1RIQA

The crystal structure of the catalytic fragment of the alanyl-trna synthetase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
457
structure length
448
Chain Sequence
b'SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alanyl-tRNA synthetase
publication title Alanyl-tRNA Synthetase Crystal Structure and Design for Acceptor-Stem Recognition
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
total genus 152
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1riqA01
1EFWA 2J3LA 4ZTUB 1NJ8A 3MF1A 3L4GA 2EJFA 4TVAB 1NJ1A 4NCXA 1G5HA 2DTHA 4YRIA 4LNSA 3VQWA 2Q7HA 3V7CA 4PHCA 1NNHA 1KOGA 2FYKA 1G51A 4P75C 3HXUA 4YRPA 3RKYA 2CJAA 4CH5A 3G1ZA 3UFGA 2EJ9A 2AKWB 4P3PA 2DU5A 3HY0A 4XTWA 3TEGA 3P8VA 3UGTA 4WJ4A 2DTIA 1NYRA 2DZCA 4TVYA 1JJCA 3EFRA 2RHSB 1BBWA 4P73A 1WNLA 2ZCEA 2Q7GA 3IALA 5E3IA 3HXZA 4P75A 1GGMA 1EVLA 3PCOB 3IKLA 3E9IA 3VBBA 2EL9A 1E24A 1FYFA 1YFTA 3UGQA 1E1TA 1WQWA 3V7RA 3VQVA 1Z7MA 4Q6GA 4XTUA 2E1HA 2E65A 1L0WA 1NJ5A 4P74C 3A7UA 5C52B 2E5AA 3UH0A 3LC0A 3I7FA 4H2TA 4RMFA 12ASA 3L2ZA 4YREA 1SRYA 4UP7A 2AMCA 2ZXFA 2ODRD 3VQYA 4BWAA 1X54A 2ALYA 5C53B 4YRFA 3HXVA 1NJ2A 2ODRC 3LSSA 4CS4A 3IG2A 4WJ3M 2XTIA 4P72C 2ZTGA 3HXXA 2DKGA 3TEHA 4P71C 3V8LA 3TUPA 3M4QA 3MF2A 4YPFA 2DDZA 2QHVA 1ADJA 3A7AA 2ARTA 2RHQB 3ICAA 2XGTA 3RGLA 2E3CA 3RL6A 1YFRA 4UP8A 5F5WA 1PYSB 2ZNJA 4Q15A 4XTVA 3HRKA 4TVAA 4XU2A 4YRQA 4KQEA 2ZT8A 1ADYA 5KNNA 3A7RA 4HVCA 2IY5B 5ELOA 1X01A 3EFSA 1WYDA 4YCUA 1E22A 4H2VA 2ZT7A 3HTZA 1H4TA 1ASZA 3RIRA 4RQEA 1B70B 2AKWA 1YB3A 4TVWA 1WQ7A 4XTYA 1BBUA 2CJ9A 1HXDA 3R07A 3A5YA 1EVKA 2C7IA 3MEYA 2C8MA 3HFZB 2I4LA 4K87A 2RHSA 3CMQA 2DU7A 1NJ6A 1SETA 4H02A 2Q5IA 3E9HA 2DTOA 3HRIA 1B7YB 4YRMA 1VQZA 1SESA 1EIYB 4YRGA 4YRKA 3HXYA 3PCOA 1HC7A 1SERA 2DXTA 1X2GA 4YRJA 3LSQA 4XU1A 5C51B 1KMMA 4H2XB 2E41A 2P5IA 2ZT5A 4AH6A 1KMNA 1WLEA 4P3NA 1QF6A 3RACA 1N9WA 3RUXA 4O2DA 4EX5A 3KFUA 3RF1A 2ZZGA 4RDXA 4K88A 4L87A 2CJBA 4YRTA 1H4QA 4OP0A 2PMEA 2ZR3A 4KR2A 3V8KA 2EAYA 2QHTA 3V8JA 4ZIBA 3BJUA 3ERRA 4X5OA 1ASYA 1X56A 11ASA 4DQ2A 1H4VB 4CH4A 3A5ZA 4HWTA 1G5IA 2QHSA 1C0AA 4PG3A 4XTXA 5ELNA 4P74A 1B8AA 2RHQA 2ZT6A 4KR3A 1YGBA 4BW9A 1PYSA 1YFSA 4OLFA 4YYEA 1WU7A 3PZCA 3WQZA 4CH6A 4HWRA 3QO7A 3L4GB 3P8TA 4YRRA 3P8YA 3RKWA 2DQ3A 4P72A 2IY5A 2ZR2A 3HXWA 3M4PA 3IKMB 4E51A 4P71A 3HFVA 4TQFA 1WPYA 4XU3A 2I4NA 2ARSA 4P73C 4YDQA 3HY1A 2ZIOA 4YRLA 3V7SA 1B70A 1EQRA 1X55A 2P0LA 4YROA 3REUA 4RQFA 4YRNA 3NETA 1BIAA 2ZGWA 1ATIA 2ZNIA 4J15A 1J5WA 1W66A 4XEMA 3HFZA 4YRCA 1QE0A 2ZIMA 3NEMA 3NENA 3L1AA 3NELA 3QTCA 2Q5HA 4XTZA 1NYQA 4H2SA 4YRSA 4WI1A 1JJCB 4TWAA 1B7YA 1EIYA 2EJGA 2ARUA 2J3MA 2ZZEA 2CGHA 1H4SA 4YP0A 3REXA 2I4MA 4H2XA 4TQDA 2I4OA 1B76A 3A74A 4ZTZB 1USYC 4UPAA 2E10A 4CS3A 4G84A 3DSQA 4CS2A 1HTTA 2ZZFA 1E1OA 3A32A 3QO5A 3W3SA 4G85A 3BFMA 4CH3A 4HWPA 4K86A 4YCVA 2DXUA 3A31A 1X2HA 5K1PA 3VQXA 3QO8A 1BIBA 4WF2A 2QHUA 2DQ0A 2AMCB 2G4CA 2DEQA 4TTVA 2ALYB 4XU0A 3OD1A 1IL2A 1Z7NA 2E64A 2PMFA 4H2YA 2Q7EA 4HWOA 3QNEA 2CIMA 4EO4A 1EOVA 1USYA 4DPGA 1LYLA 4HWSA 3RKXA 5K1XA 4H2UA 2DVEA 4P3OA 3TEHB 2DJZA 5HGQA 2ZINA 4XEOA 2DZ9A 4H2WA 4YCWA 2HNIA 4HA8A 2EWNA 4UP9A 3FJPA 1RIQA
chains in the Genus database with same CATH superfamily
1EFWA 2J3LA 4ZTUB 1NJ8A 3MF1A 3L4GA 2EJFA 4TVAB 1NJ1A 4NCXA 1G5HA 2DTHA 4YRIA 4LNSA 3VQWA 2Q7HA 3V7CA 4PHCA 1NNHA 1KOGA 2FYKA 1G51A 4P75C 3HXUA 2A8EA 4YRPA 3RKYA 2CJAA 4CH5A 3G1ZA 3UFGA 2EJ9A 2AKWB 4P3PA 2DU5A 3HY0A 4XTWA 3TEGA 3P8VA 4LVMA 3UGTA 4WJ4A 2DTIA 1NYRA 2DZCA 4TVYA 1JJCA 3EFRA 4LVJA 2RHSB 1BBWA 4P73A 1WNLA 2ZCEA 2Q7GA 3IALA 5E3IA 3HXZA 4P75A 1GGMA 1EVLA 3PCOB 3IKLA 3E9IA 3VBBA 2EL9A 1E24A 1FYFA 1YFTA 3UGQA 1E1TA 1WQWA 3V7RA 3VQVA 1Z7MA 4Q6GA 4XTUA 2E1HA 2E65A 1L0WA 1NJ5A 4P74C 3A7UA 5C52B 2E5AA 3UH0A 3LC0A 3I7FA 4H2TA 4RMFA 12ASA 3L2ZA 4YREA 1SRYA 4UP7A 2AMCA 2ZXFA 2ODRD 3VQYA 4BWAA 1X54A 2ALYA 5C53B 4YRFA 3HXVA 1NJ2A 2ODRC 3LSSA 4CS4A 3IG2A 4WJ3M 2XTIA 4P72C 2ZTGA 3HXXA 2DKGA 3TEHA 4P71C 3V8LA 3TUPA 3M4QA 3MF2A 4YPFA 2DDZA 2QHVA 1ADJA 3A7AA 2ARTA 2RHQB 3ICAA 2XGTA 3RGLA 2E3CA 3RL6A 1YFRA 4UP8A 5F5WA 1PYSB 2ZNJA 4Q15A 4XTVA 3HRKA 4TVAA 4XU2A 4YRQA 4KQEA 2ZT8A 1ADYA 5KNNA 3A7RA 4HVCA 2IY5B 5ELOA 1X01A 3EFSA 1WYDA 4HT4A 4YCUA 1E22A 4H2VA 2ZT7A 3HTZA 1H4TA 1ASZA 3RIRA 4RQEA 1B70B 2AKWA 1YB3A 4TVWA 1WQ7A 4XTYA 1BBUA 2CJ9A 1HXDA 3R07A 3A5YA 1EVKA 2C7IA 3MEYA 2C8MA 3HFZB 2I4LA 4K87A 2RHSA 3CMQA 2DU7A 1NJ6A 1SETA 4H02A 2Q5IA 3E9HA 2DTOA 3HRIA 1B7YB 4YRMA 1VQZA 1SESA 1EIYB 4YRGA 4YRKA 3HXYA 3PCOA 1HC7A 1SERA 2DXTA 1X2GA 4YRJA 3LSQA 4XU1A 5C51B 1KMMA 4H2XB 2E41A 2P5IA 2ZT5A 4AH6A 1KMNA 1WLEA 4P3NA 1QF6A 3RACA 1N9WA 3RUXA 4O2DA 4EX5A 3KFUA 3RF1A 2ZZGA 4RDXA 4K88A 4L87A 2CJBA 4YRTA 1H4QA 4OP0A 2PMEA 2ZR3A 4KR2A 3V8KA 2EAYA 2QHTA 3V8JA 4ZIBA 3BJUA 3ERRA 4LVIA 4X5OA 1ASYA 1X56A 11ASA 4DQ2A 1H4VB 4CH4A 3A5ZA 4HWTA 1G5IA 2QHSA 1C0AA 4PG3A 4XTXA 5ELNA 4P74A 1B8AA 2RHQA 2ZT6A 4KR3A 1YGBA 4BW9A 1PYSA 1YFSA 4OLFA 4YYEA 1WU7A 3PZCA 3WQZA 4LVKA 4CH6A 4HWRA 3QO7A 3L4GB 3P8TA 4YRRA 3P8YA 3RKWA 2DQ3A 4P72A 2IY5A 2ZR2A 3HXWA 3M4PA 3IKMB 4E51A 4P71A 3HFVA 4TQFA 1WPYA 4XU3A 2I4NA 2ARSA 4P73C 4YDQA 3HY1A 2ZIOA 4YRLA 3V7SA 1B70A 1EQRA 1X55A 2P0LA 4YROA 3REUA 4RQFA 4YRNA 3NETA 1BIAA 2ZGWA 1ATIA 2ZNIA 4J15A 1J5WA 1W66A 4XEMA 3HFZA 4YRCA 1QE0A 2ZIMA 3NEMA 3NENA 3L1AA 3NELA 3QTCA 2Q5HA 3MQZA 4XTZA 1NYQA 4H2SA 4YRSA 4WI1A 1JJCB 4TWAA 1B7YA 1EIYA 2EJGA 2ARUA 4LVLA 2J3MA 2ZZEA 2CGHA 1H4SA 4YP0A 3REXA 2I4MA 4H2XA 4TQDA 2I4OA 1B76A 3A74A 4ZTZB 1USYC 4UPAA 2E10A 4CS3A 4G84A 3DSQA 4CS2A 1HTTA 2ZZFA 2NS6A 1E1OA 3A32A 3QO5A 3W3SA 4G85A 3BFMA 4CH3A 4HWPA 4K86A 4YCVA 2DXUA 3A31A 1X2HA 5K1PA 3VQXA 3QO8A 1BIBA 4WF2A 2QHUA 2DQ0A 2AMCB 2G4CA 2DEQA 4TTVA 2ALYB 4XU0A 3OD1A 1IL2A 1Z7NA 2E64A 2PMFA 4H2YA 2Q7EA 4HWOA 3QNEA 2CIMA 4EO4A 1EOVA 1USYA 4DPGA 1LYLA 4HWSA 3RKXA 5K1XA 4H2UA 2DVEA 4P3OA 3TEHB 2DJZA 5HGQA 2ZINA 4XEOA 2DZ9A 4H2WA 4YCWA 2HNIA 4HA8A 2EWNA 4UP9A 3FJPA 1RIQA
chains in the Genus database with same CATH topology
1EFWA 2J3LA 4ZTUB 1NJ8A 3MF1A 3L4GA 2EJFA 4TVAB 1NJ1A 4NCXA 1G5HA 2DTHA 4YRIA 4LNSA 3VQWA 2Q7HA 3V7CA 4PHCA 1NNHA 1KOGA 2FYKA 1G51A 4P75C 3HXUA 2A8EA 4YRPA 3RKYA 2CJAA 4CH5A 3G1ZA 3UFGA 2EJ9A 2AKWB 4P3PA 2DU5A 3HY0A 4XTWA 3TEGA 3P8VA 4LVMA 3UGTA 4WJ4A 2DTIA 1NYRA 2DZCA 4TVYA 1JJCA 3EFRA 4LVJA 2RHSB 1BBWA 4P73A 1WNLA 2ZCEA 2Q7GA 3IALA 5E3IA 3HXZA 4P75A 1GGMA 1EVLA 3PCOB 3IKLA 3E9IA 3VBBA 2EL9A 1E24A 1FYFA 1YFTA 3UGQA 1E1TA 1WQWA 3V7RA 3VQVA 1Z7MA 4Q6GA 4XTUA 2E1HA 2E65A 1L0WA 1NJ5A 4P74C 3A7UA 5C52B 2E5AA 3UH0A 3LC0A 3I7FA 4H2TA 4RMFA 12ASA 3L2ZA 4YREA 1SRYA 4UP7A 2AMCA 2ZXFA 2ODRD 3VQYA 4BWAA 1X54A 2ALYA 5C53B 4YRFA 3HXVA 1NJ2A 2ODRC 3LSSA 4CS4A 3IG2A 4WJ3M 2XTIA 4P72C 2ZTGA 3HXXA 2DKGA 3TEHA 4P71C 3V8LA 3TUPA 3M4QA 3MF2A 4YPFA 2DDZA 2QHVA 1ADJA 3A7AA 2ARTA 2RHQB 3ICAA 2XGTA 3RGLA 2E3CA 3RL6A 1YFRA 4UP8A 5F5WA 1PYSB 2ZNJA 4Q15A 4XTVA 3HRKA 4TVAA 4XU2A 4YRQA 4KQEA 2ZT8A 1ADYA 5KNNA 3A7RA 4HVCA 2IY5B 5ELOA 1X01A 3EFSA 1WYDA 4HT4A 4YCUA 1E22A 4H2VA 2ZT7A 3HTZA 1H4TA 1ASZA 3RIRA 4RQEA 1B70B 2AKWA 1YB3A 4TVWA 1WQ7A 4XTYA 1BBUA 2CJ9A 1HXDA 3R07A 3A5YA 1EVKA 2C7IA 3MEYA 2C8MA 3HFZB 2I4LA 4K87A 2RHSA 3CMQA 2DU7A 1NJ6A 1SETA 4H02A 2Q5IA 3E9HA 2DTOA 3HRIA 1B7YB 4YRMA 1VQZA 1SESA 1EIYB 4YRGA 4YRKA 3HXYA 3PCOA 1HC7A 1SERA 2DXTA 1X2GA 4YRJA 3LSQA 4XU1A 5C51B 1KMMA 4H2XB 2E41A 2P5IA 2ZT5A 4AH6A 1KMNA 1WLEA 4P3NA 1QF6A 3RACA 1N9WA 3RUXA 4O2DA 4EX5A 3KFUA 3RF1A 2ZZGA 4RDXA 4K88A 4L87A 2CJBA 4YRTA 1H4QA 4OP0A 2PMEA 2ZR3A 4KR2A 3V8KA 2EAYA 2QHTA 3V8JA 4ZIBA 3BJUA 3ERRA 4LVIA 4X5OA 1ASYA 1X56A 11ASA 4DQ2A 1H4VB 4CH4A 3A5ZA 4HWTA 1G5IA 2QHSA 1C0AA 4PG3A 4XTXA 5ELNA 4P74A 1B8AA 2RHQA 2ZT6A 4KR3A 1YGBA 4BW9A 1PYSA 1YFSA 4OLFA 4YYEA 1WU7A 3PZCA 3WQZA 4LVKA 4CH6A 4HWRA 3QO7A 3L4GB 3P8TA 4YRRA 3P8YA 3RKWA 2DQ3A 4P72A 2IY5A 2ZR2A 3HXWA 3M4PA 3IKMB 4E51A 4P71A 3HFVA 4TQFA 1WPYA 4XU3A 2I4NA 2ARSA 4P73C 4YDQA 3HY1A 2ZIOA 4YRLA 3V7SA 1B70A 1EQRA 1X55A 2P0LA 4YROA 3REUA 4RQFA 4YRNA 3NETA 1BIAA 2ZGWA 1ATIA 2ZNIA 4J15A 1J5WA 1W66A 4XEMA 3HFZA 4YRCA 1QE0A 2ZIMA 3NEMA 3NENA 3L1AA 3NELA 3QTCA 2Q5HA 3MQZA 4XTZA 1NYQA 4H2SA 4YRSA 4WI1A 1JJCB 4TWAA 1B7YA 1EIYA 2EJGA 2ARUA 4LVLA 2J3MA 2ZZEA 2CGHA 1H4SA 4YP0A 3REXA 2I4MA 4H2XA 4TQDA 2I4OA 1B76A 3A74A 4ZTZB 1USYC 4UPAA 2E10A 4CS3A 4G84A 3DSQA 4CS2A 1HTTA 2ZZFA 2NS6A 1E1OA 3A32A 3QO5A 3W3SA 4G85A 3BFMA 4CH3A 4HWPA 4K86A 4YCVA 2DXUA 3A31A 1X2HA 5K1PA 3VQXA 3QO8A 1BIBA 4WF2A 2QHUA 2DQ0A 2AMCB 2G4CA 2DEQA 4TTVA 2ALYB 4XU0A 3OD1A 1IL2A 1Z7NA 2E64A 2PMFA 4H2YA 2Q7EA 4HWOA 3QNEA 2CIMA 4EO4A 1EOVA 1USYA 4DPGA 1LYLA 4HWSA 3RKXA 5K1XA 4H2UA 2DVEA 4P3OA 3TEHB 2DJZA 5HGQA 2ZINA 4XEOA 2DZ9A 4H2WA 4YCWA 2HNIA 4HA8A 2EWNA 4UP9A 3FJPA 1RIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFW A;  2J3L A;  4ZTU B;  1NJ8 A;  3MF1 A;  3L4G A;  2EJF A;  4TVA B;  1NJ1 A;  4NCX A;  1G5H A;  2DTH A;  4YRI A;  4LNS A;  3VQW A;  2Q7H A;  3V7C A;  4PHC A;  1NNH A;  1KOG A;  2FYK A;  1G51 A;  4P75 C;  3HXU A;  4YRP A;  3RKY A;  2CJA A;  4CH5 A;  3G1Z A;  3UFG A;  2EJ9 A;  2AKW B;  4P3P A;  2DU5 A;  3HY0 A;  4XTW A;  3TEG A;  3P8V A;  3UGT A;  4WJ4 A;  2DTI A;  1NYR A;  2DZC A;  4TVY A;  1JJC A;  3EFR A;  2RHS B;  1BBW A;  4P73 A;  1WNL A;  2ZCE A;  2Q7G A;  3IAL A;  5E3I A;  3HXZ A;  4P75 A;  1GGM A;  1EVL A;  3PCO B;  3IKL A;  3E9I A;  3VBB A;  2EL9 A;  1E24 A;  1FYF A;  1YFT A;  3UGQ A;  1E1T A;  1WQW A;  3V7R A;  3VQV A;  1Z7M A;  4Q6G A;  4XTU A;  2E1H A;  2E65 A;  1L0W A;  1NJ5 A;  4P74 C;  3A7U A;  5C52 B;  2E5A A;  3UH0 A;  3LC0 A;  3I7F A;  4H2T A;  4RMF A;  12AS A;  3L2Z A;  4YRE A;  1SRY A;  4UP7 A;  2AMC A;  2ZXF A;  2ODR D;  3VQY A;  4BWA A;  1X54 A;  2ALY A;  5C53 B;  4YRF A;  3HXV A;  1NJ2 A;  2ODR C;  3LSS A;  4CS4 A;  3IG2 A;  4WJ3 M;  2XTI A;  4P72 C;  2ZTG A;  3HXX A;  2DKG A;  3TEH A;  4P71 C;  3V8L A;  3TUP A;  3M4Q A;  3MF2 A;  4YPF A;  2DDZ A;  2QHV A;  1ADJ A;  3A7A A;  2ART A;  2RHQ B;  3ICA A;  2XGT A;  3RGL A;  2E3C A;  3RL6 A;  1YFR A;  4UP8 A;  5F5W A;  1PYS B;  2ZNJ A;  4Q15 A;  4XTV A;  3HRK A;  4TVA A;  4XU2 A;  4YRQ A;  4KQE A;  2ZT8 A;  1ADY A;  5KNN A;  3A7R A;  4HVC A;  2IY5 B;  5ELO A;  1X01 A;  3EFS A;  1WYD A;  4YCU A;  1E22 A;  4H2V A;  2ZT7 A;  3HTZ A;  1H4T A;  1ASZ A;  3RIR A;  4RQE A;  1B70 B;  2AKW A;  1YB3 A;  4TVW A;  1WQ7 A;  4XTY A;  1BBU A;  2CJ9 A;  1HXD A;  3R07 A;  3A5Y A;  1EVK A;  2C7I A;  3MEY A;  2C8M A;  3HFZ B;  2I4L A;  4K87 A;  2RHS A;  3CMQ A;  2DU7 A;  1NJ6 A;  1SET A;  4H02 A;  2Q5I A;  3E9H A;  2DTO A;  3HRI A;  1B7Y B;  4YRM A;  1VQZ A;  1SES A;  1EIY B;  4YRG A;  4YRK A;  3HXY A;  3PCO A;  1HC7 A;  1SER A;  2DXT A;  1X2G A;  4YRJ A;  3LSQ A;  4XU1 A;  5C51 B;  1KMM A;  4H2X B;  2E41 A;  2P5I A;  2ZT5 A;  4AH6 A;  1KMN A;  1WLE A;  4P3N A;  1QF6 A;  3RAC A;  1N9W A;  3RUX A;  4O2D A;  4EX5 A;  3KFU A;  3RF1 A;  2ZZG A;  4RDX A;  4K88 A;  4L87 A;  2CJB A;  4YRT A;  1H4Q A;  4OP0 A;  2PME A;  2ZR3 A;  4KR2 A;  3V8K A;  2EAY A;  2QHT A;  3V8J A;  4ZIB A;  3BJU A;  3ERR A;  4X5O A;  1ASY A;  1X56 A;  11AS A;  4DQ2 A;  1H4V B;  4CH4 A;  3A5Z A;  4HWT A;  1G5I A;  2QHS A;  1C0A A;  4PG3 A;  4XTX A;  5ELN A;  4P74 A;  1B8A A;  2RHQ A;  2ZT6 A;  4KR3 A;  1YGB A;  4BW9 A;  1PYS A;  1YFS A;  4OLF A;  4YYE A;  1WU7 A;  3PZC A;  3WQZ A;  4CH6 A;  4HWR A;  3QO7 A;  3L4G B;  3P8T A;  4YRR A;  3P8Y A;  3RKW A;  2DQ3 A;  4P72 A;  2IY5 A;  2ZR2 A;  3HXW A;  3M4P A;  3IKM B;  4E51 A;  4P71 A;  3HFV A;  4TQF A;  1WPY A;  4XU3 A;  2I4N A;  2ARS A;  4P73 C;  4YDQ A;  3HY1 A;  2ZIO A;  4YRL A;  3V7S A;  1B70 A;  1EQR A;  1X55 A;  2P0L A;  4YRO A;  3REU A;  4RQF A;  4YRN A;  3NET A;  1BIA A;  2ZGW A;  1ATI A;  2ZNI A;  4J15 A;  1J5W A;  1W66 A;  4XEM A;  3HFZ A;  4YRC A;  1QE0 A;  2ZIM A;  3NEM A;  3NEN A;  3L1A A;  3NEL A;  3QTC A;  2Q5H A;  4XTZ A;  1NYQ A;  4H2S A;  4YRS A;  4WI1 A;  1JJC B;  4TWA A;  1B7Y A;  1EIY A;  2EJG A;  2ARU A;  2J3M A;  2ZZE A;  2CGH A;  1H4S A;  4YP0 A;  3REX A;  2I4M A;  4H2X A;  4TQD A;  2I4O A;  1B76 A;  3A74 A;  4ZTZ B;  1USY C;  4UPA A;  2E10 A;  4CS3 A;  4G84 A;  3DSQ A;  4CS2 A;  1HTT A;  2ZZF A;  1E1O A;  3A32 A;  3QO5 A;  3W3S A;  4G85 A;  3BFM A;  4CH3 A;  4HWP A;  4K86 A;  4YCV A;  2DXU A;  3A31 A;  1X2H A;  5K1P A;  3VQX A;  3QO8 A;  1BIB A;  4WF2 A;  2QHU A;  2DQ0 A;  2AMC B;  2G4C A;  2DEQ A;  4TTV A;  2ALY B;  4XU0 A;  3OD1 A;  1IL2 A;  1Z7N A;  2E64 A;  2PMF A;  4H2Y A;  2Q7E A;  4HWO A;  3QNE A;  2CIM A;  4EO4 A;  1EOV A;  1USY A;  4DPG A;  1LYL A;  4HWS A;  3RKX A;  5K1X A;  4H2U A;  2DVE A;  4P3O A;  3TEH B;  2DJZ A;  5HGQ A;  2ZIN A;  4XEO A;  2DZ9 A;  4H2W A;  4YCW A;  2HNI A;  4HA8 A;  2EWN A;  4UP9 A;  3FJP A;  1RIQ A; 
#chains in the Genus database with same CATH topology
 1EFW A;  2J3L A;  4ZTU B;  1NJ8 A;  3MF1 A;  3L4G A;  2EJF A;  4TVA B;  1NJ1 A;  4NCX A;  1G5H A;  2DTH A;  4YRI A;  4LNS A;  3VQW A;  2Q7H A;  3V7C A;  4PHC A;  1NNH A;  1KOG A;  2FYK A;  1G51 A;  4P75 C;  3HXU A;  2A8E A;  4YRP A;  3RKY A;  2CJA A;  4CH5 A;  3G1Z A;  3UFG A;  2EJ9 A;  2AKW B;  4P3P A;  2DU5 A;  3HY0 A;  4XTW A;  3TEG A;  3P8V A;  4LVM A;  3UGT A;  4WJ4 A;  2DTI A;  1NYR A;  2DZC A;  4TVY A;  1JJC A;  3EFR A;  4LVJ A;  2RHS B;  1BBW A;  4P73 A;  1WNL A;  2ZCE A;  2Q7G A;  3IAL A;  5E3I A;  3HXZ A;  4P75 A;  1GGM A;  1EVL A;  3PCO B;  3IKL A;  3E9I A;  3VBB A;  2EL9 A;  1E24 A;  1FYF A;  1YFT A;  3UGQ A;  1E1T A;  1WQW A;  3V7R A;  3VQV A;  1Z7M A;  4Q6G A;  4XTU A;  2E1H A;  2E65 A;  1L0W A;  1NJ5 A;  4P74 C;  3A7U A;  5C52 B;  2E5A A;  3UH0 A;  3LC0 A;  3I7F A;  4H2T A;  4RMF A;  12AS A;  3L2Z A;  4YRE A;  1SRY A;  4UP7 A;  2AMC A;  2ZXF A;  2ODR D;  3VQY A;  4BWA A;  1X54 A;  2ALY A;  5C53 B;  4YRF A;  3HXV A;  1NJ2 A;  2ODR C;  3LSS A;  4CS4 A;  3IG2 A;  4WJ3 M;  2XTI A;  4P72 C;  2ZTG A;  3HXX A;  2DKG A;  3TEH A;  4P71 C;  3V8L A;  3TUP A;  3M4Q A;  3MF2 A;  4YPF A;  2DDZ A;  2QHV A;  1ADJ A;  3A7A A;  2ART A;  2RHQ B;  3ICA A;  2XGT A;  3RGL A;  2E3C A;  3RL6 A;  1YFR A;  4UP8 A;  5F5W A;  1PYS B;  2ZNJ A;  4Q15 A;  4XTV A;  3HRK A;  4TVA A;  4XU2 A;  4YRQ A;  4KQE A;  2ZT8 A;  1ADY A;  5KNN A;  3A7R A;  4HVC A;  2IY5 B;  5ELO A;  1X01 A;  3EFS A;  1WYD A;  4HT4 A;  4YCU A;  1E22 A;  4H2V A;  2ZT7 A;  3HTZ A;  1H4T A;  1ASZ A;  3RIR A;  4RQE A;  1B70 B;  2AKW A;  1YB3 A;  4TVW A;  1WQ7 A;  4XTY A;  1BBU A;  2CJ9 A;  1HXD A;  3R07 A;  3A5Y A;  1EVK A;  2C7I A;  3MEY A;  2C8M A;  3HFZ B;  2I4L A;  4K87 A;  2RHS A;  3CMQ A;  2DU7 A;  1NJ6 A;  1SET A;  4H02 A;  2Q5I A;  3E9H A;  2DTO A;  3HRI A;  1B7Y B;  4YRM A;  1VQZ A;  1SES A;  1EIY B;  4YRG A;  4YRK A;  3HXY A;  3PCO A;  1HC7 A;  1SER A;  2DXT A;  1X2G A;  4YRJ A;  3LSQ A;  4XU1 A;  5C51 B;  1KMM A;  4H2X B;  2E41 A;  2P5I A;  2ZT5 A;  4AH6 A;  1KMN A;  1WLE A;  4P3N A;  1QF6 A;  3RAC A;  1N9W A;  3RUX A;  4O2D A;  4EX5 A;  3KFU A;  3RF1 A;  2ZZG A;  4RDX A;  4K88 A;  4L87 A;  2CJB A;  4YRT A;  1H4Q A;  4OP0 A;  2PME A;  2ZR3 A;  4KR2 A;  3V8K A;  2EAY A;  2QHT A;  3V8J A;  4ZIB A;  3BJU A;  3ERR A;  4LVI A;  4X5O A;  1ASY A;  1X56 A;  11AS A;  4DQ2 A;  1H4V B;  4CH4 A;  3A5Z A;  4HWT A;  1G5I A;  2QHS A;  1C0A A;  4PG3 A;  4XTX A;  5ELN A;  4P74 A;  1B8A A;  2RHQ A;  2ZT6 A;  4KR3 A;  1YGB A;  4BW9 A;  1PYS A;  1YFS A;  4OLF A;  4YYE A;  1WU7 A;  3PZC A;  3WQZ A;  4LVK A;  4CH6 A;  4HWR A;  3QO7 A;  3L4G B;  3P8T A;  4YRR A;  3P8Y A;  3RKW A;  2DQ3 A;  4P72 A;  2IY5 A;  2ZR2 A;  3HXW A;  3M4P A;  3IKM B;  4E51 A;  4P71 A;  3HFV A;  4TQF A;  1WPY A;  4XU3 A;  2I4N A;  2ARS A;  4P73 C;  4YDQ A;  3HY1 A;  2ZIO A;  4YRL A;  3V7S A;  1B70 A;  1EQR A;  1X55 A;  2P0L A;  4YRO A;  3REU A;  4RQF A;  4YRN A;  3NET A;  1BIA A;  2ZGW A;  1ATI A;  2ZNI A;  4J15 A;  1J5W A;  1W66 A;  4XEM A;  3HFZ A;  4YRC A;  1QE0 A;  2ZIM A;  3NEM A;  3NEN A;  3L1A A;  3NEL A;  3QTC A;  2Q5H A;  3MQZ A;  4XTZ A;  1NYQ A;  4H2S A;  4YRS A;  4WI1 A;  1JJC B;  4TWA A;  1B7Y A;  1EIY A;  2EJG A;  2ARU A;  4LVL A;  2J3M A;  2ZZE A;  2CGH A;  1H4S A;  4YP0 A;  3REX A;  2I4M A;  4H2X A;  4TQD A;  2I4O A;  1B76 A;  3A74 A;  4ZTZ B;  1USY C;  4UPA A;  2E10 A;  4CS3 A;  4G84 A;  3DSQ A;  4CS2 A;  1HTT A;  2ZZF A;  2NS6 A;  1E1O A;  3A32 A;  3QO5 A;  3W3S A;  4G85 A;  3BFM A;  4CH3 A;  4HWP A;  4K86 A;  4YCV A;  2DXU A;  3A31 A;  1X2H A;  5K1P A;  3VQX A;  3QO8 A;  1BIB A;  4WF2 A;  2QHU A;  2DQ0 A;  2AMC B;  2G4C A;  2DEQ A;  4TTV A;  2ALY B;  4XU0 A;  3OD1 A;  1IL2 A;  1Z7N A;  2E64 A;  2PMF A;  4H2Y A;  2Q7E A;  4HWO A;  3QNE A;  2CIM A;  4EO4 A;  1EOV A;  1USY A;  4DPG A;  1LYL A;  4HWS A;  3RKX A;  5K1X A;  4H2U A;  2DVE A;  4P3O A;  3TEH B;  2DJZ A;  5HGQ A;  2ZIN A;  4XEO A;  2DZ9 A;  4H2W A;  4YCW A;  2HNI A;  4HA8 A;  2EWN A;  4UP9 A;  3FJP A;  1RIQ A; 
#chains in the Genus database with same CATH homology
 1EFW A;  2J3L A;  4ZTU B;  1NJ8 A;  3MF1 A;  3L4G A;  2EJF A;  4TVA B;  1NJ1 A;  4NCX A;  1G5H A;  2DTH A;  4YRI A;  4LNS A;  3VQW A;  2Q7H A;  3V7C A;  4PHC A;  1NNH A;  1KOG A;  2FYK A;  1G51 A;  4P75 C;  3HXU A;  2A8E A;  4YRP A;  3RKY A;  2CJA A;  4CH5 A;  3G1Z A;  3UFG A;  2EJ9 A;  2AKW B;  4P3P A;  2DU5 A;  3HY0 A;  4XTW A;  3TEG A;  3P8V A;  4LVM A;  3UGT A;  4WJ4 A;  2DTI A;  1NYR A;  2DZC A;  4TVY A;  1JJC A;  3EFR A;  4LVJ A;  2RHS B;  1BBW A;  4P73 A;  1WNL A;  2ZCE A;  2Q7G A;  3IAL A;  5E3I A;  3HXZ A;  4P75 A;  1GGM A;  1EVL A;  3PCO B;  3IKL A;  3E9I A;  3VBB A;  2EL9 A;  1E24 A;  1FYF A;  1YFT A;  3UGQ A;  1E1T A;  1WQW A;  3V7R A;  3VQV A;  1Z7M A;  4Q6G A;  4XTU A;  2E1H A;  2E65 A;  1L0W A;  1NJ5 A;  4P74 C;  3A7U A;  5C52 B;  2E5A A;  3UH0 A;  3LC0 A;  3I7F A;  4H2T A;  4RMF A;  12AS A;  3L2Z A;  4YRE A;  1SRY A;  4UP7 A;  2AMC A;  2ZXF A;  2ODR D;  3VQY A;  4BWA A;  1X54 A;  2ALY A;  5C53 B;  4YRF A;  3HXV A;  1NJ2 A;  2ODR C;  3LSS A;  4CS4 A;  3IG2 A;  4WJ3 M;  2XTI A;  4P72 C;  2ZTG A;  3HXX A;  2DKG A;  3TEH A;  4P71 C;  3V8L A;  3TUP A;  3M4Q A;  3MF2 A;  4YPF A;  2DDZ A;  2QHV A;  1ADJ A;  3A7A A;  2ART A;  2RHQ B;  3ICA A;  2XGT A;  3RGL A;  2E3C A;  3RL6 A;  1YFR A;  4UP8 A;  5F5W A;  1PYS B;  2ZNJ A;  4Q15 A;  4XTV A;  3HRK A;  4TVA A;  4XU2 A;  4YRQ A;  4KQE A;  2ZT8 A;  1ADY A;  5KNN A;  3A7R A;  4HVC A;  2IY5 B;  5ELO A;  1X01 A;  3EFS A;  1WYD A;  4HT4 A;  4YCU A;  1E22 A;  4H2V A;  2ZT7 A;  3HTZ A;  1H4T A;  1ASZ A;  3RIR A;  4RQE A;  1B70 B;  2AKW A;  1YB3 A;  4TVW A;  1WQ7 A;  4XTY A;  1BBU A;  2CJ9 A;  1HXD A;  3R07 A;  3A5Y A;  1EVK A;  2C7I A;  3MEY A;  2C8M A;  3HFZ B;  2I4L A;  4K87 A;  2RHS A;  3CMQ A;  2DU7 A;  1NJ6 A;  1SET A;  4H02 A;  2Q5I A;  3E9H A;  2DTO A;  3HRI A;  1B7Y B;  4YRM A;  1VQZ A;  1SES A;  1EIY B;  4YRG A;  4YRK A;  3HXY A;  3PCO A;  1HC7 A;  1SER A;  2DXT A;  1X2G A;  4YRJ A;  3LSQ A;  4XU1 A;  5C51 B;  1KMM A;  4H2X B;  2E41 A;  2P5I A;  2ZT5 A;  4AH6 A;  1KMN A;  1WLE A;  4P3N A;  1QF6 A;  3RAC A;  1N9W A;  3RUX A;  4O2D A;  4EX5 A;  3KFU A;  3RF1 A;  2ZZG A;  4RDX A;  4K88 A;  4L87 A;  2CJB A;  4YRT A;  1H4Q A;  4OP0 A;  2PME A;  2ZR3 A;  4KR2 A;  3V8K A;  2EAY A;  2QHT A;  3V8J A;  4ZIB A;  3BJU A;  3ERR A;  4LVI A;  4X5O A;  1ASY A;  1X56 A;  11AS A;  4DQ2 A;  1H4V B;  4CH4 A;  3A5Z A;  4HWT A;  1G5I A;  2QHS A;  1C0A A;  4PG3 A;  4XTX A;  5ELN A;  4P74 A;  1B8A A;  2RHQ A;  2ZT6 A;  4KR3 A;  1YGB A;  4BW9 A;  1PYS A;  1YFS A;  4OLF A;  4YYE A;  1WU7 A;  3PZC A;  3WQZ A;  4LVK A;  4CH6 A;  4HWR A;  3QO7 A;  3L4G B;  3P8T A;  4YRR A;  3P8Y A;  3RKW A;  2DQ3 A;  4P72 A;  2IY5 A;  2ZR2 A;  3HXW A;  3M4P A;  3IKM B;  4E51 A;  4P71 A;  3HFV A;  4TQF A;  1WPY A;  4XU3 A;  2I4N A;  2ARS A;  4P73 C;  4YDQ A;  3HY1 A;  2ZIO A;  4YRL A;  3V7S A;  1B70 A;  1EQR A;  1X55 A;  2P0L A;  4YRO A;  3REU A;  4RQF A;  4YRN A;  3NET A;  1BIA A;  2ZGW A;  1ATI A;  2ZNI A;  4J15 A;  1J5W A;  1W66 A;  4XEM A;  3HFZ A;  4YRC A;  1QE0 A;  2ZIM A;  3NEM A;  3NEN A;  3L1A A;  3NEL A;  3QTC A;  2Q5H A;  3MQZ A;  4XTZ A;  1NYQ A;  4H2S A;  4YRS A;  4WI1 A;  1JJC B;  4TWA A;  1B7Y A;  1EIY A;  2EJG A;  2ARU A;  4LVL A;  2J3M A;  2ZZE A;  2CGH A;  1H4S A;  4YP0 A;  3REX A;  2I4M A;  4H2X A;  4TQD A;  2I4O A;  1B76 A;  3A74 A;  4ZTZ B;  1USY C;  4UPA A;  2E10 A;  4CS3 A;  4G84 A;  3DSQ A;  4CS2 A;  1HTT A;  2ZZF A;  2NS6 A;  1E1O A;  3A32 A;  3QO5 A;  3W3S A;  4G85 A;  3BFM A;  4CH3 A;  4HWP A;  4K86 A;  4YCV A;  2DXU A;  3A31 A;  1X2H A;  5K1P A;  3VQX A;  3QO8 A;  1BIB A;  4WF2 A;  2QHU A;  2DQ0 A;  2AMC B;  2G4C A;  2DEQ A;  4TTV A;  2ALY B;  4XU0 A;  3OD1 A;  1IL2 A;  1Z7N A;  2E64 A;  2PMF A;  4H2Y A;  2Q7E A;  4HWO A;  3QNE A;  2CIM A;  4EO4 A;  1EOV A;  1USY A;  4DPG A;  1LYL A;  4HWS A;  3RKX A;  5K1X A;  4H2U A;  2DVE A;  4P3O A;  3TEH B;  2DJZ A;  5HGQ A;  2ZIN A;  4XEO A;  2DZ9 A;  4H2W A;  4YCW A;  2HNI A;  4HA8 A;  2EWN A;  4UP9 A;  3FJP A;  1RIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...