIQA

The crystal structure of the catalytic fragment of the alanyl-trna synthetase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
457
structure length
448
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Alanyl-tRNA Synthetase Crystal Structure and Design for Acceptor-Stem Recognition
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 152
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1riqA01
2ZT6A 4HWTA 4DQ2A 2AMCB 3REUA 4TQDA 4P73C 1J5WA 5KNNA 4G85A 1BIAA 2CJAA 4K86A 2E64A 4CH4A 2IY5B 1G5IA 4YDQA 1FYFA 3HFZB 4BW9A 3E9HA 2ODRD 4YYEA 2E3CA 4Q15A 4YCUA 4KR3A 1IL2A 2ZR2A 1X2GA 2I4LA 1BIBA 2E65A 4H2UA 2G4CA 3OD1A 4NCXA 4YP0A 3W3SA 3VQXA 4P75A 4EO4A 1SETA 4TVYA 4CH6A 5K1XA 3BFMA 1B70A 4XTUA 4RMFA 1C0AA 1X01A 4TVAB 3ERRA 4XEMA 3UH0A 5F5WA 4UP8A 3I7FA 2ARTA 4P73A 4YRFA 2ZGWA 1HXDA 4YRPA 1B7YA 2ZZGA 1ADYA 1B76A 3REXA 3IKLA 4CS2A 2AKWB 3A5YA 3E9IA 3MF2A 4H2VA 3RKYA 5C53B 3QTCA 1NJ8A 12ASA 1QE0A 4XTYA 2ZXFA 1X54A 3MEYA 4YRGA 4YRNA 4EX5A 4TQFA 2ZIOA 1EIYA 2I4NA 1G5HA 4YRTA 2ODRC 3DSQA 2Q5HA 3HXXA 4P3NA 3VBBA 1PYSB 1L0WA 3L4GB 2CIMA 1B70B 4CS4A 1NJ5A 4G84A 2EAYA 1EFWA 5HGQA 3QO7A 3IALA 4YRRA 2E10A 2DU7A 1X56A 4O2DA 2DDZA 4TWAA 1BBWA 2C8MA 1WNLA 5C52B 4P3PA 1B8AA 3CMQA 4TVAA 2CGHA 4HWPA 3IG2A 1KOGA 2DTOA 3HXYA 4P3OA 1BBUA 4P72C 1JJCA 2HNIA 4Q6GA 4XU0A 4XU2A 4XTZA 4RQEA 1H4VB 1EIYB 1YFTA 2PMFA 3A7AA 2AKWA 3TEHA 2ZINA 4P71A 4E51A 4YRLA 1H4SA 3HY0A 2J3LA 2RHQA 2ARUA 3HRKA 1WLEA 4XTXA 3V7RA 4OLFA 1PYSA 2PMEA 4YRSA 3A5ZA 3LSQA 3L4GA 2QHSA 4XU3A 4WJ4A 4K88A 2I4OA 4UP7A 4P72A 2DJZA 4PG3A 2E41A 3HFVA 4BWAA 5E3IA 1JJCB 3A74A 3RACA 2DXUA 2ZNJA 3KFUA 2EJFA 3TEHB 1LYLA 4HWOA 1USYA 2E5AA 4DPGA 3IKMB 1SERA 1SESA 4WF2A 3HXZA 4AH6A 2RHQB 3RKWA 1HC7A 2Q7GA 3TUPA 2XGTA 1ASYA 4J15A 5ELNA 4RDXA 4CH5A 2ZNIA 2P5IA 3A31A 2RHSA 3UGTA 2ZTGA 1H4TA 1KMNA 1NYQA 2ZIMA 1GGMA 1EOVA 4CS3A 2CJ9A 4P71C 1EQRA 4YRJA 3HXUA 3A7UA 2DZCA 3RGLA 2EWNA 2DU5A 1E22A 3MF1A 4K87A 4HWRA 2QHTA 3P8TA 1KMMA 3FJPA 4KQEA 1RIQA 2ZT5A 2Q7HA 2ZT8A 4H2TA 1NJ2A 1NNHA 2DXTA 3A32A 4TVWA 1QF6A 1G51A 4L87A 5C51B 1YGBA 2C7IA 2Q5IA 3HY1A 1EVKA 4PHCA 4H2XA 4TTVA 3HXWA 2ALYB 3M4QA 1E1TA 2RHSB 3VQVA 2DVEA 4ZTZB 3A7RA 4P74C 1EVLA 1Z7MA 3V7CA 3RIRA 1USYC 1N9WA 2FYKA 4YREA 1X2HA 3V8LA 1SRYA 4H2YA 1HTTA 4UP9A 4HWSA 4XTWA 3NELA 3RKXA 2ZZFA 3EFSA 4H02A 3RF1A 2QHVA 3L1AA 4XTVA 1X55A 2J3MA 3VQYA 1NJ1A 4YRIA 3LC0A 4LNSA 1E1OA 4WI1A 4H2XB 1ATIA 1WPYA 3LSSA 3QO8A 3RUXA 4P74A 1YFRA 3EFRA 3L2ZA 2DZ9A 4ZTUB 1W66A 3HXVA 1WYDA 3BJUA 3UGQA 3R07A 1ASZA 2EL9A 3PCOA 2DEQA 3NENA 3G1ZA 3V7SA 3HTZA 4RQFA 4XU1A 4HVCA 2CJBA 1YFSA 2ALYA 3NEMA 3UFGA 1WU7A 4OP0A 2EJ9A 1NYRA 5ELOA 3M4PA 4YRQA 2EJGA 1ADJA 2ZT7A 3HRIA 3V8JA 2AMCA 3RL6A 3NETA 2P0LA 4YROA 3P8YA 2DKGA 3VQWA 1YB3A 3QO5A 4YRCA 4YPFA 2IY5A 2ZCEA 2DQ0A 4WJ3M 3HFZA 2E1HA 1VQZA 3V8KA 4YRKA 4X5OA 1WQ7A 4YCWA 2DQ3A 3TEGA 4CH3A 2DTHA 5K1PA 3PCOB 3ICAA 11ASA 1NJ6A 3WQZA 2ZR3A 1E24A 4H2WA 2I4MA 3QNEA 4ZIBA 1H4QA 2ZZEA 1B7YB 2QHUA 4YCVA 2DTIA 2XTIA 4P75C 2ARSA 4HA8A 4UPAA 4YRMA 3P8VA 3PZCA 2Q7EA 4KR2A 1Z7NA 1WQWA 4H2SA 4XEOA
chains in the Genus database with same CATH superfamily
2ZT6A 4HWTA 4DQ2A 2AMCB 3REUA 4TQDA 4P73C 1J5WA 5KNNA 4G85A 1BIAA 2CJAA 4K86A 2E64A 4CH4A 2IY5B 1G5IA 4YDQA 1FYFA 3HFZB 4BW9A 3E9HA 2ODRD 4YYEA 2E3CA 4Q15A 4YCUA 4KR3A 1IL2A 2ZR2A 1X2GA 2I4LA 1BIBA 2E65A 4H2UA 2G4CA 3OD1A 4NCXA 4YP0A 3W3SA 3VQXA 4LVJA 4P75A 4EO4A 1SETA 4TVYA 4CH6A 5K1XA 3BFMA 1B70A 4XTUA 4RMFA 1C0AA 1X01A 4TVAB 3ERRA 4XEMA 3UH0A 5F5WA 4UP8A 3I7FA 2ARTA 4P73A 4YRFA 2ZGWA 1HXDA 4YRPA 1B7YA 2ZZGA 1ADYA 1B76A 4LVLA 3REXA 3IKLA 4CS2A 2AKWB 3A5YA 3E9IA 3MF2A 4H2VA 3RKYA 5C53B 3QTCA 1NJ8A 12ASA 1QE0A 4XTYA 2ZXFA 1X54A 3MEYA 4YRGA 4YRNA 4EX5A 4TQFA 2ZIOA 1EIYA 2I4NA 1G5HA 4YRTA 2ODRC 3DSQA 2Q5HA 3HXXA 4P3NA 3VBBA 1PYSB 1L0WA 3L4GB 2CIMA 1B70B 4CS4A 1NJ5A 4G84A 2EAYA 1EFWA 5HGQA 3QO7A 3IALA 4YRRA 2E10A 4LVIA 2DU7A 1X56A 4O2DA 2DDZA 4TWAA 1BBWA 2C8MA 1WNLA 5C52B 4P3PA 1B8AA 3CMQA 4TVAA 2CGHA 4HWPA 3IG2A 1KOGA 2DTOA 3HXYA 4P3OA 1BBUA 4P72C 1JJCA 2HNIA 4Q6GA 4XU0A 4XU2A 4XTZA 4RQEA 1H4VB 1EIYB 1YFTA 2PMFA 3A7AA 2AKWA 3TEHA 2ZINA 4P71A 4E51A 4LVMA 4YRLA 1H4SA 3HY0A 2J3LA 2RHQA 2ARUA 3HRKA 1WLEA 4XTXA 3V7RA 4OLFA 1PYSA 2PMEA 4YRSA 3A5ZA 3LSQA 3L4GA 2QHSA 4XU3A 4WJ4A 4K88A 2I4OA 4UP7A 4P72A 2DJZA 4PG3A 2E41A 3HFVA 4BWAA 5E3IA 1JJCB 3A74A 3RACA 2DXUA 2ZNJA 3KFUA 2EJFA 3TEHB 1LYLA 4HWOA 1USYA 2E5AA 4DPGA 3IKMB 1SERA 1SESA 4WF2A 3HXZA 4AH6A 2RHQB 3RKWA 1HC7A 2Q7GA 3TUPA 2XGTA 1ASYA 4J15A 5ELNA 4RDXA 4CH5A 2ZNIA 2P5IA 3A31A 2RHSA 3UGTA 2ZTGA 1H4TA 1KMNA 1NYQA 2ZIMA 1GGMA 1EOVA 4CS3A 2CJ9A 4P71C 1EQRA 4YRJA 3HXUA 3A7UA 2DZCA 3RGLA 2EWNA 2DU5A 1E22A 3MF1A 4K87A 4HWRA 2QHTA 3P8TA 1KMMA 3FJPA 4KQEA 1RIQA 2ZT5A 2Q7HA 2ZT8A 4H2TA 1NJ2A 1NNHA 2DXTA 3A32A 4TVWA 1QF6A 1G51A 4L87A 5C51B 1YGBA 2C7IA 2Q5IA 3HY1A 1EVKA 4PHCA 4H2XA 4TTVA 3HXWA 2ALYB 3M4QA 2NS6A 1E1TA 2RHSB 3VQVA 2DVEA 4ZTZB 3A7RA 4P74C 1EVLA 1Z7MA 3V7CA 3RIRA 1USYC 1N9WA 2FYKA 4YREA 1X2HA 3V8LA 1SRYA 4H2YA 1HTTA 4UP9A 4HWSA 4XTWA 3NELA 3RKXA 2ZZFA 3EFSA 4H02A 3RF1A 2QHVA 3L1AA 4XTVA 1X55A 2J3MA 3VQYA 1NJ1A 4YRIA 3LC0A 4LNSA 1E1OA 2A8EA 4WI1A 4H2XB 1ATIA 1WPYA 3LSSA 3QO8A 4LVKA 3RUXA 4P74A 1YFRA 3EFRA 3L2ZA 2DZ9A 4ZTUB 1W66A 3HXVA 1WYDA 3BJUA 3UGQA 3R07A 1ASZA 2EL9A 3PCOA 2DEQA 3NENA 3G1ZA 3V7SA 3HTZA 4RQFA 4XU1A 4HVCA 2CJBA 1YFSA 2ALYA 3NEMA 3UFGA 1WU7A 4OP0A 2EJ9A 1NYRA 5ELOA 3M4PA 4YRQA 2EJGA 1ADJA 2ZT7A 3HRIA 3V8JA 2AMCA 3RL6A 3NETA 2P0LA 4YROA 3P8YA 2DKGA 3VQWA 1YB3A 3QO5A 4YRCA 4YPFA 2IY5A 2ZCEA 2DQ0A 4WJ3M 3HFZA 2E1HA 1VQZA 3V8KA 4YRKA 4HT4A 4X5OA 1WQ7A 4YCWA 2DQ3A 3TEGA 4CH3A 2DTHA 5K1PA 3PCOB 3ICAA 11ASA 1NJ6A 3WQZA 2ZR3A 1E24A 4H2WA 2I4MA 3QNEA 4ZIBA 1H4QA 2ZZEA 1B7YB 2QHUA 4YCVA 2DTIA 2XTIA 4P75C 2ARSA 4HA8A 4UPAA 4YRMA 3P8VA 3PZCA 2Q7EA 3MQZA 4KR2A 1Z7NA 1WQWA 4H2SA 4XEOA
chains in the Genus database with same CATH topology
2ZT6A 4HWTA 4DQ2A 2AMCB 3REUA 4TQDA 4P73C 1J5WA 5KNNA 4G85A 1BIAA 2CJAA 4K86A 2E64A 4CH4A 2IY5B 1G5IA 4YDQA 1FYFA 3HFZB 4BW9A 3E9HA 2ODRD 4YYEA 2E3CA 4Q15A 4YCUA 4KR3A 1IL2A 2ZR2A 1X2GA 2I4LA 1BIBA 2E65A 4H2UA 2G4CA 3OD1A 4NCXA 4YP0A 3W3SA 3VQXA 4LVJA 4P75A 4EO4A 1SETA 4TVYA 4CH6A 5K1XA 3BFMA 1B70A 4XTUA 4RMFA 1C0AA 1X01A 4TVAB 3ERRA 4XEMA 3UH0A 5F5WA 4UP8A 3I7FA 2ARTA 4P73A 4YRFA 2ZGWA 1HXDA 4YRPA 1B7YA 2ZZGA 1ADYA 1B76A 4LVLA 3REXA 3IKLA 4CS2A 2AKWB 3A5YA 3E9IA 3MF2A 4H2VA 3RKYA 5C53B 3QTCA 1NJ8A 12ASA 1QE0A 4XTYA 2ZXFA 1X54A 3MEYA 4YRGA 4YRNA 4EX5A 4TQFA 2ZIOA 1EIYA 2I4NA 1G5HA 4YRTA 2ODRC 3DSQA 2Q5HA 3HXXA 4P3NA 3VBBA 1PYSB 1L0WA 3L4GB 2CIMA 1B70B 4CS4A 1NJ5A 4G84A 2EAYA 1EFWA 5HGQA 3QO7A 3IALA 4YRRA 2E10A 4LVIA 2DU7A 1X56A 4O2DA 2DDZA 4TWAA 1BBWA 2C8MA 1WNLA 5C52B 4P3PA 1B8AA 3CMQA 4TVAA 2CGHA 4HWPA 3IG2A 1KOGA 2DTOA 3HXYA 4P3OA 1BBUA 4P72C 1JJCA 2HNIA 4Q6GA 4XU0A 4XU2A 4XTZA 4RQEA 1H4VB 1EIYB 1YFTA 2PMFA 3A7AA 2AKWA 3TEHA 2ZINA 4P71A 4E51A 4LVMA 4YRLA 1H4SA 3HY0A 2J3LA 2RHQA 2ARUA 3HRKA 1WLEA 4XTXA 3V7RA 4OLFA 1PYSA 2PMEA 4YRSA 3A5ZA 3LSQA 3L4GA 2QHSA 4XU3A 4WJ4A 4K88A 2I4OA 4UP7A 4P72A 2DJZA 4PG3A 2E41A 3HFVA 4BWAA 5E3IA 1JJCB 3A74A 3RACA 2DXUA 2ZNJA 3KFUA 2EJFA 3TEHB 1LYLA 4HWOA 1USYA 2E5AA 4DPGA 3IKMB 1SERA 1SESA 4WF2A 3HXZA 4AH6A 2RHQB 3RKWA 1HC7A 2Q7GA 3TUPA 2XGTA 1ASYA 4J15A 5ELNA 4RDXA 4CH5A 2ZNIA 2P5IA 3A31A 2RHSA 3UGTA 2ZTGA 1H4TA 1KMNA 1NYQA 2ZIMA 1GGMA 1EOVA 4CS3A 2CJ9A 4P71C 1EQRA 4YRJA 3HXUA 3A7UA 2DZCA 3RGLA 2EWNA 2DU5A 1E22A 3MF1A 4K87A 4HWRA 2QHTA 3P8TA 1KMMA 3FJPA 4KQEA 1RIQA 2ZT5A 2Q7HA 2ZT8A 4H2TA 1NJ2A 1NNHA 2DXTA 3A32A 4TVWA 1QF6A 1G51A 4L87A 5C51B 1YGBA 2C7IA 2Q5IA 3HY1A 1EVKA 4PHCA 4H2XA 4TTVA 3HXWA 2ALYB 3M4QA 2NS6A 1E1TA 2RHSB 3VQVA 2DVEA 4ZTZB 3A7RA 4P74C 1EVLA 1Z7MA 3V7CA 3RIRA 1USYC 1N9WA 2FYKA 4YREA 1X2HA 3V8LA 1SRYA 4H2YA 1HTTA 4UP9A 4HWSA 4XTWA 3NELA 3RKXA 2ZZFA 3EFSA 4H02A 3RF1A 2QHVA 3L1AA 4XTVA 1X55A 2J3MA 3VQYA 1NJ1A 4YRIA 3LC0A 4LNSA 1E1OA 2A8EA 4WI1A 4H2XB 1ATIA 1WPYA 3LSSA 3QO8A 4LVKA 3RUXA 4P74A 1YFRA 3EFRA 3L2ZA 2DZ9A 4ZTUB 1W66A 3HXVA 1WYDA 3BJUA 3UGQA 3R07A 1ASZA 2EL9A 3PCOA 2DEQA 3NENA 3G1ZA 3V7SA 3HTZA 4RQFA 4XU1A 4HVCA 2CJBA 1YFSA 2ALYA 3NEMA 3UFGA 1WU7A 4OP0A 2EJ9A 1NYRA 5ELOA 3M4PA 4YRQA 2EJGA 1ADJA 2ZT7A 3HRIA 3V8JA 2AMCA 3RL6A 3NETA 2P0LA 4YROA 3P8YA 2DKGA 3VQWA 1YB3A 3QO5A 4YRCA 4YPFA 2IY5A 2ZCEA 2DQ0A 4WJ3M 3HFZA 2E1HA 1VQZA 3V8KA 4YRKA 4HT4A 4X5OA 1WQ7A 4YCWA 2DQ3A 3TEGA 4CH3A 2DTHA 5K1PA 3PCOB 3ICAA 11ASA 1NJ6A 3WQZA 2ZR3A 1E24A 4H2WA 2I4MA 3QNEA 4ZIBA 1H4QA 2ZZEA 1B7YB 2QHUA 4YCVA 2DTIA 2XTIA 4P75C 2ARSA 4HA8A 4UPAA 4YRMA 3P8VA 3PZCA 2Q7EA 3MQZA 4KR2A 1Z7NA 1WQWA 4H2SA 4XEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT6 A;  4HWT A;  4DQ2 A;  2AMC B;  3REU A;  4TQD A;  4P73 C;  1J5W A;  5KNN A;  4G85 A;  1BIA A;  2CJA A;  4K86 A;  2E64 A;  4CH4 A;  2IY5 B;  1G5I A;  4YDQ A;  1FYF A;  3HFZ B;  4BW9 A;  3E9H A;  2ODR D;  4YYE A;  2E3C A;  4Q15 A;  4YCU A;  4KR3 A;  1IL2 A;  2ZR2 A;  1X2G A;  2I4L A;  1BIB A;  2E65 A;  4H2U A;  2G4C A;  3OD1 A;  4NCX A;  4YP0 A;  3W3S A;  3VQX A;  4P75 A;  4EO4 A;  1SET A;  4TVY A;  4CH6 A;  5K1X A;  3BFM A;  1B70 A;  4XTU A;  4RMF A;  1C0A A;  1X01 A;  4TVA B;  3ERR A;  4XEM A;  3UH0 A;  5F5W A;  4UP8 A;  3I7F A;  2ART A;  4P73 A;  4YRF A;  2ZGW A;  1HXD A;  4YRP A;  1B7Y A;  2ZZG A;  1ADY A;  1B76 A;  3REX A;  3IKL A;  4CS2 A;  2AKW B;  3A5Y A;  3E9I A;  3MF2 A;  4H2V A;  3RKY A;  5C53 B;  3QTC A;  1NJ8 A;  12AS A;  1QE0 A;  4XTY A;  2ZXF A;  1X54 A;  3MEY A;  4YRG A;  4YRN A;  4EX5 A;  4TQF A;  2ZIO A;  1EIY A;  2I4N A;  1G5H A;  4YRT A;  2ODR C;  3DSQ A;  2Q5H A;  3HXX A;  4P3N A;  3VBB A;  1PYS B;  1L0W A;  3L4G B;  2CIM A;  1B70 B;  4CS4 A;  1NJ5 A;  4G84 A;  2EAY A;  1EFW A;  5HGQ A;  3QO7 A;  3IAL A;  4YRR A;  2E10 A;  2DU7 A;  1X56 A;  4O2D A;  2DDZ A;  4TWA A;  1BBW A;  2C8M A;  1WNL A;  5C52 B;  4P3P A;  1B8A A;  3CMQ A;  4TVA A;  2CGH A;  4HWP A;  3IG2 A;  1KOG A;  2DTO A;  3HXY A;  4P3O A;  1BBU A;  4P72 C;  1JJC A;  2HNI A;  4Q6G A;  4XU0 A;  4XU2 A;  4XTZ A;  4RQE A;  1H4V B;  1EIY B;  1YFT A;  2PMF A;  3A7A A;  2AKW A;  3TEH A;  2ZIN A;  4P71 A;  4E51 A;  4YRL A;  1H4S A;  3HY0 A;  2J3L A;  2RHQ A;  2ARU A;  3HRK A;  1WLE A;  4XTX A;  3V7R A;  4OLF A;  1PYS A;  2PME A;  4YRS A;  3A5Z A;  3LSQ A;  3L4G A;  2QHS A;  4XU3 A;  4WJ4 A;  4K88 A;  2I4O A;  4UP7 A;  4P72 A;  2DJZ A;  4PG3 A;  2E41 A;  3HFV A;  4BWA A;  5E3I A;  1JJC B;  3A74 A;  3RAC A;  2DXU A;  2ZNJ A;  3KFU A;  2EJF A;  3TEH B;  1LYL A;  4HWO A;  1USY A;  2E5A A;  4DPG A;  3IKM B;  1SER A;  1SES A;  4WF2 A;  3HXZ A;  4AH6 A;  2RHQ B;  3RKW A;  1HC7 A;  2Q7G A;  3TUP A;  2XGT A;  1ASY A;  4J15 A;  5ELN A;  4RDX A;  4CH5 A;  2ZNI A;  2P5I A;  3A31 A;  2RHS A;  3UGT A;  2ZTG A;  1H4T A;  1KMN A;  1NYQ A;  2ZIM A;  1GGM A;  1EOV A;  4CS3 A;  2CJ9 A;  4P71 C;  1EQR A;  4YRJ A;  3HXU A;  3A7U A;  2DZC A;  3RGL A;  2EWN A;  2DU5 A;  1E22 A;  3MF1 A;  4K87 A;  4HWR A;  2QHT A;  3P8T A;  1KMM A;  3FJP A;  4KQE A;  1RIQ A;  2ZT5 A;  2Q7H A;  2ZT8 A;  4H2T A;  1NJ2 A;  1NNH A;  2DXT A;  3A32 A;  4TVW A;  1QF6 A;  1G51 A;  4L87 A;  5C51 B;  1YGB A;  2C7I A;  2Q5I A;  3HY1 A;  1EVK A;  4PHC A;  4H2X A;  4TTV A;  3HXW A;  2ALY B;  3M4Q A;  1E1T A;  2RHS B;  3VQV A;  2DVE A;  4ZTZ B;  3A7R A;  4P74 C;  1EVL A;  1Z7M A;  3V7C A;  3RIR A;  1USY C;  1N9W A;  2FYK A;  4YRE A;  1X2H A;  3V8L A;  1SRY A;  4H2Y A;  1HTT A;  4UP9 A;  4HWS A;  4XTW A;  3NEL A;  3RKX A;  2ZZF A;  3EFS A;  4H02 A;  3RF1 A;  2QHV A;  3L1A A;  4XTV A;  1X55 A;  2J3M A;  3VQY A;  1NJ1 A;  4YRI A;  3LC0 A;  4LNS A;  1E1O A;  4WI1 A;  4H2X B;  1ATI A;  1WPY A;  3LSS A;  3QO8 A;  3RUX A;  4P74 A;  1YFR A;  3EFR A;  3L2Z A;  2DZ9 A;  4ZTU B;  1W66 A;  3HXV A;  1WYD A;  3BJU A;  3UGQ A;  3R07 A;  1ASZ A;  2EL9 A;  3PCO A;  2DEQ A;  3NEN A;  3G1Z A;  3V7S A;  3HTZ A;  4RQF A;  4XU1 A;  4HVC A;  2CJB A;  1YFS A;  2ALY A;  3NEM A;  3UFG A;  1WU7 A;  4OP0 A;  2EJ9 A;  1NYR A;  5ELO A;  3M4P A;  4YRQ A;  2EJG A;  1ADJ A;  2ZT7 A;  3HRI A;  3V8J A;  2AMC A;  3RL6 A;  3NET A;  2P0L A;  4YRO A;  3P8Y A;  2DKG A;  3VQW A;  1YB3 A;  3QO5 A;  4YRC A;  4YPF A;  2IY5 A;  2ZCE A;  2DQ0 A;  4WJ3 M;  3HFZ A;  2E1H A;  1VQZ A;  3V8K A;  4YRK A;  4X5O A;  1WQ7 A;  4YCW A;  2DQ3 A;  3TEG A;  4CH3 A;  2DTH A;  5K1P A;  3PCO B;  3ICA A;  11AS A;  1NJ6 A;  3WQZ A;  2ZR3 A;  1E24 A;  4H2W A;  2I4M A;  3QNE A;  4ZIB A;  1H4Q A;  2ZZE A;  1B7Y B;  2QHU A;  4YCV A;  2DTI A;  2XTI A;  4P75 C;  2ARS A;  4HA8 A;  4UPA A;  4YRM A;  3P8V A;  3PZC A;  2Q7E A;  4KR2 A;  1Z7N A;  1WQW A;  4H2S A;  4XEO A; 
#chains in the Genus database with same CATH topology
 2ZT6 A;  4HWT A;  4DQ2 A;  2AMC B;  3REU A;  4TQD A;  4P73 C;  1J5W A;  5KNN A;  4G85 A;  1BIA A;  2CJA A;  4K86 A;  2E64 A;  4CH4 A;  2IY5 B;  1G5I A;  4YDQ A;  1FYF A;  3HFZ B;  4BW9 A;  3E9H A;  2ODR D;  4YYE A;  2E3C A;  4Q15 A;  4YCU A;  4KR3 A;  1IL2 A;  2ZR2 A;  1X2G A;  2I4L A;  1BIB A;  2E65 A;  4H2U A;  2G4C A;  3OD1 A;  4NCX A;  4YP0 A;  3W3S A;  3VQX A;  4LVJ A;  4P75 A;  4EO4 A;  1SET A;  4TVY A;  4CH6 A;  5K1X A;  3BFM A;  1B70 A;  4XTU A;  4RMF A;  1C0A A;  1X01 A;  4TVA B;  3ERR A;  4XEM A;  3UH0 A;  5F5W A;  4UP8 A;  3I7F A;  2ART A;  4P73 A;  4YRF A;  2ZGW A;  1HXD A;  4YRP A;  1B7Y A;  2ZZG A;  1ADY A;  1B76 A;  4LVL A;  3REX A;  3IKL A;  4CS2 A;  2AKW B;  3A5Y A;  3E9I A;  3MF2 A;  4H2V A;  3RKY A;  5C53 B;  3QTC A;  1NJ8 A;  12AS A;  1QE0 A;  4XTY A;  2ZXF A;  1X54 A;  3MEY A;  4YRG A;  4YRN A;  4EX5 A;  4TQF A;  2ZIO A;  1EIY A;  2I4N A;  1G5H A;  4YRT A;  2ODR C;  3DSQ A;  2Q5H A;  3HXX A;  4P3N A;  3VBB A;  1PYS B;  1L0W A;  3L4G B;  2CIM A;  1B70 B;  4CS4 A;  1NJ5 A;  4G84 A;  2EAY A;  1EFW A;  5HGQ A;  3QO7 A;  3IAL A;  4YRR A;  2E10 A;  4LVI A;  2DU7 A;  1X56 A;  4O2D A;  2DDZ A;  4TWA A;  1BBW A;  2C8M A;  1WNL A;  5C52 B;  4P3P A;  1B8A A;  3CMQ A;  4TVA A;  2CGH A;  4HWP A;  3IG2 A;  1KOG A;  2DTO A;  3HXY A;  4P3O A;  1BBU A;  4P72 C;  1JJC A;  2HNI A;  4Q6G A;  4XU0 A;  4XU2 A;  4XTZ A;  4RQE A;  1H4V B;  1EIY B;  1YFT A;  2PMF A;  3A7A A;  2AKW A;  3TEH A;  2ZIN A;  4P71 A;  4E51 A;  4LVM A;  4YRL A;  1H4S A;  3HY0 A;  2J3L A;  2RHQ A;  2ARU A;  3HRK A;  1WLE A;  4XTX A;  3V7R A;  4OLF A;  1PYS A;  2PME A;  4YRS A;  3A5Z A;  3LSQ A;  3L4G A;  2QHS A;  4XU3 A;  4WJ4 A;  4K88 A;  2I4O A;  4UP7 A;  4P72 A;  2DJZ A;  4PG3 A;  2E41 A;  3HFV A;  4BWA A;  5E3I A;  1JJC B;  3A74 A;  3RAC A;  2DXU A;  2ZNJ A;  3KFU A;  2EJF A;  3TEH B;  1LYL A;  4HWO A;  1USY A;  2E5A A;  4DPG A;  3IKM B;  1SER A;  1SES A;  4WF2 A;  3HXZ A;  4AH6 A;  2RHQ B;  3RKW A;  1HC7 A;  2Q7G A;  3TUP A;  2XGT A;  1ASY A;  4J15 A;  5ELN A;  4RDX A;  4CH5 A;  2ZNI A;  2P5I A;  3A31 A;  2RHS A;  3UGT A;  2ZTG A;  1H4T A;  1KMN A;  1NYQ A;  2ZIM A;  1GGM A;  1EOV A;  4CS3 A;  2CJ9 A;  4P71 C;  1EQR A;  4YRJ A;  3HXU A;  3A7U A;  2DZC A;  3RGL A;  2EWN A;  2DU5 A;  1E22 A;  3MF1 A;  4K87 A;  4HWR A;  2QHT A;  3P8T A;  1KMM A;  3FJP A;  4KQE A;  1RIQ A;  2ZT5 A;  2Q7H A;  2ZT8 A;  4H2T A;  1NJ2 A;  1NNH A;  2DXT A;  3A32 A;  4TVW A;  1QF6 A;  1G51 A;  4L87 A;  5C51 B;  1YGB A;  2C7I A;  2Q5I A;  3HY1 A;  1EVK A;  4PHC A;  4H2X A;  4TTV A;  3HXW A;  2ALY B;  3M4Q A;  2NS6 A;  1E1T A;  2RHS B;  3VQV A;  2DVE A;  4ZTZ B;  3A7R A;  4P74 C;  1EVL A;  1Z7M A;  3V7C A;  3RIR A;  1USY C;  1N9W A;  2FYK A;  4YRE A;  1X2H A;  3V8L A;  1SRY A;  4H2Y A;  1HTT A;  4UP9 A;  4HWS A;  4XTW A;  3NEL A;  3RKX A;  2ZZF A;  3EFS A;  4H02 A;  3RF1 A;  2QHV A;  3L1A A;  4XTV A;  1X55 A;  2J3M A;  3VQY A;  1NJ1 A;  4YRI A;  3LC0 A;  4LNS A;  1E1O A;  2A8E A;  4WI1 A;  4H2X B;  1ATI A;  1WPY A;  3LSS A;  3QO8 A;  4LVK A;  3RUX A;  4P74 A;  1YFR A;  3EFR A;  3L2Z A;  2DZ9 A;  4ZTU B;  1W66 A;  3HXV A;  1WYD A;  3BJU A;  3UGQ A;  3R07 A;  1ASZ A;  2EL9 A;  3PCO A;  2DEQ A;  3NEN A;  3G1Z A;  3V7S A;  3HTZ A;  4RQF A;  4XU1 A;  4HVC A;  2CJB A;  1YFS A;  2ALY A;  3NEM A;  3UFG A;  1WU7 A;  4OP0 A;  2EJ9 A;  1NYR A;  5ELO A;  3M4P A;  4YRQ A;  2EJG A;  1ADJ A;  2ZT7 A;  3HRI A;  3V8J A;  2AMC A;  3RL6 A;  3NET A;  2P0L A;  4YRO A;  3P8Y A;  2DKG A;  3VQW A;  1YB3 A;  3QO5 A;  4YRC A;  4YPF A;  2IY5 A;  2ZCE A;  2DQ0 A;  4WJ3 M;  3HFZ A;  2E1H A;  1VQZ A;  3V8K A;  4YRK A;  4HT4 A;  4X5O A;  1WQ7 A;  4YCW A;  2DQ3 A;  3TEG A;  4CH3 A;  2DTH A;  5K1P A;  3PCO B;  3ICA A;  11AS A;  1NJ6 A;  3WQZ A;  2ZR3 A;  1E24 A;  4H2W A;  2I4M A;  3QNE A;  4ZIB A;  1H4Q A;  2ZZE A;  1B7Y B;  2QHU A;  4YCV A;  2DTI A;  2XTI A;  4P75 C;  2ARS A;  4HA8 A;  4UPA A;  4YRM A;  3P8V A;  3PZC A;  2Q7E A;  3MQZ A;  4KR2 A;  1Z7N A;  1WQW A;  4H2S A;  4XEO A; 
#chains in the Genus database with same CATH homology
 2ZT6 A;  4HWT A;  4DQ2 A;  2AMC B;  3REU A;  4TQD A;  4P73 C;  1J5W A;  5KNN A;  4G85 A;  1BIA A;  2CJA A;  4K86 A;  2E64 A;  4CH4 A;  2IY5 B;  1G5I A;  4YDQ A;  1FYF A;  3HFZ B;  4BW9 A;  3E9H A;  2ODR D;  4YYE A;  2E3C A;  4Q15 A;  4YCU A;  4KR3 A;  1IL2 A;  2ZR2 A;  1X2G A;  2I4L A;  1BIB A;  2E65 A;  4H2U A;  2G4C A;  3OD1 A;  4NCX A;  4YP0 A;  3W3S A;  3VQX A;  4LVJ A;  4P75 A;  4EO4 A;  1SET A;  4TVY A;  4CH6 A;  5K1X A;  3BFM A;  1B70 A;  4XTU A;  4RMF A;  1C0A A;  1X01 A;  4TVA B;  3ERR A;  4XEM A;  3UH0 A;  5F5W A;  4UP8 A;  3I7F A;  2ART A;  4P73 A;  4YRF A;  2ZGW A;  1HXD A;  4YRP A;  1B7Y A;  2ZZG A;  1ADY A;  1B76 A;  4LVL A;  3REX A;  3IKL A;  4CS2 A;  2AKW B;  3A5Y A;  3E9I A;  3MF2 A;  4H2V A;  3RKY A;  5C53 B;  3QTC A;  1NJ8 A;  12AS A;  1QE0 A;  4XTY A;  2ZXF A;  1X54 A;  3MEY A;  4YRG A;  4YRN A;  4EX5 A;  4TQF A;  2ZIO A;  1EIY A;  2I4N A;  1G5H A;  4YRT A;  2ODR C;  3DSQ A;  2Q5H A;  3HXX A;  4P3N A;  3VBB A;  1PYS B;  1L0W A;  3L4G B;  2CIM A;  1B70 B;  4CS4 A;  1NJ5 A;  4G84 A;  2EAY A;  1EFW A;  5HGQ A;  3QO7 A;  3IAL A;  4YRR A;  2E10 A;  4LVI A;  2DU7 A;  1X56 A;  4O2D A;  2DDZ A;  4TWA A;  1BBW A;  2C8M A;  1WNL A;  5C52 B;  4P3P A;  1B8A A;  3CMQ A;  4TVA A;  2CGH A;  4HWP A;  3IG2 A;  1KOG A;  2DTO A;  3HXY A;  4P3O A;  1BBU A;  4P72 C;  1JJC A;  2HNI A;  4Q6G A;  4XU0 A;  4XU2 A;  4XTZ A;  4RQE A;  1H4V B;  1EIY B;  1YFT A;  2PMF A;  3A7A A;  2AKW A;  3TEH A;  2ZIN A;  4P71 A;  4E51 A;  4LVM A;  4YRL A;  1H4S A;  3HY0 A;  2J3L A;  2RHQ A;  2ARU A;  3HRK A;  1WLE A;  4XTX A;  3V7R A;  4OLF A;  1PYS A;  2PME A;  4YRS A;  3A5Z A;  3LSQ A;  3L4G A;  2QHS A;  4XU3 A;  4WJ4 A;  4K88 A;  2I4O A;  4UP7 A;  4P72 A;  2DJZ A;  4PG3 A;  2E41 A;  3HFV A;  4BWA A;  5E3I A;  1JJC B;  3A74 A;  3RAC A;  2DXU A;  2ZNJ A;  3KFU A;  2EJF A;  3TEH B;  1LYL A;  4HWO A;  1USY A;  2E5A A;  4DPG A;  3IKM B;  1SER A;  1SES A;  4WF2 A;  3HXZ A;  4AH6 A;  2RHQ B;  3RKW A;  1HC7 A;  2Q7G A;  3TUP A;  2XGT A;  1ASY A;  4J15 A;  5ELN A;  4RDX A;  4CH5 A;  2ZNI A;  2P5I A;  3A31 A;  2RHS A;  3UGT A;  2ZTG A;  1H4T A;  1KMN A;  1NYQ A;  2ZIM A;  1GGM A;  1EOV A;  4CS3 A;  2CJ9 A;  4P71 C;  1EQR A;  4YRJ A;  3HXU A;  3A7U A;  2DZC A;  3RGL A;  2EWN A;  2DU5 A;  1E22 A;  3MF1 A;  4K87 A;  4HWR A;  2QHT A;  3P8T A;  1KMM A;  3FJP A;  4KQE A;  1RIQ A;  2ZT5 A;  2Q7H A;  2ZT8 A;  4H2T A;  1NJ2 A;  1NNH A;  2DXT A;  3A32 A;  4TVW A;  1QF6 A;  1G51 A;  4L87 A;  5C51 B;  1YGB A;  2C7I A;  2Q5I A;  3HY1 A;  1EVK A;  4PHC A;  4H2X A;  4TTV A;  3HXW A;  2ALY B;  3M4Q A;  2NS6 A;  1E1T A;  2RHS B;  3VQV A;  2DVE A;  4ZTZ B;  3A7R A;  4P74 C;  1EVL A;  1Z7M A;  3V7C A;  3RIR A;  1USY C;  1N9W A;  2FYK A;  4YRE A;  1X2H A;  3V8L A;  1SRY A;  4H2Y A;  1HTT A;  4UP9 A;  4HWS A;  4XTW A;  3NEL A;  3RKX A;  2ZZF A;  3EFS A;  4H02 A;  3RF1 A;  2QHV A;  3L1A A;  4XTV A;  1X55 A;  2J3M A;  3VQY A;  1NJ1 A;  4YRI A;  3LC0 A;  4LNS A;  1E1O A;  2A8E A;  4WI1 A;  4H2X B;  1ATI A;  1WPY A;  3LSS A;  3QO8 A;  4LVK A;  3RUX A;  4P74 A;  1YFR A;  3EFR A;  3L2Z A;  2DZ9 A;  4ZTU B;  1W66 A;  3HXV A;  1WYD A;  3BJU A;  3UGQ A;  3R07 A;  1ASZ A;  2EL9 A;  3PCO A;  2DEQ A;  3NEN A;  3G1Z A;  3V7S A;  3HTZ A;  4RQF A;  4XU1 A;  4HVC A;  2CJB A;  1YFS A;  2ALY A;  3NEM A;  3UFG A;  1WU7 A;  4OP0 A;  2EJ9 A;  1NYR A;  5ELO A;  3M4P A;  4YRQ A;  2EJG A;  1ADJ A;  2ZT7 A;  3HRI A;  3V8J A;  2AMC A;  3RL6 A;  3NET A;  2P0L A;  4YRO A;  3P8Y A;  2DKG A;  3VQW A;  1YB3 A;  3QO5 A;  4YRC A;  4YPF A;  2IY5 A;  2ZCE A;  2DQ0 A;  4WJ3 M;  3HFZ A;  2E1H A;  1VQZ A;  3V8K A;  4YRK A;  4HT4 A;  4X5O A;  1WQ7 A;  4YCW A;  2DQ3 A;  3TEG A;  4CH3 A;  2DTH A;  5K1P A;  3PCO B;  3ICA A;  11AS A;  1NJ6 A;  3WQZ A;  2ZR3 A;  1E24 A;  4H2W A;  2I4M A;  3QNE A;  4ZIB A;  1H4Q A;  2ZZE A;  1B7Y B;  2QHU A;  4YCV A;  2DTI A;  2XTI A;  4P75 C;  2ARS A;  4HA8 A;  4UPA A;  4YRM A;  3P8V A;  3PZC A;  2Q7E A;  3MQZ A;  4KR2 A;  1Z7N A;  1WQW A;  4H2S A;  4XEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...