1RIQA

The crystal structure of the catalytic fragment of the alanyl-trna synthetase
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
457
structure length
448
Chain Sequence
SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGMVPFKNVFLGLEKRPYKRATSCQKCLRVSGKHNDLEQVGYTSRHHTFFEMLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYKDDEEAYRIWNEHIGIPSERIWRLGEEDNFWQMGDVGPCGPSSEIYVDRGEEYEGDERYLEIWNLVFMQYNRDENGVLTPLPHPNIDTGMGLERIASVLQGKNSNFEIDIIFPLIQFGEEVSGKKYGEKFETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAMRFGYKLGIENPFLYKGVDLVVDIMKEPYPELELSREFVKGIVKGEEKRFIKTLKAGMEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDEIAREKGLGIDLEGFQCELEEQRERARKHPVYSHLKELGKTSAFVGAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alanyl-tRNA Synthetase Crystal Structure and Design for Acceptor-Stem Recognition
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Ligase
molecule keywords Alanyl-tRNA synthetase
total genus 152
structure length 448
sequence length 457
ec nomenclature ec 6.1.1.7: Alanine--tRNA ligase.
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1riqA01
1QE0A 4KR2A 4H2YA 3RKYA 1USYC 2FYKA 2HNIA 3QNEA 2I4MA 4P73A 3HXWA 1WYDA 2CIMA 4LNSA 3REXA 4RQEA 2EJFA 4H2VA 3TEHA 3CMQA 3HXVA 2QHVA 3HXUA 4L87A 2DKGA 1WLEA 2E1HA 4RDXA 4KQEA 3L2ZA 1J5WA 1HXDA 3HTZA 3EFSA 4YRJA 1ASYA 3HFVA 3UGQA 3HXZA 2DU5A 2ALYB 2DQ0A 2DXUA 2ZINA 3P8TA 4XU0A 1B70B 1E24A 2I4NA 2ZT7A 4YRQA 1EVKA 4CS4A 4G85A 4KR3A 1QF6A 3RACA 1NJ1A 2ODRC 2ZZGA 2EAYA 1H4QA 4UP7A 3A7UA 4XU3A 2AMCA 4WJ3M 4YRLA 4XU1A 3UGTA 3MF1A 3RF1A 3A74A 3A5ZA 3VQWA 4UPAA 4Q6GA 4XTXA 3V8JA 2EJ9A 3IKLA 3VQVA 1NYRA 2CGHA 2EWNA 1SESA 2ZR3A 3P8YA 5ELNA 3RIRA 1X2GA 3M4QA 3KFUA 1ADYA 3ERRA 2DVEA 4HWRA 1YFRA 3PCOB 2DTIA 4K86A 5F5WA 3UH0A 4DQ2A 3PZCA 4YRNA 1EFWA 2J3LA 1LYLA 4P3OA 4TVWA 1WPYA 2ZT8A 2ARUA 4ZIBA 1RIQA 4WJ4A 2Q7GA 3V7SA 1YGBA 4H2SA 2G4CA 3OD1A 2C7IA 3NETA 2RHSA 1X01A 2E5AA 3HY1A 3RGLA 4O2DA 4P72C 4EO4A 1FYFA 4XTUA 1Z7NA 2DJZA 4YRPA 3L4GB 3EFRA 2ZIOA 4CH6A 4J15A 2AKWA 1EOVA 2Q5HA 2PMFA 1PYSB 4CS3A 2Q7HA 1Z7MA 4YREA 12ASA 4CS2A 2AMCB 3MEYA 1L0WA 3M4PA 2ZT6A 4DPGA 2DXTA 1B7YB 3L1AA 2DEQA 1YFSA 3IALA 5E3IA 1B70A 4XTYA 5KNNA 4YRRA 4YRMA 1NNHA 1BBUA 2CJ9A 4OP0A 1HC7A 5K1XA 4YDQA 4OLFA 4WI1A 4E51A 2ZTGA 4K87A 2DTOA 3LSSA 2Q5IA 2P5IA 2ZZEA 4HWSA 1EQRA 5C51B 4ZTUB 1G51A 4RQFA 2ODRD 3QO8A 3TEHB 2E10A 3TUPA 4YRIA 1USYA 4P74A 2EL9A 3A31A 2E41A 3HXXA 4PHCA 1WU7A 4BWAA 3WQZA 1E1OA 3V8LA 1B8AA 2DDZA 1VQZA 4TVAB 1NYQA 4P75C 3RKWA 4CH5A 3VBBA 3E9HA 1NJ6A 4YCVA 3RUXA 4TQDA 2ZXFA 4Q15A 5C52B 1H4SA 3TEGA 4PG3A 3HRIA 5HGQA 3A7RA 3NEMA 3A7AA 2RHQA 1HTTA 4YPFA 1C0AA 4P3PA 2P0LA 4H2XA 1KMMA 1B7YA 3FJPA 4WF2A 4XTVA 3VQYA 4H2TA 4YP0A 3LC0A 1KOGA 4K88A 2ZR2A 1JJCA 1WNLA 4HVCA 3G1ZA 2DZCA 2J3MA 2XTIA 3W3SA 2DTHA 2ZCEA 4YCWA 4TWAA 3MF2A 3IG2A 2ARSA 1SERA 2IY5A 2Q7EA 4CH4A 4YRCA 1EVLA 1X56A 2I4OA 3HXYA 4P71A 3RKXA 3QO5A 4UP9A 2ZNJA 1N9WA 4XTWA 1ADJA 2ZNIA 4HWOA 2QHUA 1WQ7A 2QHTA 1NJ2A 5C53B 2ZZFA 1H4TA 4XEMA 1JJCB 3A32A 4EX5A 2CJAA 2EJGA 2ARTA 3HRKA 4YRSA 1ATIA 4G84A 4AH6A 3PCOA 1EIYA 3IKMB 4XEOA 4H2WA 2DZ9A 4RMFA 3BJUA 1SETA 1ASZA 3I7FA 4YRFA 4XU2A 4YROA 2IY5B 1X54A 2CJBA 5K1PA 3P8VA 3L4GA 3V8KA 1BIBA 1NJ8A 3QO7A 4YYEA 4TVAA 4BW9A 2I4LA 1GGMA 3NELA 1PYSA 4YRKA 2DQ3A 3BFMA 4ZTZB 3VQXA 4P72A 4TTVA 1G5IA 4TVYA 3HFZA 1YFTA 4HWPA 2DU7A 5ELOA 4P3NA 1H4VB 3V7RA 1W66A 11ASA 2RHQB 3R07A 2ZGWA 3E9IA 4P73C 3A5YA 4YRTA 2ALYA 2ZIMA 1KMNA 1EIYB 2RHSB 2QHSA 4NCXA 3ICAA 1B76A 3UFGA 1WQWA 1BIAA 4H02A 3V7CA 1G5HA 2XGTA 1X2HA 4HWTA 4UP8A 1E22A 4X5OA 1IL2A 4P74C 3HFZB 1NJ5A 4HA8A 2E3CA 2E65A 2PMEA 4YRGA 2E64A 4CH3A 4P75A 4TQFA 3HY0A 4YCUA 1YB3A 3REUA 4XTZA 3QTCA 2ZT5A 1E1TA 1SRYA 3DSQA 1BBWA 1X55A 4H2XB 2C8MA 2AKWB 3NENA 4H2UA 3LSQA 4P71C 3RL6A
chains in the Genus database with same CATH superfamily
1QE0A 4KR2A 4H2YA 3RKYA 1USYC 2FYKA 2HNIA 3QNEA 2I4MA 4P73A 3HXWA 1WYDA 2CIMA 4LNSA 3REXA 4RQEA 2EJFA 4H2VA 3TEHA 3CMQA 3HXVA 2QHVA 3HXUA 4L87A 2DKGA 1WLEA 2E1HA 4RDXA 4KQEA 3L2ZA 1J5WA 1HXDA 3HTZA 3EFSA 4YRJA 1ASYA 3HFVA 3UGQA 3HXZA 2DU5A 2ALYB 2DQ0A 2DXUA 2ZINA 3P8TA 4XU0A 1B70B 1E24A 2I4NA 2ZT7A 4YRQA 1EVKA 4CS4A 4G85A 4KR3A 1QF6A 3RACA 1NJ1A 2ODRC 2ZZGA 2EAYA 1H4QA 2A8EA 4UP7A 3A7UA 4XU3A 2AMCA 4WJ3M 4YRLA 4XU1A 3UGTA 3MF1A 3RF1A 3A74A 3A5ZA 3VQWA 4UPAA 4Q6GA 4XTXA 3V8JA 2EJ9A 3IKLA 3VQVA 1NYRA 2CGHA 2EWNA 1SESA 2ZR3A 3P8YA 5ELNA 3RIRA 1X2GA 3M4QA 3KFUA 1ADYA 3ERRA 2DVEA 4HWRA 1YFRA 3PCOB 2DTIA 4K86A 5F5WA 3UH0A 4DQ2A 3PZCA 4YRNA 1EFWA 2J3LA 1LYLA 4P3OA 4TVWA 1WPYA 2ZT8A 2ARUA 4ZIBA 1RIQA 4WJ4A 2Q7GA 3V7SA 1YGBA 4H2SA 2G4CA 3OD1A 3MQZA 2C7IA 3NETA 2RHSA 1X01A 2E5AA 3HY1A 3RGLA 4O2DA 4P72C 4EO4A 1FYFA 4XTUA 1Z7NA 2DJZA 4YRPA 3L4GB 3EFRA 2ZIOA 4CH6A 4J15A 2AKWA 1EOVA 4LVLA 2Q5HA 2PMFA 1PYSB 4CS3A 2Q7HA 1Z7MA 4YREA 12ASA 4CS2A 2AMCB 3MEYA 1L0WA 3M4PA 2ZT6A 4DPGA 2DXTA 1B7YB 3L1AA 2DEQA 1YFSA 3IALA 5E3IA 1B70A 4XTYA 5KNNA 4YRRA 4YRMA 1NNHA 1BBUA 2CJ9A 4OP0A 1HC7A 5K1XA 4YDQA 4OLFA 4WI1A 4E51A 2ZTGA 4K87A 2DTOA 3LSSA 2Q5IA 2P5IA 2ZZEA 4HWSA 1EQRA 5C51B 4ZTUB 2NS6A 1G51A 4RQFA 2ODRD 3QO8A 3TEHB 2E10A 3TUPA 4YRIA 1USYA 4P74A 2EL9A 3A31A 2E41A 3HXXA 4PHCA 1WU7A 4BWAA 3WQZA 1E1OA 3V8LA 1B8AA 2DDZA 1VQZA 4TVAB 1NYQA 4P75C 3RKWA 4CH5A 3VBBA 3E9HA 1NJ6A 4YCVA 3RUXA 4TQDA 2ZXFA 4Q15A 5C52B 1H4SA 3TEGA 4PG3A 3HRIA 5HGQA 3A7RA 3NEMA 3A7AA 2RHQA 1HTTA 4YPFA 1C0AA 4P3PA 2P0LA 4H2XA 1KMMA 1B7YA 3FJPA 4WF2A 4XTVA 3VQYA 4H2TA 4YP0A 3LC0A 1KOGA 4K88A 2ZR2A 1JJCA 1WNLA 4HVCA 3G1ZA 2DZCA 2J3MA 2XTIA 3W3SA 2DTHA 2ZCEA 4YCWA 4TWAA 3MF2A 3IG2A 2ARSA 1SERA 2IY5A 2Q7EA 4CH4A 4YRCA 1EVLA 1X56A 2I4OA 3HXYA 4P71A 3RKXA 3QO5A 4UP9A 2ZNJA 1N9WA 4XTWA 1ADJA 2ZNIA 4HWOA 2QHUA 4LVJA 1WQ7A 2QHTA 1NJ2A 5C53B 2ZZFA 1H4TA 4XEMA 1JJCB 3A32A 4EX5A 2CJAA 2EJGA 2ARTA 3HRKA 4YRSA 1ATIA 4G84A 4AH6A 3PCOA 1EIYA 3IKMB 4XEOA 4H2WA 2DZ9A 4RMFA 3BJUA 1SETA 1ASZA 3I7FA 4YRFA 4XU2A 4YROA 2IY5B 1X54A 2CJBA 5K1PA 3P8VA 3L4GA 3V8KA 1BIBA 1NJ8A 3QO7A 4YYEA 4TVAA 4BW9A 2I4LA 1GGMA 3NELA 1PYSA 4YRKA 2DQ3A 3BFMA 4ZTZB 3VQXA 4P72A 4TTVA 1G5IA 4TVYA 3HFZA 1YFTA 4HWPA 2DU7A 5ELOA 4P3NA 1H4VB 3V7RA 1W66A 11ASA 2RHQB 3R07A 2ZGWA 3E9IA 4P73C 3A5YA 4YRTA 2ALYA 2ZIMA 1KMNA 1EIYB 2RHSB 2QHSA 4NCXA 3ICAA 1B76A 3UFGA 1WQWA 1BIAA 4H02A 4HT4A 3V7CA 1G5HA 2XGTA 1X2HA 4HWTA 4UP8A 1E22A 4X5OA 1IL2A 4P74C 3HFZB 1NJ5A 4HA8A 2E3CA 2E65A 2PMEA 4LVIA 4YRGA 2E64A 4LVKA 4CH3A 4P75A 4TQFA 3HY0A 4YCUA 1YB3A 3REUA 4LVMA 4XTZA 3QTCA 2ZT5A 1E1TA 1SRYA 3DSQA 1BBWA 1X55A 4H2XB 2C8MA 2AKWB 3NENA 4H2UA 3LSQA 4P71C 3RL6A
chains in the Genus database with same CATH topology
1QE0A 4KR2A 4H2YA 3RKYA 1USYC 2FYKA 2HNIA 3QNEA 2I4MA 4P73A 3HXWA 1WYDA 2CIMA 4LNSA 3REXA 4RQEA 2EJFA 4H2VA 3TEHA 3CMQA 3HXVA 2QHVA 3HXUA 4L87A 2DKGA 1WLEA 2E1HA 4RDXA 4KQEA 3L2ZA 1J5WA 1HXDA 3HTZA 3EFSA 4YRJA 1ASYA 3HFVA 3UGQA 3HXZA 2DU5A 2ALYB 2DQ0A 2DXUA 2ZINA 3P8TA 4XU0A 1B70B 1E24A 2I4NA 2ZT7A 4YRQA 1EVKA 4CS4A 4G85A 4KR3A 1QF6A 3RACA 1NJ1A 2ODRC 2ZZGA 2EAYA 1H4QA 2A8EA 4UP7A 3A7UA 4XU3A 2AMCA 4WJ3M 4YRLA 4XU1A 3UGTA 3MF1A 3RF1A 3A74A 3A5ZA 3VQWA 4UPAA 4Q6GA 4XTXA 3V8JA 2EJ9A 3IKLA 3VQVA 1NYRA 2CGHA 2EWNA 1SESA 2ZR3A 3P8YA 5ELNA 3RIRA 1X2GA 3M4QA 3KFUA 1ADYA 3ERRA 2DVEA 4HWRA 1YFRA 3PCOB 2DTIA 4K86A 5F5WA 3UH0A 4DQ2A 3PZCA 4YRNA 1EFWA 2J3LA 1LYLA 4P3OA 4TVWA 1WPYA 2ZT8A 2ARUA 4ZIBA 1RIQA 4WJ4A 2Q7GA 3V7SA 1YGBA 4H2SA 2G4CA 3OD1A 3MQZA 2C7IA 3NETA 2RHSA 1X01A 2E5AA 3HY1A 3RGLA 4O2DA 4P72C 4EO4A 1FYFA 4XTUA 1Z7NA 2DJZA 4YRPA 3L4GB 3EFRA 2ZIOA 4CH6A 4J15A 2AKWA 1EOVA 4LVLA 2Q5HA 2PMFA 1PYSB 4CS3A 2Q7HA 1Z7MA 4YREA 12ASA 4CS2A 2AMCB 3MEYA 1L0WA 3M4PA 2ZT6A 4DPGA 2DXTA 1B7YB 3L1AA 2DEQA 1YFSA 3IALA 5E3IA 1B70A 4XTYA 5KNNA 4YRRA 4YRMA 1NNHA 1BBUA 2CJ9A 4OP0A 1HC7A 5K1XA 4YDQA 4OLFA 4WI1A 4E51A 2ZTGA 4K87A 2DTOA 3LSSA 2Q5IA 2P5IA 2ZZEA 4HWSA 1EQRA 5C51B 4ZTUB 2NS6A 1G51A 4RQFA 2ODRD 3QO8A 3TEHB 2E10A 3TUPA 4YRIA 1USYA 4P74A 2EL9A 3A31A 2E41A 3HXXA 4PHCA 1WU7A 4BWAA 3WQZA 1E1OA 3V8LA 1B8AA 2DDZA 1VQZA 4TVAB 1NYQA 4P75C 3RKWA 4CH5A 3VBBA 3E9HA 1NJ6A 4YCVA 3RUXA 4TQDA 2ZXFA 4Q15A 5C52B 1H4SA 3TEGA 4PG3A 3HRIA 5HGQA 3A7RA 3NEMA 3A7AA 2RHQA 1HTTA 4YPFA 1C0AA 4P3PA 2P0LA 4H2XA 1KMMA 1B7YA 3FJPA 4WF2A 4XTVA 3VQYA 4H2TA 4YP0A 3LC0A 1KOGA 4K88A 2ZR2A 1JJCA 1WNLA 4HVCA 3G1ZA 2DZCA 2J3MA 2XTIA 3W3SA 2DTHA 2ZCEA 4YCWA 4TWAA 3MF2A 3IG2A 2ARSA 1SERA 2IY5A 2Q7EA 4CH4A 4YRCA 1EVLA 1X56A 2I4OA 3HXYA 4P71A 3RKXA 3QO5A 4UP9A 2ZNJA 1N9WA 4XTWA 1ADJA 2ZNIA 4HWOA 2QHUA 4LVJA 1WQ7A 2QHTA 1NJ2A 5C53B 2ZZFA 1H4TA 4XEMA 1JJCB 3A32A 4EX5A 2CJAA 2EJGA 2ARTA 3HRKA 4YRSA 1ATIA 4G84A 4AH6A 3PCOA 1EIYA 3IKMB 4XEOA 4H2WA 2DZ9A 4RMFA 3BJUA 1SETA 1ASZA 3I7FA 4YRFA 4XU2A 4YROA 2IY5B 1X54A 2CJBA 5K1PA 3P8VA 3L4GA 3V8KA 1BIBA 1NJ8A 3QO7A 4YYEA 4TVAA 4BW9A 2I4LA 1GGMA 3NELA 1PYSA 4YRKA 2DQ3A 3BFMA 4ZTZB 3VQXA 4P72A 4TTVA 1G5IA 4TVYA 3HFZA 1YFTA 4HWPA 2DU7A 5ELOA 4P3NA 1H4VB 3V7RA 1W66A 11ASA 2RHQB 3R07A 2ZGWA 3E9IA 4P73C 3A5YA 4YRTA 2ALYA 2ZIMA 1KMNA 1EIYB 2RHSB 2QHSA 4NCXA 3ICAA 1B76A 3UFGA 1WQWA 1BIAA 4H02A 4HT4A 3V7CA 1G5HA 2XGTA 1X2HA 4HWTA 4UP8A 1E22A 4X5OA 1IL2A 4P74C 3HFZB 1NJ5A 4HA8A 2E3CA 2E65A 2PMEA 4LVIA 4YRGA 2E64A 4LVKA 4CH3A 4P75A 4TQFA 3HY0A 4YCUA 1YB3A 3REUA 4LVMA 4XTZA 3QTCA 2ZT5A 1E1TA 1SRYA 3DSQA 1BBWA 1X55A 4H2XB 2C8MA 2AKWB 3NENA 4H2UA 3LSQA 4P71C 3RL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QE0 A;  4KR2 A;  4H2Y A;  3RKY A;  1USY C;  2FYK A;  2HNI A;  3QNE A;  2I4M A;  4P73 A;  3HXW A;  1WYD A;  2CIM A;  4LNS A;  3REX A;  4RQE A;  2EJF A;  4H2V A;  3TEH A;  3CMQ A;  3HXV A;  2QHV A;  3HXU A;  4L87 A;  2DKG A;  1WLE A;  2E1H A;  4RDX A;  4KQE A;  3L2Z A;  1J5W A;  1HXD A;  3HTZ A;  3EFS A;  4YRJ A;  1ASY A;  3HFV A;  3UGQ A;  3HXZ A;  2DU5 A;  2ALY B;  2DQ0 A;  2DXU A;  2ZIN A;  3P8T A;  4XU0 A;  1B70 B;  1E24 A;  2I4N A;  2ZT7 A;  4YRQ A;  1EVK A;  4CS4 A;  4G85 A;  4KR3 A;  1QF6 A;  3RAC A;  1NJ1 A;  2ODR C;  2ZZG A;  2EAY A;  1H4Q A;  4UP7 A;  3A7U A;  4XU3 A;  2AMC A;  4WJ3 M;  4YRL A;  4XU1 A;  3UGT A;  3MF1 A;  3RF1 A;  3A74 A;  3A5Z A;  3VQW A;  4UPA A;  4Q6G A;  4XTX A;  3V8J A;  2EJ9 A;  3IKL A;  3VQV A;  1NYR A;  2CGH A;  2EWN A;  1SES A;  2ZR3 A;  3P8Y A;  5ELN A;  3RIR A;  1X2G A;  3M4Q A;  3KFU A;  1ADY A;  3ERR A;  2DVE A;  4HWR A;  1YFR A;  3PCO B;  2DTI A;  4K86 A;  5F5W A;  3UH0 A;  4DQ2 A;  3PZC A;  4YRN A;  1EFW A;  2J3L A;  1LYL A;  4P3O A;  4TVW A;  1WPY A;  2ZT8 A;  2ARU A;  4ZIB A;  1RIQ A;  4WJ4 A;  2Q7G A;  3V7S A;  1YGB A;  4H2S A;  2G4C A;  3OD1 A;  2C7I A;  3NET A;  2RHS A;  1X01 A;  2E5A A;  3HY1 A;  3RGL A;  4O2D A;  4P72 C;  4EO4 A;  1FYF A;  4XTU A;  1Z7N A;  2DJZ A;  4YRP A;  3L4G B;  3EFR A;  2ZIO A;  4CH6 A;  4J15 A;  2AKW A;  1EOV A;  2Q5H A;  2PMF A;  1PYS B;  4CS3 A;  2Q7H A;  1Z7M A;  4YRE A;  12AS A;  4CS2 A;  2AMC B;  3MEY A;  1L0W A;  3M4P A;  2ZT6 A;  4DPG A;  2DXT A;  1B7Y B;  3L1A A;  2DEQ A;  1YFS A;  3IAL A;  5E3I A;  1B70 A;  4XTY A;  5KNN A;  4YRR A;  4YRM A;  1NNH A;  1BBU A;  2CJ9 A;  4OP0 A;  1HC7 A;  5K1X A;  4YDQ A;  4OLF A;  4WI1 A;  4E51 A;  2ZTG A;  4K87 A;  2DTO A;  3LSS A;  2Q5I A;  2P5I A;  2ZZE A;  4HWS A;  1EQR A;  5C51 B;  4ZTU B;  1G51 A;  4RQF A;  2ODR D;  3QO8 A;  3TEH B;  2E10 A;  3TUP A;  4YRI A;  1USY A;  4P74 A;  2EL9 A;  3A31 A;  2E41 A;  3HXX A;  4PHC A;  1WU7 A;  4BWA A;  3WQZ A;  1E1O A;  3V8L A;  1B8A A;  2DDZ A;  1VQZ A;  4TVA B;  1NYQ A;  4P75 C;  3RKW A;  4CH5 A;  3VBB A;  3E9H A;  1NJ6 A;  4YCV A;  3RUX A;  4TQD A;  2ZXF A;  4Q15 A;  5C52 B;  1H4S A;  3TEG A;  4PG3 A;  3HRI A;  5HGQ A;  3A7R A;  3NEM A;  3A7A A;  2RHQ A;  1HTT A;  4YPF A;  1C0A A;  4P3P A;  2P0L A;  4H2X A;  1KMM A;  1B7Y A;  3FJP A;  4WF2 A;  4XTV A;  3VQY A;  4H2T A;  4YP0 A;  3LC0 A;  1KOG A;  4K88 A;  2ZR2 A;  1JJC A;  1WNL A;  4HVC A;  3G1Z A;  2DZC A;  2J3M A;  2XTI A;  3W3S A;  2DTH A;  2ZCE A;  4YCW A;  4TWA A;  3MF2 A;  3IG2 A;  2ARS A;  1SER A;  2IY5 A;  2Q7E A;  4CH4 A;  4YRC A;  1EVL A;  1X56 A;  2I4O A;  3HXY A;  4P71 A;  3RKX A;  3QO5 A;  4UP9 A;  2ZNJ A;  1N9W A;  4XTW A;  1ADJ A;  2ZNI A;  4HWO A;  2QHU A;  1WQ7 A;  2QHT A;  1NJ2 A;  5C53 B;  2ZZF A;  1H4T A;  4XEM A;  1JJC B;  3A32 A;  4EX5 A;  2CJA A;  2EJG A;  2ART A;  3HRK A;  4YRS A;  1ATI A;  4G84 A;  4AH6 A;  3PCO A;  1EIY A;  3IKM B;  4XEO A;  4H2W A;  2DZ9 A;  4RMF A;  3BJU A;  1SET A;  1ASZ A;  3I7F A;  4YRF A;  4XU2 A;  4YRO A;  2IY5 B;  1X54 A;  2CJB A;  5K1P A;  3P8V A;  3L4G A;  3V8K A;  1BIB A;  1NJ8 A;  3QO7 A;  4YYE A;  4TVA A;  4BW9 A;  2I4L A;  1GGM A;  3NEL A;  1PYS A;  4YRK A;  2DQ3 A;  3BFM A;  4ZTZ B;  3VQX A;  4P72 A;  4TTV A;  1G5I A;  4TVY A;  3HFZ A;  1YFT A;  4HWP A;  2DU7 A;  5ELO A;  4P3N A;  1H4V B;  3V7R A;  1W66 A;  11AS A;  2RHQ B;  3R07 A;  2ZGW A;  3E9I A;  4P73 C;  3A5Y A;  4YRT A;  2ALY A;  2ZIM A;  1KMN A;  1EIY B;  2RHS B;  2QHS A;  4NCX A;  3ICA A;  1B76 A;  3UFG A;  1WQW A;  1BIA A;  4H02 A;  3V7C A;  1G5H A;  2XGT A;  1X2H A;  4HWT A;  4UP8 A;  1E22 A;  4X5O A;  1IL2 A;  4P74 C;  3HFZ B;  1NJ5 A;  4HA8 A;  2E3C A;  2E65 A;  2PME A;  4YRG A;  2E64 A;  4CH3 A;  4P75 A;  4TQF A;  3HY0 A;  4YCU A;  1YB3 A;  3REU A;  4XTZ A;  3QTC A;  2ZT5 A;  1E1T A;  1SRY A;  3DSQ A;  1BBW A;  1X55 A;  4H2X B;  2C8M A;  2AKW B;  3NEN A;  4H2U A;  3LSQ A;  4P71 C;  3RL6 A; 
#chains in the Genus database with same CATH topology
 1QE0 A;  4KR2 A;  4H2Y A;  3RKY A;  1USY C;  2FYK A;  2HNI A;  3QNE A;  2I4M A;  4P73 A;  3HXW A;  1WYD A;  2CIM A;  4LNS A;  3REX A;  4RQE A;  2EJF A;  4H2V A;  3TEH A;  3CMQ A;  3HXV A;  2QHV A;  3HXU A;  4L87 A;  2DKG A;  1WLE A;  2E1H A;  4RDX A;  4KQE A;  3L2Z A;  1J5W A;  1HXD A;  3HTZ A;  3EFS A;  4YRJ A;  1ASY A;  3HFV A;  3UGQ A;  3HXZ A;  2DU5 A;  2ALY B;  2DQ0 A;  2DXU A;  2ZIN A;  3P8T A;  4XU0 A;  1B70 B;  1E24 A;  2I4N A;  2ZT7 A;  4YRQ A;  1EVK A;  4CS4 A;  4G85 A;  4KR3 A;  1QF6 A;  3RAC A;  1NJ1 A;  2ODR C;  2ZZG A;  2EAY A;  1H4Q A;  2A8E A;  4UP7 A;  3A7U A;  4XU3 A;  2AMC A;  4WJ3 M;  4YRL A;  4XU1 A;  3UGT A;  3MF1 A;  3RF1 A;  3A74 A;  3A5Z A;  3VQW A;  4UPA A;  4Q6G A;  4XTX A;  3V8J A;  2EJ9 A;  3IKL A;  3VQV A;  1NYR A;  2CGH A;  2EWN A;  1SES A;  2ZR3 A;  3P8Y A;  5ELN A;  3RIR A;  1X2G A;  3M4Q A;  3KFU A;  1ADY A;  3ERR A;  2DVE A;  4HWR A;  1YFR A;  3PCO B;  2DTI A;  4K86 A;  5F5W A;  3UH0 A;  4DQ2 A;  3PZC A;  4YRN A;  1EFW A;  2J3L A;  1LYL A;  4P3O A;  4TVW A;  1WPY A;  2ZT8 A;  2ARU A;  4ZIB A;  1RIQ A;  4WJ4 A;  2Q7G A;  3V7S A;  1YGB A;  4H2S A;  2G4C A;  3OD1 A;  3MQZ A;  2C7I A;  3NET A;  2RHS A;  1X01 A;  2E5A A;  3HY1 A;  3RGL A;  4O2D A;  4P72 C;  4EO4 A;  1FYF A;  4XTU A;  1Z7N A;  2DJZ A;  4YRP A;  3L4G B;  3EFR A;  2ZIO A;  4CH6 A;  4J15 A;  2AKW A;  1EOV A;  4LVL A;  2Q5H A;  2PMF A;  1PYS B;  4CS3 A;  2Q7H A;  1Z7M A;  4YRE A;  12AS A;  4CS2 A;  2AMC B;  3MEY A;  1L0W A;  3M4P A;  2ZT6 A;  4DPG A;  2DXT A;  1B7Y B;  3L1A A;  2DEQ A;  1YFS A;  3IAL A;  5E3I A;  1B70 A;  4XTY A;  5KNN A;  4YRR A;  4YRM A;  1NNH A;  1BBU A;  2CJ9 A;  4OP0 A;  1HC7 A;  5K1X A;  4YDQ A;  4OLF A;  4WI1 A;  4E51 A;  2ZTG A;  4K87 A;  2DTO A;  3LSS A;  2Q5I A;  2P5I A;  2ZZE A;  4HWS A;  1EQR A;  5C51 B;  4ZTU B;  2NS6 A;  1G51 A;  4RQF A;  2ODR D;  3QO8 A;  3TEH B;  2E10 A;  3TUP A;  4YRI A;  1USY A;  4P74 A;  2EL9 A;  3A31 A;  2E41 A;  3HXX A;  4PHC A;  1WU7 A;  4BWA A;  3WQZ A;  1E1O A;  3V8L A;  1B8A A;  2DDZ A;  1VQZ A;  4TVA B;  1NYQ A;  4P75 C;  3RKW A;  4CH5 A;  3VBB A;  3E9H A;  1NJ6 A;  4YCV A;  3RUX A;  4TQD A;  2ZXF A;  4Q15 A;  5C52 B;  1H4S A;  3TEG A;  4PG3 A;  3HRI A;  5HGQ A;  3A7R A;  3NEM A;  3A7A A;  2RHQ A;  1HTT A;  4YPF A;  1C0A A;  4P3P A;  2P0L A;  4H2X A;  1KMM A;  1B7Y A;  3FJP A;  4WF2 A;  4XTV A;  3VQY A;  4H2T A;  4YP0 A;  3LC0 A;  1KOG A;  4K88 A;  2ZR2 A;  1JJC A;  1WNL A;  4HVC A;  3G1Z A;  2DZC A;  2J3M A;  2XTI A;  3W3S A;  2DTH A;  2ZCE A;  4YCW A;  4TWA A;  3MF2 A;  3IG2 A;  2ARS A;  1SER A;  2IY5 A;  2Q7E A;  4CH4 A;  4YRC A;  1EVL A;  1X56 A;  2I4O A;  3HXY A;  4P71 A;  3RKX A;  3QO5 A;  4UP9 A;  2ZNJ A;  1N9W A;  4XTW A;  1ADJ A;  2ZNI A;  4HWO A;  2QHU A;  4LVJ A;  1WQ7 A;  2QHT A;  1NJ2 A;  5C53 B;  2ZZF A;  1H4T A;  4XEM A;  1JJC B;  3A32 A;  4EX5 A;  2CJA A;  2EJG A;  2ART A;  3HRK A;  4YRS A;  1ATI A;  4G84 A;  4AH6 A;  3PCO A;  1EIY A;  3IKM B;  4XEO A;  4H2W A;  2DZ9 A;  4RMF A;  3BJU A;  1SET A;  1ASZ A;  3I7F A;  4YRF A;  4XU2 A;  4YRO A;  2IY5 B;  1X54 A;  2CJB A;  5K1P A;  3P8V A;  3L4G A;  3V8K A;  1BIB A;  1NJ8 A;  3QO7 A;  4YYE A;  4TVA A;  4BW9 A;  2I4L A;  1GGM A;  3NEL A;  1PYS A;  4YRK A;  2DQ3 A;  3BFM A;  4ZTZ B;  3VQX A;  4P72 A;  4TTV A;  1G5I A;  4TVY A;  3HFZ A;  1YFT A;  4HWP A;  2DU7 A;  5ELO A;  4P3N A;  1H4V B;  3V7R A;  1W66 A;  11AS A;  2RHQ B;  3R07 A;  2ZGW A;  3E9I A;  4P73 C;  3A5Y A;  4YRT A;  2ALY A;  2ZIM A;  1KMN A;  1EIY B;  2RHS B;  2QHS A;  4NCX A;  3ICA A;  1B76 A;  3UFG A;  1WQW A;  1BIA A;  4H02 A;  4HT4 A;  3V7C A;  1G5H A;  2XGT A;  1X2H A;  4HWT A;  4UP8 A;  1E22 A;  4X5O A;  1IL2 A;  4P74 C;  3HFZ B;  1NJ5 A;  4HA8 A;  2E3C A;  2E65 A;  2PME A;  4LVI A;  4YRG A;  2E64 A;  4LVK A;  4CH3 A;  4P75 A;  4TQF A;  3HY0 A;  4YCU A;  1YB3 A;  3REU A;  4LVM A;  4XTZ A;  3QTC A;  2ZT5 A;  1E1T A;  1SRY A;  3DSQ A;  1BBW A;  1X55 A;  4H2X B;  2C8M A;  2AKW B;  3NEN A;  4H2U A;  3LSQ A;  4P71 C;  3RL6 A; 
#chains in the Genus database with same CATH homology
 1QE0 A;  4KR2 A;  4H2Y A;  3RKY A;  1USY C;  2FYK A;  2HNI A;  3QNE A;  2I4M A;  4P73 A;  3HXW A;  1WYD A;  2CIM A;  4LNS A;  3REX A;  4RQE A;  2EJF A;  4H2V A;  3TEH A;  3CMQ A;  3HXV A;  2QHV A;  3HXU A;  4L87 A;  2DKG A;  1WLE A;  2E1H A;  4RDX A;  4KQE A;  3L2Z A;  1J5W A;  1HXD A;  3HTZ A;  3EFS A;  4YRJ A;  1ASY A;  3HFV A;  3UGQ A;  3HXZ A;  2DU5 A;  2ALY B;  2DQ0 A;  2DXU A;  2ZIN A;  3P8T A;  4XU0 A;  1B70 B;  1E24 A;  2I4N A;  2ZT7 A;  4YRQ A;  1EVK A;  4CS4 A;  4G85 A;  4KR3 A;  1QF6 A;  3RAC A;  1NJ1 A;  2ODR C;  2ZZG A;  2EAY A;  1H4Q A;  2A8E A;  4UP7 A;  3A7U A;  4XU3 A;  2AMC A;  4WJ3 M;  4YRL A;  4XU1 A;  3UGT A;  3MF1 A;  3RF1 A;  3A74 A;  3A5Z A;  3VQW A;  4UPA A;  4Q6G A;  4XTX A;  3V8J A;  2EJ9 A;  3IKL A;  3VQV A;  1NYR A;  2CGH A;  2EWN A;  1SES A;  2ZR3 A;  3P8Y A;  5ELN A;  3RIR A;  1X2G A;  3M4Q A;  3KFU A;  1ADY A;  3ERR A;  2DVE A;  4HWR A;  1YFR A;  3PCO B;  2DTI A;  4K86 A;  5F5W A;  3UH0 A;  4DQ2 A;  3PZC A;  4YRN A;  1EFW A;  2J3L A;  1LYL A;  4P3O A;  4TVW A;  1WPY A;  2ZT8 A;  2ARU A;  4ZIB A;  1RIQ A;  4WJ4 A;  2Q7G A;  3V7S A;  1YGB A;  4H2S A;  2G4C A;  3OD1 A;  3MQZ A;  2C7I A;  3NET A;  2RHS A;  1X01 A;  2E5A A;  3HY1 A;  3RGL A;  4O2D A;  4P72 C;  4EO4 A;  1FYF A;  4XTU A;  1Z7N A;  2DJZ A;  4YRP A;  3L4G B;  3EFR A;  2ZIO A;  4CH6 A;  4J15 A;  2AKW A;  1EOV A;  4LVL A;  2Q5H A;  2PMF A;  1PYS B;  4CS3 A;  2Q7H A;  1Z7M A;  4YRE A;  12AS A;  4CS2 A;  2AMC B;  3MEY A;  1L0W A;  3M4P A;  2ZT6 A;  4DPG A;  2DXT A;  1B7Y B;  3L1A A;  2DEQ A;  1YFS A;  3IAL A;  5E3I A;  1B70 A;  4XTY A;  5KNN A;  4YRR A;  4YRM A;  1NNH A;  1BBU A;  2CJ9 A;  4OP0 A;  1HC7 A;  5K1X A;  4YDQ A;  4OLF A;  4WI1 A;  4E51 A;  2ZTG A;  4K87 A;  2DTO A;  3LSS A;  2Q5I A;  2P5I A;  2ZZE A;  4HWS A;  1EQR A;  5C51 B;  4ZTU B;  2NS6 A;  1G51 A;  4RQF A;  2ODR D;  3QO8 A;  3TEH B;  2E10 A;  3TUP A;  4YRI A;  1USY A;  4P74 A;  2EL9 A;  3A31 A;  2E41 A;  3HXX A;  4PHC A;  1WU7 A;  4BWA A;  3WQZ A;  1E1O A;  3V8L A;  1B8A A;  2DDZ A;  1VQZ A;  4TVA B;  1NYQ A;  4P75 C;  3RKW A;  4CH5 A;  3VBB A;  3E9H A;  1NJ6 A;  4YCV A;  3RUX A;  4TQD A;  2ZXF A;  4Q15 A;  5C52 B;  1H4S A;  3TEG A;  4PG3 A;  3HRI A;  5HGQ A;  3A7R A;  3NEM A;  3A7A A;  2RHQ A;  1HTT A;  4YPF A;  1C0A A;  4P3P A;  2P0L A;  4H2X A;  1KMM A;  1B7Y A;  3FJP A;  4WF2 A;  4XTV A;  3VQY A;  4H2T A;  4YP0 A;  3LC0 A;  1KOG A;  4K88 A;  2ZR2 A;  1JJC A;  1WNL A;  4HVC A;  3G1Z A;  2DZC A;  2J3M A;  2XTI A;  3W3S A;  2DTH A;  2ZCE A;  4YCW A;  4TWA A;  3MF2 A;  3IG2 A;  2ARS A;  1SER A;  2IY5 A;  2Q7E A;  4CH4 A;  4YRC A;  1EVL A;  1X56 A;  2I4O A;  3HXY A;  4P71 A;  3RKX A;  3QO5 A;  4UP9 A;  2ZNJ A;  1N9W A;  4XTW A;  1ADJ A;  2ZNI A;  4HWO A;  2QHU A;  4LVJ A;  1WQ7 A;  2QHT A;  1NJ2 A;  5C53 B;  2ZZF A;  1H4T A;  4XEM A;  1JJC B;  3A32 A;  4EX5 A;  2CJA A;  2EJG A;  2ART A;  3HRK A;  4YRS A;  1ATI A;  4G84 A;  4AH6 A;  3PCO A;  1EIY A;  3IKM B;  4XEO A;  4H2W A;  2DZ9 A;  4RMF A;  3BJU A;  1SET A;  1ASZ A;  3I7F A;  4YRF A;  4XU2 A;  4YRO A;  2IY5 B;  1X54 A;  2CJB A;  5K1P A;  3P8V A;  3L4G A;  3V8K A;  1BIB A;  1NJ8 A;  3QO7 A;  4YYE A;  4TVA A;  4BW9 A;  2I4L A;  1GGM A;  3NEL A;  1PYS A;  4YRK A;  2DQ3 A;  3BFM A;  4ZTZ B;  3VQX A;  4P72 A;  4TTV A;  1G5I A;  4TVY A;  3HFZ A;  1YFT A;  4HWP A;  2DU7 A;  5ELO A;  4P3N A;  1H4V B;  3V7R A;  1W66 A;  11AS A;  2RHQ B;  3R07 A;  2ZGW A;  3E9I A;  4P73 C;  3A5Y A;  4YRT A;  2ALY A;  2ZIM A;  1KMN A;  1EIY B;  2RHS B;  2QHS A;  4NCX A;  3ICA A;  1B76 A;  3UFG A;  1WQW A;  1BIA A;  4H02 A;  4HT4 A;  3V7C A;  1G5H A;  2XGT A;  1X2H A;  4HWT A;  4UP8 A;  1E22 A;  4X5O A;  1IL2 A;  4P74 C;  3HFZ B;  1NJ5 A;  4HA8 A;  2E3C A;  2E65 A;  2PME A;  4LVI A;  4YRG A;  2E64 A;  4LVK A;  4CH3 A;  4P75 A;  4TQF A;  3HY0 A;  4YCU A;  1YB3 A;  3REU A;  4LVM A;  4XTZ A;  3QTC A;  2ZT5 A;  1E1T A;  1SRY A;  3DSQ A;  1BBW A;  1X55 A;  4H2X B;  2C8M A;  2AKW B;  3NEN A;  4H2U A;  3LSQ A;  4P71 C;  3RL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...