4XU2A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 87 with a 3'deoxy ribose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
264
structure length
262
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 90
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu2A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu2A01
1RIQA 2IY5A 3RERA 4X9CA 4M7DF 1USYA 4ZTUB 4M7AB 3PZCA 4P3PA 3HFOA 3JCMc 4C8QG 4HWPA 1FYFA 3M4GA 3JB9I 1ASYA 4YCVA 3V8KA 1G5HA 3REXA 2CJBA 4J6WA 4P74A 4CH6A 4YRLA 1WU7A 3OD1A 2ODRD 4ZIBA 2ZTGA 4P75C 3RKWA 3NELA 2EL9A 3V8JA 2ZZFA 3ERRA 1H4QA 1E1OA 4TVAA 1YCYA 2AKWB 5GMKi 1H641 4F7UG 4M77A 1NJ8A 4YYEA 3A74A 3QO7A 3KFUA 3RACA 1N9RA 1NYQA 2Y90A 5GAMg 4G84A 3LSQA 4PJOG 4H2VA 4M77G 4M78F 2I4MA 4C8QB 4MMLA 4WF2A 3BY7A 2IY5B 4RDXA 5GANg 1KOGA 1D3BA 1USYC 2E41A 2ZCEA 1W66A 5GAN8 4M75D 4C92E 3RIRA 4EMKA 1EVLA 1QE0A 4N0AC 4XTYA 3EFRA 4JRIA 4M7DG 4YRNA 4HA8A 4F7UB 4K88A 3JB9J 2EJGA 2P5IA 5LJ3d 4QVDA 1HC7A 3FB9A 3DSQA 4H2XB 2QHVA 4H2SA 3RKXA 4M7AD 4PJOB 3SWNC 2QTXA 4M77B 3V7RA 4M75E 3JCMb 1EIYB 4C92G 1BBUA 1Y96A 1LYLA 3JCMP 2E5AA 2C7IA 4EO4A 4KR2A 1E1TA 1PYSA 3HXUA 5GAOm 2ZT5A 5GAMj 1X01A 3TEGA 3QO3A 4O2DA 1WQWA 2DZ9A 5GMKm 3HRKA 4P3OA 4M7DB 1D3BB 1LJOA 2ZINA 2ZT8A 3JCMQ 4EMKB 5GANj 4CH4A 5GAMh 3MF2A 4M78G 4J5YA 5LJ3g 4HVCA 2ARSA 2CGHA 3V8LA 3HFVA 4XTVA 2RHQA 4BWAA 5GAOp 2YLCA 4K86A 5GANh 5LJ5g 3LSSA 4H2YA 5ELOA 4C8QD 5I21A 3QNEA 4YRMA 5C51B 4JRKA 1NYRA 2Q5IA 2DXTA 4Y91A 2AKWA 2RM4A 4HWOA 3G1ZA 3HFZA 2FB7A 3UFGA 2I4LA 2RHSA 3RL6A 3HXZA 4BW9A 1HK9A 4J15A 1SESA 3FJPA 3ICAA 1KQ1A 1PYSB 4C8QA 4XTUA 2DZCA 2G4CA 4H2TA 4YRGA 3JCMJ 1QF6A 3NEMA 4ZTZB 4CH3A 4MMKA 2EWNA 3RF1A 4M7AC 1KMNA 2HNIA 3IKMB 3I7FA 3QSUA 4YRTA 4YCWA 4M77D 2RB6A 12ASA 1NNHA 3RGLA 2RHQB 4PHCA 4TVYA 4C92F 2ARUA 5ELNA 4F7UA 1ADYA 1SETA 4XU1A 4YRPA 3NETA 4CS3A 4E51A 4H2XA 4YRRA 4XEOA 4PJOA 5LJ3h 4YREA 1WQ7A 2ZZEA 3HFZB 1EIYA 5LJ3f 2JN0A 5GAMe 2RHSB 3WQZA 4J6YA 4V2SA 4NOYA 4P73A 5LJ5h 3JCMW 3L4GA 1E24A 4H02A 1JJCB 2FYKA 5LJ5f 4J6XA 4M75F 1YFSA 1M8VA 2DDZA 5GANe 1JRIA 4C8QC 4RMFA 2ZR2A 1LOJA 1JBMA 4DQ2A 3P8TA 4M7DA 2Q7GA 2DU5A 4HWSA 2DKGA 5GAN5 1TH7A 4P72A 1H4VB 5GAN4 1X2HA 3QO5A 3HXYA 1NJ1A 2Q7EA 2CJ9A 2ALYA 2K57A 2E3CA 2EJ9A 4RQEA 5GMKh 4WJ4A 1B76A 4P74C 3P8YA 3BDUA 3VQXA 4XTZA 1HTTA 3A32A 4C92A 4YROA 4RQFA 1X56A 2ZZGA 1WPYA 3MEYA 3JB9F 4YPFA 2AMCA 4XU2A 3V7SA 1N9WA 1EVKA 4PJOC 4NL3A 1I81A 4M77C 2QHUA 4TQFA 3L4GB 3VQYA 1IL2A 3JCMd 4P73C 4YDQA 3A7RA 4M78A 4TQDA 1MGQA 1YGBA 4K87A 3GIBA 1NJ2A 4HWRA 2XTIA 2RD1A 2J3MA 4M7AE 4UP7A 2EJFA 3JCMV 3AHUA 4M7DC 5LJ3e 3QTCA 1U1TA 2DQ0A 3L2ZA 4M75G 5E3IA 4EMKC 1EFWA 2ALYB 4Q15A 4YRQA 3UGTA 4YP0A 5LJ5e 3JB9H 3QHSA 2ZGWA 3EFSA 1WLEA 3R07A 2VC8A 11ASA 3M4PA 1B7YA 2ARTA 3IG2A 4C92B 2DXUA 3JCMX 3UH0A 5GAN6 1BBWA 1C0AA 2ZIOA 3JCMg 2AMCB 3UGQA 4M7AG 4PNOA 1G51A 3VU3C 4XU0A 2E1HA 4XU3A 3BJUA 1JJCA 4OLFA 1NJ5A 4XTXA 5GMKe 3JB9G 1EOVA 1E22A 4M78B 1YFTA 4M75B 1Z7MA 4TVWA 4C8QE 4M78C 3VQVA 2ZT6A 3TUPA 2C8MA 5GAOq 3HXVA 2I4NA 4PJOD 1L0WA 1YFRA 1NJ6A 2ZIMA 4G85A 3RKYA 1X2GA 4YRSA 5GAN7 1GGMA 5KNNA 1WYDA 3TEHA 4L87A 2PMEA 5LJ3j 1G5IA 3HTZA 3A5YA 2DTHA 2EAYA 1B7YB 2E64A 3A7UA 4RCCA 5K1XA 2ZNIA 5GAMd 2VXFA 4F7UE 4CS2A 5LJ5j 4XTWA 3HXWA 4NCXA 2CIMA 1HXDA 4N0AA 4DPGA 4M7DD 2J3LA 4PG3A 5GANd 3L1AA 4EMGA 3IALA 4PJOE 4XEMA 3VQWA 3IKLA 4M77E 3V7CA 2ZNJA 3HY0A 3A7AA 1WNLA 4QVCA 5C52B 3HFNA 3FIFA 4P71A 4HT9A 4H2WA 3SB2A 2DEQA 3CMQA 5HGQA 3SWNA 3JCMh 2DVEA 4NL2A 5DY9A 4WJ3M 4JLIA 4C92D 2YLBA 4RCBA 3E9HA 4EX5A 3JCMf 3HXXA 3PGGA 5GMKj 1YB3A 2ZT7A 1SERA 4M7DE 1B70B 4UPAA 4CS4A 2VXEA 1B34A 2DU7A 2I2LA 3TEHB 5F5WA 4M7AF 2CJAA 3BW1A 1I8FA 4EMHA 4OP0A 1H4SA 4M78D 2RA2A 1M5Q1 4YRJA 4KR3A 4LNSA 5GAOr 4A54A 2DTIA 3PCOA 4H2UA 2QHTA 1J5WA 4UP9A 4HT8A 4YCUA 5GAOl 3RESA 1I5LA 4HWTA 1U1SA 4YRKA 4AH6A 5GMKl 3NENA 2ZR3A 3QUIA 5C53B 3REUA 4M75A 3SWNB 4UP8A 4P71C 1H4TA 1SRYA 4TVAB 4CH5A 5CAIA 1KQ2A 4M78E 3W3SA 5LJ5d 4YRIA 3RUXA 3HSBA 4YRFA 1B34B 3MF1A 3JB9D 4C8QF 4P72C 2Q7HA 4Q6GA 4JUVA 2DTOA 1I4K1 2ODRC 3BFMA 3P8VA 4A53A 2QHSA 1ASZA 3QO8A 3VBBA 4M7AA 3HY1A 1BIBA 2DQ3A 5GAOn 3JCMe 4C92C 3E9IA 2PMFA 3HRIA 2ZXFA 3PCOB 4YRCA 5GAN3 5GAN2 2P0LA 3M4QA 5GAMf 1X55A 2I4OA 4F7UF 4P3NA 4P75A 4KQEA 4XQ3A 1EQRA 2E65A 2YHTA 2XGTA 5GANf 3A31A 2Q5HA 1ATIA 4PJOF 1N9SA 4M77F 4X9DA 2DJZA 4M75C 4WI1A 3INZA 2E10A 1KMMA 4TTVA 1Y96B 1B70A 1LNXA 1VQZA 3LC0A 1B8AA 1Z7NA 4TWAA 1BIAA 1X54A 4X5OA 3A5ZA 5K1PA 1ADJA
chains in the Genus database with same CATH superfamily
1OX8A 4J8OA 1MV3A 4M7DF 1QVPA 3HFOA 3LWHA 4LDUA 3JCMc 4C8QG 2RQVA 7AT1B 2DBMA 3V8KA 1G5HA 2DX1A 2EKOA 3T9NA 3CEYA 2A28A 4BI4A 2E6ZA 2ODRD 3CCMQ 2VWFA 4ZIBA 3CPFA 4P75C 3RKWA 1VQ7T 4VUBA 2DIGA 4IIOA 2EGCA 2EL9A 5A0LA 2QGFB 5CCAA 1H4QA 1E1OA 2ZPHB 1VQ4A 2J6KA 2QA4Q 5GMKi 1H641 1QQJA 2X3XD 1RACB 3S3MA 1NYQA 4G84A 3A5ZB 2XDBA 3CQTA 1XNIA 1FXXA 1R8OB 4M77G 2I4MA 2K6DA 4MMLA 2KI7A 3BY7A 1OULA 2KYMA 1I07A 3JRZA 2LCLA 1KOGA 1T3LA 2E41A 4HCCA 3OYDA 4C92E 1W2BP 2RHIA 3RIRA 2A7YA 3CC7A 1AHJB 2MOXA 1QVGA 4PFOA 2M02A 4KH0B 4AFZC 4OGCA 5J39A 2CP0A 2YDLA 1UHFA 1OZ3A 4J9FA 1QVFA 3I56Q 2HZYA 1OEBA 1PC0A 3DSQA 2VGNA 2MMPA 3S3NA 1KSWA 2CP3A 3V7RA 2MF2A 5M9OA 1EIYB 4ELYC 1Y96A 2JM9A 1BU1A 4OMNA 1Q95G 3O5ZA 3EFOA 4C5EA 1IXDA 2D8HA 2DXBA 4MDXA 3TEGA 3MP8A 1RAAB 1K4US 2R57A 4JLGA 3X25B 3HL8A 4P3OA 4QW2A 2ZINA 1D3BB 5GJWB 2E5KA 2LQNA 1UGRB 5GANj 1M3CA 4JS4A 4CH4A 5GAMh 2COZA 3G1JA 2RI5A 4BI8B 1TOVA 4RTUA 3HFVA 3QZ9B 3CMAQ 2EYXA 4ESRA 4L59A 2L3SA 3NFCA 5GJVB 4C8QD 5I21A 3HKSA 2J6FA 1W1FA 1UB4A 4JRKA 2Q5IA 4OGEA 1QP2A 1OPLA 3CC7Q 5IXFA 1BI3A 3OYLA 1PD1A 2FB7A 2DYBA 3DLLA 2NUPB 1RI0A 5FU7C 1SESA 3QJYA 2O2OA 3ICAA 4F16A 1PYSB 4C8QA 3A8LB 4BD3A 4YRGA 4NS5A 3CCMT 1YI2Q 3IQLA 2M51A 5CKDA 2WSFE 1EFNA 4KH1B 2OTLA 2BUDA 3MPUB 4BUGA 1VOMA 4IUUA 2JS0A 1KHCA 1Q82U 4BE2A 3M59A 2QA4T 3IKMB 3I7FA 3QSUA 4YRTA 4M77D 1QKXA 1VIEA 2RHQB 5J3BA 4PHCA 4IKFA 2LJ3A 1EZZB 2EQMA 1UE9A 2D8JA 2BE7D 1SG5A 3VS0A 4C92F 1ZA2B 4E6RA 1SETA 1F1BB 4YRPA 2DYIA 3OYNA 2YXYA 4E51A 4YRRA 1WQ7A 3EGDB 2ZZEA 1X6OA 1WJSA 1WJQA 4J6YA 3JCMW 1IGQA 1WLPB 4JDSA 1YHQA 1E24A 3L4GA 2FYKA 1YFSA 3FJ5A 2CT4A 4OB3B 3PMTA 3NPFA 4C8QC 1ZSZB 2QTVA 1JBMA 1KD1R 3I56T 2DL7A 1SRMA 2J05A 2DU5A 2DKGA 1AWXA 2LRQA 2Q7EA 2ALYA 2K57A 4E7KA 4R0KA 3MEWA 3CCEA 3CCVQ 2MI6A 3H9NA 5GMKh 1B76A 4P74C 3P8YA 3BDUA 3VQXA 1Y57A 1HTTA 3A32A 2OTLQ 4FW1A 4RQFA 3VV0A 3G4SA 3CC4Q 2ZZGA 5D6WA 4ZN3A 4QQ6A 3VKIA 4OMLA 4YPFA 4YTLA 2AMCA 5HCKA 1OYXA 3V7SA 1N9WA 3SHWA 4M77C 2G6FX 2KMTA 3E2UA 2QHUA 1AZGB 4CC3A 4TQFA 2VKNA 4FCYA 1IL2A 3URGA 4J7IA 1Y7XA 3CMAT 1ZBXA 5I2SA 1M27C 4D8KA 4MZTA 1WHKA 1QLYA 4K87A 1IHVA 3CCQQ 2ZZDA 2EGEA 5KYWB 2OAUA 1NJ2A 4HWRA 2J3MA 5FW9A 4F17A 3CC7T 2E5QA 1U1TA 1M1KU 2QK0A 3MJXA 5E3IA 2XICA 1WDXA 2EGAA 1QVGP 3TVTA 4YRQA 2O88A 2EQUA 1WGSA 2QQRA 2ZGWA 3NTHA 1NPRA 4DOVA 4QKUA 1YIJQ 3M4PA 2PTKA 3IG2A 2C06A 2FRYA 1YI2T 4Z89A 2MAMA 2RHYA 1QVFP 4J7FA 3OS5A 2CS7A 2NUTA 1NEGA 2ZIOA 3CC2A 2O01E 1T0HA 2A3LA 5I11A 4F14A 2ECZA 1Y0MA 2QQAA 4OLFA 3JB9G 1GCPA 4M78B 4JJCA 3G4SQ 4E7SA 4GBQA 1M2VB 4C8QE 1LCKA 1ZUUA 1VQ9Q 1TXQA 5GAOq 1SKUB 4FYVB 4LDYA 4PJOD 1YFRA 3RKYA 2K9GA 4JJBA 1RI9A 2JM8A 1WYDA 1TWBA 2PMEA 1G5IA 3HTZA 3M0RA 1SPKA 4BY6B 2DTHA 2OTJQ 2X35A 4OMOA 2ZCFB 2VXFA 4CS2A 2LJ1A 4XTWA 1PM3A 4NCXA 1UGSB 2VV5A 1FX7A 4M7DD 2J3LA 2QEXQ 8ATCB 2LVMA 3SFMA 1GFDA 3IKLA 4M77E 4EPCA 2ZNJA 1VQPA 1KC8C 1VQ8A 2GTJA 1X69A 3A7AA 3CCVT 1WNLA 3M0SA 4IURA 5C52B 1M90R 3FIFA 2HAXA 4H2WA 4FYXB 1HYOA 2VYTA 3JCMh 2CUBA 2OTLT 3VUBA 4NL2A 4LVJA 5KYXB 4CRIA 4RCBA 2JS2A 3CC4T 2HBPA 3GP8A 3QIIA 1B34A 2DU7A 3P8BB 2CP2A 4J9DA 4ATOA 2OI3A 1UHCA 1QWEA 1YJWA 2EW3A 1I8FA 2RHXA 3FC3A 2GTOA 3CCQT 4YRJA 3WVDB 2DA9A 4HWTA 1S72A 3A98A 2ZR3A 2V1RA 3SWNB 4UP8A 3MP6A 4A4GA 1VQNA 3HP9A 3VYHB 3W3SA 4YRIA 3SEMA 2KVQG 1JO8A 1PSFA 3M0TA 2LNVA 3JB9D 4C8QF 2E70A 4AG2C 2RQUA 4RKUE 2BTTA 2DLPA 2KY9A 2XHCA 1ASZA 3QO8A 1AWWA 2ZPEB 3HY1A 1BIBA 2AK5A 3BDLA 5KYUA 3G4ST 1UTIA 3E9IA 1W2BS 2FZGB 2GBQA 2ZXFA 2L3QA 1VQ9T 3PCOB 1ZQ1A 4A4EA 4FSXA 3M4QA 2A0FB 1UEBA 2JJ9A 4P3NA 2QASA 4IUPA 1N27A 3WVEB 4KUDK 4XQ3A 2E65A 1M2OA 1YN8A 2KSSA 4OMFB 3NTIA 3A31A 2OTJT 4OB0B 2RF0A 4M77F 2ZPGB 3OYKA 4EIKA 1K8AC 1KMMA 2ARUA 1UGQB 1LNXA 4B9XA 1VQZA 3LC0A 5EG2A 3WXMB 2QEXT 2P4RA 4TWAA 3DB3A 4DOWA 1X54A 4X5OA 2K4YA 4J9CA 2PVGB 3A5ZA 1RIQA 1OV3A 1G3SA 2DM1A 3RERA 4X9CA 5FWBA 1NG2A 1HSQA 2V26A 2EBPA 2V8IA 4XK8E 4HWPA 3JB9I 1ASYA 4YCVA 5LL6S 2CJBA 4CH6A 4JRQA 1YJNA 4L6V5 4YRLA 1MV0B 2A36A 3HTRA 2LQ8A 4Z8AA 1ZHIA 2JNGA 3L2QA 3PIOA 2K7AA 2RJCA 4TVAA 2P4TA 2C0TA 2LMJA 3A74A 2KXCA 3RACA 1N9RA 4KGVB 3CCJA 5GAMg 2CZ1B 3LSQA 2DBKA 1X27A 1VQ5A 1YP5A 4WF2A 2IG0A 5KE3A 4RDXA 1TUGB 1D3BA 2GQVA 2O4XB 2YUPA 4CC2A 1KQSA 4O5VA 1FYNA 3PTAA 1EVLA 5CKBA 1VQOA 1TSFA 1QE0A 4N0AC 3L2WA 3EFRA 4JRIA 1PNJA 2YSQA 2HKNA 2YRVA 4YRNA 2EYWA 4F7UB 4K88A 3JB9J 1IB8A 2DL4A 2EJGA 2FPEA 3CCUA 1VQKQ 2RNAA 3VS7A 3GLXA 1EX4A 5FU6C 5CR2A 4H2XB 1JJ2A 3J81E 4H2SA 1M8MA 3RKXA 4M7AD 4PJOB 2QTXA 3JCMb 4ZGDB 1TS9A 4JZ4A 2PU9B 2ED0A 5FRNA 1ZA1B 1YJ9A 1BBUA 4A4FA 2JTEA 5IN1A 2HQHA 1WXUA 2CZ0B 1RABB 1PYSA 1BBZA 1Y07A 2VASA 1YJWT 4RG2A 1X01A 2FG0A 5GMKm 3HRKA 4M7DB 2R58A 5IH2A 1Q81C 4EMKB 2V8JA 4J9IA 4M78G 3OYEA 5IHIA 1SSFA 2CGHA 4ZNXA 4FW2A 4CC7A 2RHQA 1VQ5Q 4BWAA 5GAOp 2YLCA 1S72T 3A1PA 2SRCA 1VUBA 3L2UA 3LSSA 2DO3A 3QNEA 1YITA 2C0IA 3MO8A 4YRMA 5C51B 1NYRA 1BB9A 4Y91A 2AKWA 1JEGA 3G1ZA 2RI3A 1R0CB 2FPFA 5D7UA 2JTMA 1AD5A 1HK9A 4J15A 3TSZA 2HD0A 4R56A 1KD1U 1KQ1A 1P92A 2DEUA 1B7TA 3NEMA 1VQLA 2HL3A 2DETA 1ZSZA 1RAHB 2EWNA 2MK5A 3M4YA 1T3SA 2BIVA 2MIOA 4M7AC 1KMNA 1D1BA 1NJIU 2HNIA 1YJ9Q 4YCWA 3KXTA 2RK2A 1R0BG 2KDSA 2NS6A 3RGLA 2GQIA 1X2KA 4FIBA 4TVYA 1ADYA 2LP5A 3MHXA 2KT8A 1RLPC 1Q86R 4L5GA 4LE9A 4BE1A 3NETA 1QVFS 3CXCA 4Z02A 5I22A 4YREA 2K2MA 4Y28E 4PLIA 5LJ3f 3WQZA 4H02A 3LW5E 1JJCB 3CBOA 5LJ5f 1ZUKA 3PVQA 4J6XA 1AOJA 5GANe 3OMCA 1YITQ 1BCOA 3CD6Q 1CSKA 4RMFA 1VQKT 3JV3A 1LOJA 3QJ6A 3LGFA 4LN2A 1RAFB 2COWA 1N5ZA 4FYYB 5GAN5 1TH7A 3MEVA 4J9BA 2A37A 1X2HA 3HXYA 3VS6A 3C0CA 1NJ1A 3FDRA 1FMWA 2LT4A 2DD4A 1WHMA 2EJ9A 4WTOB 3M55A 2ABLA 4E7LA 4JRPA 1W6XA 2QQ9A 3QXEB 1YCSB 3ZL7C 4B9WA 3M0PA 2IPOB 4J9EA 3CCLA 1T0JA 3THKA 1WPYA 2EPDA 1K73R 3JB9F 1K76A 4C5IA 3EG3A 2SEMA 2PVDB 4C0DB 3E19A 1H3HA 2H8HA 1NE8A 3CCSA 2QXFA 4OB2B 3JCMd 1VQ5T 1WXBA 4YDQA 1Q86C 3UPUA 3A7RA 4M78A 4TQDA 1MGQA 1YGBA 1VQ4Q 3OYFA 2DJQA 2E12A 2XTIA 2RD1A 4UP7A 4M7AE 1KQSP 3CMEA 5LJ3e 4KGXB 3QTCA 2GNCA 4M75G 3CBMA 1EFWA 2DXCA 3OB9A 1OI1A 2LTOA 4Z88A 5LJ5e 4MZPA 3QHSA 2MWPA 2PUOB 1JB0E 1WXTA 3TCJA 4C92B 1MUZA 3OBWA 2DXUA 2J6OA 3JCMX 3S6WA 2CUDA 2K5LA 5GAN6 1CKBA 1BBWA 1JJ2P 1C0AA 3JCMg 1UFFA 6AT1B 3X24B 2IVWA 2A8EA 1YJ9T 3PFSA 1M90U 2L0AA 4J9HA 1AWJA 3VU3C 3BJUA 1GCQA 3DB4A 2XU8A 3OSVA 4XTXA 5CK9A 2NLUA 3OW2P 3OMGA 2HEQA 2E3HA 1H8KA 4TVWA 1K73C 1I1JA 2LC4A 4M78C 2DD5A 5KYXA 4OMPA 4OVAA 5C0MA 2C8MA 2HMAA 3HXVA 1L0WA 2ZIMA 2Y4XA 1G5VA 1E6GA 5CIUA 2D6FA 5GAN7 1O9SA 2AIRB 2DAQA 5KNNA 4L87A 4ANJA 3CBPA 3EG0A 5LJ3j 2K3YA 3A5YA 2AZVA 1B7YB 4PFPA 2X4WA 3E9FA 5K1XA 1SF9A 4BY6C 3VS3A 1YITT 1PRMC 3MEUA 5LJ5j 2HSPA 3CD6T 2ROTA 1SHGA 3CMEQ 1M1FA 5GANd 4EMGA 2L8DA 1MNEA 3IALA 3VQWA 3V7CA 4E7IA 2ATCB 4RG8A 3HY0A 3EG1A 3GOXA 3MQZA 1C1AA 2DEQA 3SB2A 3CMQA 2DL3A 3SWNA 5HGQA 2KAFA 5DY9A 4JLIA 3VUZA 1PWTA 2EQIA 3RBBB 4EX5A 2ZT7A 2YRCA 1YBYA 1SERA 1W70A 1JQQA 1AEYA 2DRKA 3OYYA 4FU6A 2X4YA 1YNZA 4D6WA 4M7AF 2L5QA 2NYSA 2K3BA 4OP0A 3REBB 4GLKA 2D0NA 1VQ4T 3R6NA 1M3BA 3CXCP 4KR3A 2MYSA 2D0QB 2O9VA 2K79A 4LD6A 3PCOA 1X6BA 2B8AA 1J5WA 2DVJA 2JOYA 3UF4A 4HT8A 3E1SA 2EYZA 4YRKA 3GF5A 4E7ZA 1MMAA 2L3RA 4N4GA 3NENA 2YUNA 3U23A 3REUA 4M75A 1B3QA 4CH5A 3QBYA 5CAIA 4M78E 3X20B 5LJ5d 8AT1B 4YRFA 3JSCA 1UG1A 1K0SA 1YHQQ 4Q6GA 1N6AA 4JUVA 2DTOA 1I4K1 3I55A 1KC8R 3BFMA 2KROA 1QW1A 1GL5A 2P84A 3VS4A 2B86A 3VBBA 2JMCA 2AKLA 3CCLT 1YWOA 4ZN1A 1WA7A 1IHWA 1XTDA 4KT0E 5GAN3 2RN8A 3QDRB 3OY9A 3CCEQ 5GAMf 1IREB 1K1ZA 3UA6A 1KFZA 3RR6A 1EQRA 3NGPA 1ABOA 2QYZA 2GCXA 3NTKA 4A4KA 1ZLMA 2HBWA 2HL5C 4M75C 3VS2A 4WI1A 2QGGA 3INZA 5FU7B 4E2FB 3CMET 1Y96B 1B70A 2E4HA 1D09B 1B8AA 3EFOB 2KGTA 2JMAA 2RO0A 4MDWA 3H6ZA 2RQRA 2YT6A 1NLOC 1USYA 3PZCA 3META 4ZTUB 2P0PA 1FMKA 4P3PA 2O4XA 4OMQA 1FYFA 3M4GA 1QCNA 2LNHB 1VYUA 4X34A 3REXA 1VIFA 3EG9A 4LVIA 2DRMA 5HK0A 2DF6A 3G6EA 1WU7A 3OD1A 4AT1B 2HSEB 2KE9A 3LLRA 4BI3A 2EYYA 3TU4K 2ZTGA 3TREA 1WIEA 3LH5A 2FHDA 3V8JA 1BI1A 3ERRA 2YRDA 1FWZA 3OSSC 2F5TX 1YCYA 4CC4B 4ZTFA 3CC2Q 2ESWA 1LVKA 1NJ8A 3OYIA 4YYEA 3I5SA 4OF1A 3KBGA 2Y90A 3GBQA 3CCRA 5IT9E 5HKCA 4M78F 4C8QB 2CZ6B 4IIMA 5K1PA 2IY5B 3EAEA 4UC4A 1VA7A 2E6NA 3EHRA 2XI9A 3L2VA 1USYC 2ZCEA 1W66A 4Y92A 1K0XA 3G71A 4EMKA 2PNIA 1K8AR 4IUTA 2JTFA 5KYYB 1YHQT 1XQHA 4KBMB 2RPNA 1HC7A 1NEBA 4FT2A 3C4SA 3FB9A 2QHVA 4KULA 1BI0A 1LPLA 4M77B 4M75E 4GY5A 4C92G 2H3EB 4B6MA 1LYLA 2DE0X 1V76A 3JCMP 3G6EQ 1VQPQ 1VQ8Q 3UATA 1KK7A 4RUGA 2E5AA 4OMMA 3CCET 1ABQA 2DK3A 5GAOm 2ZT5A 5GAMj 1UUEA 1HJDA 1E7OA 3OYAA 3QO3A 4O2DA 1WQWA 2DZ9A 1LJOA 1AZEA 2ZT8A 1BI2A 1QCOA 2X4XA 3MF2A 4J5YA 2L89A 3CCRQ 3LH0A 4C5HA 2XIDA 2QG9B 1TUDA 4DBRA 1YJWQ 4ZTJA 1NZ9A 3H41A 5GANh 2ED1A 4A4HA 4K86A 2QI2A 2LDMA 1IRXA 4H2YA 4N4IA 1M4ZA 2CH4W 1AWOA 1KG1A 1M3AA 4PJJA 2DXTA 4DBQA 4HWOA 2AZSA 2PUKB 3UFGA 1RAGB 4CI0C 2QQBA 2I4LA 3OYGA 3HXZA 4BW9A 1S72Q 5KE2A 3FJPA 2G3RA 3H0HA 2W0ZA 4XTUA 2G4CA 4H2TA 4ZTZB 1VQ7A 1VQNQ 2EVRA 3JAME 4MMKA 2NWMA 3RF1A 3O8VA 3CC2T 1KQSS 2GGRA 5FROA 1G2BA 4K11A 12ASA 4II1A 3SD4A 3LYIA 3OYJA 1WZOA 5ELNA 2XDPA 2F1LA 1Q7YR 2XKOC 2ZPIB 2F2VA 2NUTB 5LJ3h 3CPWA 3NHNA 2LX9A 1Q81R 3HFZB 1EIYA 2JN0A 1MMGA 1H92A 2RHSB 4V2SA 2XK0A 1PCXA 1TG0A 5AT1B 5LJ5h 4P73A 5D6YA 2J7IA 2RH2A 4M75F 1M8VA 3OW2S 1HD3A 1EIFA 1DJ7B 1JRIA 2DILA 2ZR2A 3P8TA 2Q7GA 4RTWA 3PT9A 3UDCA 3BE3A 2L3PA 4P72A 5CO7A 5GAN4 2X4JA 3Q1JA 1OOTA 3L42A 4O6JA 2E3CA 3G6ET 1VQPT 1VQ8T 3C95A 1PSEA 4RQEA 2HQEA 2O31A 1VQ6A 2FPDA 4PJLA 4TVRA 5DM7R 2DL5A 2HCKA 4C92A 2GFAA 4LD9K 3M9QA 1X56A 3H8ZA 2KR3A 2KBTA 4AMCA 2RK1A 2AKKA 4XU2A 4ZGEB 4NL3A 1I81A 1YJNQ 2NUPA 2DMOA 3PNWC 4ZGJB 2LJ0A 4LDWA 1FMVA 3CCRT 1ARKA 2DNUA 4JJNK 3UT1A 4P73C 3J80E 1Q7YC 1D0YA 2WACA 3ME9A 2QQSA 2ROLA 3LGLA 2LCSA 3VRZA 4N4HA 4JZ3A 3G71T 3AHUA 3OYMA 2QDYB 3CCJQ 3L2ZA 3OYBA 2EQJA 3UGTA 3EHQA 3HRTA 1WHHA 4PJNA 3JB9H 4J9GA 1G3TA 1ZX6A 1VYTA 5KYNA 3R07A 2PZ1A 3CCMA 1B7YA 2ARTA 3VRYA 1UGPB 1VQNT 2W10A 3LWIA 3CXCS 1UECA 1VQOQ 2QA4A 2X3WD 3EGDA 3FRNA 3F70A 1G51A 4JPBW 4XU3A 2E1HA 2HDAA 1VQ6Q 4HVUA 1K9MR 4DEXA 2IIMA 1NJ5A 3CCUQ 2E3IA 1IO6A 1NYGA 1TTHB 2JZ2A 1Z7MA 2D1XA 1IGUA 1RLQC 2CKKA 2ZT6A 3M0QA 4C5GA 3C12A 4IUVA 5I2MA 3SDZA 1NJ6A 4LUDA 1IZ6A 2P0KA 1QVGS 4YRSA 3EGXB 1GGMA 1JXOA 2GFUA 2EAYA 2E64A 3A7UA 3LX7A 4RCCA 2AT1B 3DKMA 5KYUB 3VS5A 3I56A 4PFZA 2CIMA 1HXDA 4DPGA 2MCNA 2CP7A 4DEYA 4QQGA 3OBYA 1QMCA 2FL7A 1D0ZA 4AFSC 1M1GA 3HRUA 4F04B 4P71A 4HT9A 2LCCA 2R5MA 5CQXA 4WJ3M 1AVZC 4HVVA 5KYWA 3E9HA 1E6HA 3PGGA 1G8XA 1ZSZC 3H0FA 4RMOA 1KC8U 2OJ2A 4UPAA 2VXEA 1K9MC 1YJNT 3I35A 2C0OA 4JJDA 3TEHB 1C6VX 3HHTB 2F69A 4XAXB 3CMAA 1VQLQ 3E9GA 4HVWA 2CJAA 4EMHA 2VGMA 3OS0A 1H4SA 4MZMA 4M78D 2RHZA 3MCAB 5CKHA 3ZFJA 5GAOr 3PE0A 5A0GA 4A54A 1BKBA 3CPWP 3PIPA 4H2UA 2QHTA 1GBRA 3CCJT 4YCUA 1GFCA 1JXMA 3RESA 1U1SA 2ZAEA 3J7AF 5GMKl 5FU6B 4PJMA 3QUIA 1PKTA 1YI2A 1M2VA 4P71C 1H3ZA 1H4TA 4TVAB 1KQ2A 4QQDA 4HCBA 3TEEA 1WJRA 3OYCA 2FEIA 3RUXA 1WHGA 1VQOT 3S3OA 3HSBA 1SHFA 4A63B 5C6SA 4JS5A 2CDTA 2JT4A 3QYGB 3OYHA 2ODRC 4A53A 1VQ6T 2XG8D 3MKDA 3M57A 4LUEA 3CCUT 2RQTA 2L2PA 4E7JA 2XMFA 1GXIE 2VB6A 2PMFA 3HRIA 1D0XA 2CYZB 4BDZA 3OA6A 2Z0WA 4BDYA 5D6XA 2HQXA 1O75A 1G3WA 2PVOB 1QP3A 3CCLQ 4IUQA 1B07A 2Q5HA 1ATIA 3MEAA 3GPLA 4X9DA 1GBQA 1OU9A 3RDVA 1NPPA 2FO0A 2E10A 2KYBA 2X51A 2GF7A 1SEMA 3CCSQ 1BIAA 2CT3A 1G3YA 4ME7A 3G7ZA 5CQYA 2ENMA 3CCVA 2IY5A 1RL2A 1PHTA 3ASKA 4LDVA 4M7AB 1K8AU 5HY6A 3M0UA 2D9TA 2ZPFB 4HCZA 1I5OB 3CC4A 4HCKA 2JVVA 3P8DA 1TU0B 1K9AA 4RTTA 3ZEHA 2K5IA 4C0ZA 4KRTA 1RADB 4J6WA 4P74A 5KYYA 1YFNA 2CP5A 2CZ7B 3A8GB 3GNFB 1GCQC 3A8OB 3NELA 1OU8A 4FT4A 4DA4A 1VQLT 4RTYA 2EYQA 2ZZFA 4ELZC 1W4SA 3CCQA 2AKWB 1GRIA 4AG1C 4F7UG 4M77A 4C0FA 1MNDA 3QO7A 3KFUA 2LQKA 1WHLA 2O9SA 4PJOG 4H2VA 1X43A 3QWYA 5HK3A 1YIJA 1U5SA 5GANg 1N8RR 1MMDA 5GAN8 4M75D 2MPXC 4KUIA 2YWWA 4Q5WA 2F2XA 4XTYA 1U8RA 5KCHA 2RJFA 4M7DG 1Z9ZA 1BK2A 4HA8A 1NJIR 1X75C 2JXBA 1XJWB 4PL6A 2P5IA 5LJ3d 5ECAA 4QVDA 4E7HA 3X26B 1BCMA 2Y4YA 3SWNC 1VQ9A 4KGZB 4HT4A 1M30A 5J26A 1QKWA 2C7IA 5FLXE 4EO4A 4KR2A 2CSQA 1E1TA 4LVMA 3HXUA 3M5AA 1ZSGA 3KFVA 1CKAA 2OTJA 4EDUA 2M0OA 3AT1B 2XDDA 4GLMA 1PKSA 3JCMQ 3FEOA 5CVIA 3ER0A 5DLOA 5LJ3g 2QEXA 3QDFA 4HVCA 1Q7YU 2ARSA 3V8LA 4XTVA 3CCST 2BZYA 5LJ5g 3A8MB 1Q81U 3H0IA 5ELOA 1KD1C 1N8RC 2QAZA 1OPKA 2M9UA 2RM4A 2DL8A 4D8DA 3HFZA 2RHSA 3RL6A 4BACA 1NJIC 5L23A 2K5FA 2H3JA 4FM4B 2DZCA 1QF6A 3JCMJ 2HKQB 3QG1A 1VQMA 4CH3A 2J06A 5L8RE 2K3XA 4DBHA 3TSWA 1I0CA 3GNGA 2K2VA 2M1HA 2EIFA 2RB6A 2DPPB 5CKEA 1NNHA 3I55Q 4RTVA 3UWNA 4AFUC 4OB1B 4DBFA 2KT1A 4F7UA 1TUCA 3VJPA 3TQ7P 4XU1A 4LNPA 3X28B 4CS3A 4H2XA 2A08A 4XEOA 3I9QA 4LDXA 4PJOA 1ZUYA 2EFIA 1NYFA 2COYA 3HRSA 5GAMe 2JW4A 4NOYA 1QWFA 1V29B 4FYWB 2NUZA 1MHNA 2DDZA 5IXBA 1WYXA 2V8KA 3RNJA 1RAEB 1NLPC 4LXCA 4DQ2A 4M7DA 3EH2A 1C0MA 1WFWA 4R55A 4HWSA 4C0GA 1Z9QA 3M53A 2I0NA 1H4VB 3QO5A 5A0DA 1BYMA 2CJ9A 1X2QA 3QPHA 2KQWA 1KHIA 1Q82R 2WSEE 4WJ4A 1M9SA 1J3TA 2LQWA 1S1NA 4XTZA 1G83A 5AYFA 1VQMQ 9ATCB 4YROA 2CREA 3MEYA 3EGUA 1ACMB 1D1AA 4M4ZA 3REAB 1K9MU 1SSHA 3P8HA 1EVKA 4PJOC 2CP6A 3L4GB 3VQYA 3QWXX 2OX7A 4AFQC 4QVZA 3UA7A 1YIJT 2R5AA 2V1QA 1AT1B 2YUQA 3GIBA 1U3OA 1ZBJA 2EJFA 3M58A 3JCMV 3PMIA 4M7DC 5EC7A 2DQ0A 2MWOA 4EMKC 2YUOA 1Q86U 2ALYB 4Q15A 2FZCB 3EGXA 4YP0A 5KH6A 1M90C 3EFSA 3QYHB 4FL6A 1WLEA 2VC8A 11ASA 4J83A 1JU5C 3I5RA 3PVLA 1D1CA 3UH0A 3G71Q 2DERA 4LVLA 5CKFA 2AMCB 3UGQA 3ZBDA 3CPWS 2KRNA 4M7AG 1PRLC 4PNOA 1Q82C 2KK4A 4XU0A 2OAWA 1JJCA 2CH4A 3I55T 1XOVA 5GMKe 1EOVA 2BZXA 1E22A 5A2QE 2KRMA 3A8HB 1YFTA 1UGVA 4M75B 4RTZA 3OS2A 3VQVA 4RTXA 3C94A 3TUPA 2RQWA 2I4NA 4G85A 3FLGA 1UJYA 1X2GA 2QDLA 2BZ8A 2RHUA 3TEHA 2VUBA 2FVUA 2KEAA 1K73U 2AHJB 1M1KR 2P0QA 4ORZA 2ZNIA 5GAMd 1VQKA 4F7UE 1W2BA 4P5NA 3HXWA 2RMOA 4LVKA 3M56A 4N0AA 1JJ2S 3L2RA 4PG3A 1U06A 3R6OA 1SRLA 3KUFA 3L1AA 4XEMA 4PJOE 1YWPA 3ULRB 2KNBB 2DIQA 5FWCA 5FRMA 4BE0A 4QVCA 2LZ6B 3HFNA 1VQMT 2DVEA 2CSIA 4C92D 1RAIB 2YLBA 3N5BB 3JCMf 3HXXA 1YB3A 5GMKj 4PK4A 2LX7A 3EG2A 4M7DE 1B70B 1KJWA 1PG5B 1X6GA 4CS4A 2RJEA 2WSCE 2ZPBB 2I2LA 1NM7A 2BKDN 5F5WA 3RMSA 1VQ7Q 5IAYA 1WX6A 2RI2A 3BW1A 1A0NB 2JUFA 2RA2A 1M5Q1 4LNSA 4BB7A 2FZKB 2DTIA 5KCOA 2LT1A 4C0DC 3EG9B 4UP9A 4PLLA 5GAOl 2F2WA 1NBEB 1I5LA 1M1KC 2DFUA 1OX9A 4AH6A 1R77A 1WHJA 5C53B 2VVKA 1KIKA 3EH1A 1SRYA 4HXJA 4E47A 1UJ0A 3HPWA 2F5KA 4PKCC 2X9HA 1B34B 3MF1A 4WCIA 1UDLA 4P72C 2Q7HA 3VS1A 3OW2A 1OZ2A 1PD0A 2RJDA 3P8VA 2QHSA 4HKEA 1WI7A 2XD0A 4M7AA 5IHNA 2DQ3A 1Y71A 1QCFA 2PQWA 5GAOn 3JCMe 4C92C 3VYGA 1OQKA 5IHKA 2M16A 5DLQE 2KRSA 4YRCA 2M0YA 5GAN2 2P0LA 3MP1A 1X55A 2I4OA 4F7UF 4P75A 1V1CA 4KQEA 2BE9B 3QZ5B 2EKHA 3OQ5A 2YHTA 3QKJA 2KXDA 4FSSA 2XGTA 4X1VA 5GANf 2EQKA 1RUWA 4PJOF 1N9SA 1MMNA 3CD6A 1VYVA 2DJZA 3D7SB 2FRWA 3M54A 3RMQA 4TTVA 3DLMA 3OS1A 3NMZC 1Z7NA 4QT7A 1ADJA 1N8RU
chains in the Genus database with same CATH topology
4J8OA 4M7DF 1QVPA 3HFOA 3LWHA 4LDUA 3JCMc 4C8QG 3V8KA 1G5HA 2EKOA 3T9NA 3CEYA 4BI4A 2E6ZA 2ODRD 4ZIBA 3CPFA 4P75C 3RKWA 1VQ7T 4VUBA 2DIGA 2EL9A 5A0LA 5CCAA 1H4QA 1E1OA 2ZPHB 1VQ4A 5GMKi 1H641 3S3MA 1NYQA 4G84A 3A5ZB 2XDBA 1XNIA 1FXXA 1R8OB 4M77G 2I4MA 4MMLA 3BY7A 3JRZA 2LCLA 1KOGA 2E41A 4HCCA 3OYDA 4C92E 2RHIA 3RIRA 2A7YA 3CC7A 1AHJB 1QVGA 4OGCA 5J39A 1OZ3A 1QVFA 3DSQA 2VGNA 2MMPA 3S3NA 3V7RA 2MF2A 5M9OA 1EIYB 4ELYC 1Y96A 4C5EA 2DXBA 4MDXA 3TEGA 3MP8A 2R57A 4JLGA 3X25B 3HL8A 4P3OA 4QW2A 2ZINA 1D3BB 1UGRB 5GANj 4JS4A 4CH4A 5GAMh 2RI5A 4BI8B 3HFVA 3QZ9B 4L59A 3NFCA 4C8QD 5I21A 3HKSA 1UB4A 4JRKA 2Q5IA 4OGEA 1QP2A 1BI3A 3OYLA 2FB7A 3DLLA 1RI0A 5FU7C 1SESA 3QJYA 3ICAA 1PYSB 4C8QA 3A8LB 4BD3A 4YRGA 4NS5A 3CCMT 5CKDA 2WSFE 2OTLA 2BUDA 4BUGA 4IUUA 1KHCA 1Q82U 4BE2A 3M59A 2QA4T 3IKMB 3I7FA 3QSUA 4YRTA 4M77D 1VIEA 2RHQB 5J3BA 4PHCA 4IKFA 2EQMA 4C92F 2ARUA 1SETA 4YRPA 3OYNA 4E51A 4YRRA 1WQ7A 2ZZEA 1X6OA 1WJSA 1WJQA 4J6YA 3JCMW 4JDSA 1YHQA 1E24A 3L4GA 2FYKA 1YFSA 4OB3B 3PMTA 4C8QC 1JBMA 3I56T 2DU5A 2DKGA 2LRQA 2Q7EA 2ALYA 4E7KA 2K57A 3MEWA 3CCEA 2MI6A 5GMKh 1B76A 4P74C 3P8YA 3BDUA 3VQXA 1HTTA 3A32A 4RQFA 3VV0A 3G4SA 2ZZGA 5D6WA 4ZN3A 4QQ6A 3VKIA 4YPFA 4YTLA 2AMCA 1OYXA 3V7SA 1N9WA 4M77C 2KMTA 2QHUA 4TQFA 1IL2A 3URGA 4J7IA 1Y7XA 3CMAT 1ZBXA 5I2SA 4MZTA 4K87A 2ZZDA 2OAUA 1NJ2A 4HWRA 2J3MA 3CC7T 2E5QA 1U1TA 1M1KU 5E3IA 2XICA 4YRQA 2EQUA 1WGSA 2QQRA 2ZGWA 3NTHA 1NPRA 4DOVA 3M4PA 3IG2A 2C06A 1YI2T 2MAMA 2RHYA 4J7FA 3OS5A 2CS7A 2ZIOA 3CC2A 2O01E 2A3LA 2QQAA 4OLFA 3JB9G 4M78B 4C8QE 5GAOq 4LDYA 4PJOD 1YFRA 3RKYA 1WYDA 2PMEA 1G5IA 3HTZA 4BY6B 2DTHA 2X35A 2ZCFB 2VXFA 4CS2A 4XTWA 4NCXA 1UGSB 2VV5A 1FX7A 4M7DD 2J3LA 2LVMA 3SFMA 3IKLA 4M77E 4EPCA 2ZNJA 1VQPA 1KC8C 1VQ8A 3A7AA 3CCVT 1WNLA 4IURA 5C52B 3FIFA 2HAXA 4H2WA 2VYTA 3JCMh 4LVJA 2OTLT 3VUBA 4NL2A 4CRIA 4RCBA 3CC4T 2HBPA 3GP8A 3QIIA 1B34A 2DU7A 3P8BB 4ATOA 1YJWA 1I8FA 2RHXA 3FC3A 3CCQT 4YRJA 3WVDB 4HWTA 1S72A 2ZR3A 3SWNB 4UP8A 3MP6A 4A4GA 1VQNA 3HP9A 3VYHB 3W3SA 4YRIA 2KVQG 1PSFA 2LNVA 3JB9D 4C8QF 2E70A 4RKUE 2KY9A 2XHCA 1ASZA 3QO8A 2ZPEB 3HY1A 1BIBA 3BDLA 3G4ST 3E9IA 1W2BS 2ZXFA 1VQ9T 3PCOB 1ZQ1A 4A4EA 4FSXA 3M4QA 1UEBA 4P3NA 4IUPA 1N27A 3WVEB 4KUDK 4XQ3A 2E65A 4OMFB 2KSSA 3NTIA 3A31A 2OTJT 4OB0B 4M77F 2ZPGB 3OYKA 1K8AC 1KMMA 1UGQB 1LNXA 4B9XA 1VQZA 3LC0A 5EG2A 3WXMB 2QEXT 4TWAA 3DB3A 4DOWA 1X54A 4X5OA 2K4YA 3A5ZA 2PVGB 1RIQA 1G3SA 3RERA 4X9CA 2V8IA 4XK8E 4HWPA 3JB9I 1ASYA 4YCVA 5LL6S 2CJBA 4CH6A 4JRQA 1YJNA 4L6V5 4YRLA 2LQ8A 1ZHIA 2JNGA 3L2QA 3PIOA 2RJCA 4TVAA 2P4TA 3A74A 3RACA 1N9RA 3CCJA 5GAMg 2CZ1B 3LSQA 1VQ5A 4WF2A 2IG0A 5KE3A 4RDXA 1D3BA 2GQVA 2O4XB 1KQSA 4O5VA 3PTAA 1EVLA 5CKBA 1VQOA 1QE0A 4N0AC 3L2WA 3EFRA 4JRIA 2YRVA 4YRNA 4F7UB 4K88A 3JB9J 2EJGA 3CCUA 3GLXA 5FU6C 5CR2A 4H2XB 1JJ2A 3J81E 4H2SA 3RKXA 4M7AD 4PJOB 2QTXA 3JCMb 4ZGDB 2PU9B 5FRNA 1YJ9A 1BBUA 4A4FA 5IN1A 2CZ0B 1PYSA 1Y07A 1YJWT 4RG2A 1X01A 5GMKm 3HRKA 4M7DB 2R58A 1Q81C 4EMKB 2V8JA 4M78G 3OYEA 1SSFA 2CGHA 2RHQA 4BWAA 5GAOp 2YLCA 1S72T 1VUBA 3L2UA 3LSSA 2DO3A 3QNEA 1YITA 3MO8A 4YRMA 5C51B 1NYRA 4Y91A 2AKWA 3G1ZA 2RI3A 2JTMA 1HK9A 4J15A 2HD0A 4R56A 1KD1U 1KQ1A 1P92A 3NEMA 1VQLA 2EWNA 3M4YA 2BIVA 4M7AC 1KMNA 1NJIU 2HNIA 4YCWA 3KXTA 2RK2A 2KDSA 2NS6A 3RGLA 4FIBA 4TVYA 1ADYA 3MHXA 4L5GA 4BE1A 3NETA 1QVFS 3CXCA 4Z02A 4YREA 4Y28E 4PLIA 5LJ3f 3WQZA 4H02A 3LW5E 1JJCB 3CBOA 5LJ5f 4J6XA 5GANe 3OMCA 4RMFA 1VQKT 1LOJA 3QJ6A 3LGFA 5GAN5 1TH7A 3MEVA 1X2HA 3HXYA 1NJ1A 3FDRA 2LT4A 2DD4A 2EJ9A 3M55A 4E7LA 4JRPA 2QQ9A 3QXEB 4B9WA 3CCLA 1WPYA 3JB9F 4C5IA 2PVDB 4C0DB 3E19A 1NE8A 3CCSA 2QXFA 4OB2B 3JCMd 1VQ5T 4YDQA 1Q86C 3UPUA 3A7RA 4M78A 4TQDA 1MGQA 1YGBA 3OYFA 2E12A 2XTIA 2RD1A 4UP7A 4M7AE 3CMEA 5LJ3e 3QTCA 4M75G 3CBMA 1EFWA 2DXCA 3OB9A 1OI1A 2LTOA 5LJ5e 4MZPA 3QHSA 2MWPA 2PUOB 1JB0E 3TCJA 4C92B 3OBWA 2DXUA 3JCMX 3S6WA 2K5LA 5GAN6 1BBWA 1C0AA 3JCMg 3X24B 2IVWA 2A8EA 1YJ9T 3PFSA 1M90U 3VU3C 3BJUA 3DB4A 2XU8A 3OSVA 4XTXA 5CK9A 2NLUA 3OMGA 4TVWA 1K73C 2LC4A 4M78C 2DD5A 4OVAA 5C0MA 2C8MA 3HXVA 1L0WA 2ZIMA 2Y4XA 1G5VA 5CIUA 2D6FA 5GAN7 1O9SA 2DAQA 5KNNA 4L87A 3CBPA 5LJ3j 2K3YA 3A5YA 1B7YB 2X4WA 3E9FA 5K1XA 4BY6C 1YITT 3CD6T 3MEUA 5LJ5j 1M1FA 5GANd 4EMGA 2L8DA 3IALA 3VQWA 3V7CA 4E7IA 4RG8A 3HY0A 3GOXA 3MQZA 2DEQA 3SB2A 3CMQA 5HGQA 3SWNA 2KAFA 5DY9A 4JLIA 3VUZA 4EX5A 2ZT7A 1YBYA 1SERA 3OYYA 4FU6A 2X4YA 4D6WA 4M7AF 2L5QA 4OP0A 4GLKA 1VQ4T 4KR3A 2D0QB 4LD6A 3PCOA 2B8AA 1J5WA 2JOYA 4HT8A 3E1SA 4YRKA 3GF5A 2L3RA 4N4GA 3NENA 3REUA 4M75A 4CH5A 3QBYA 5CAIA 4M78E 3X20B 5LJ5d 4YRFA 3JSCA 4Q6GA 1N6AA 4JUVA 2DTOA 1I4K1 3I55A 3BFMA 1QW1A 3VBBA 3CCLT 4ZN1A 1XTDA 4KT0E 5GAN3 3QDRB 3OY9A 5GAMf 1IREB 1EQRA 2GCXA 3NTKA 4A4KA 4M75C 4WI1A 3INZA 5FU7B 3CMET 1Y96B 1B70A 1B8AA 2RO0A 4MDWA 3H6ZA 1USYA 4ZTUB 3PZCA 3META 2P0PA 4P3PA 2O4XA 1FYFA 3M4GA 4X34A 3REXA 1VIFA 4LVIA 3G6EA 5HK0A 1WU7A 3OD1A 3LLRA 4BI3A 3TU4K 2ZTGA 3TREA 2FHDA 3V8JA 1BI1A 3ERRA 1FWZA 3OSSC 2F5TX 1YCYA 4ZTFA 1NJ8A 3OYIA 4YYEA 4OF1A 3KBGA 2Y90A 3CCRA 5IT9E 5HKCA 4M78F 4C8QB 2CZ6B 2IY5B 3EAEA 4UC4A 2E6NA 2XI9A 3L2VA 1USYC 2ZCEA 1W66A 3G71A 4EMKA 4IUTA 2JTFA 1YHQT 1XQHA 4KBMB 1HC7A 4FT2A 3C4SA 3FB9A 2QHVA 4KULA 1BI0A 4M77B 4M75E 4GY5A 4C92G 1LYLA 3JCMP 2E5AA 3CCET 2DK3A 5GAOm 2ZT5A 5GAMj 3OYAA 3QO3A 4O2DA 1WQWA 2DZ9A 1LJOA 2ZT8A 1BI2A 2X4XA 3MF2A 4J5YA 2L89A 3LH0A 4C5HA 2XIDA 4K86A 4ZTJA 1NZ9A 5GANh 4A4HA 2QI2A 2LDMA 4H2YA 4N4IA 1M4ZA 1KG1A 2DXTA 4HWOA 2PUKB 3UFGA 4CI0C 2QQBA 2I4LA 3OYGA 3HXZA 4BW9A 5KE2A 3FJPA 2G3RA 4XTUA 2G4CA 4H2TA 4ZTZB 1VQ7A 3JAME 4MMKA 3RF1A 3O8VA 3CC2T 1KQSS 5FROA 12ASA 4II1A 3SD4A 3LYIA 3OYJA 5ELNA 2XDPA 2XKOC 2ZPIB 5LJ3h 3CPWA 2LX9A 3HFZB 1EIYA 2JN0A 2RHSB 4V2SA 2XK0A 4P73A 5LJ5h 5D6YA 2RH2A 4M75F 1M8VA 3OW2S 1EIFA 1DJ7B 1JRIA 2ZR2A 3P8TA 2Q7GA 3PT9A 3UDCA 4P72A 5CO7A 5GAN4 2X4JA 3Q1JA 3L42A 2E3CA 4O6JA 3G6ET 1VQPT 1VQ8T 3C95A 1PSEA 4RQEA 2HQEA 1VQ6A 4TVRA 5DM7R 4C92A 2GFAA 4LD9K 3M9QA 1X56A 3H8ZA 2RK1A 4XU2A 4ZGEB 4NL3A 1I81A 3PNWC 4ZGJB 4LDWA 3CCRT 4JJNK 3UT1A 4P73C 3J80E 1Q7YC 2WACA 3ME9A 2QQSA 3LGLA 4N4HA 3G71T 3AHUA 3OYMA 2QDYB 3L2ZA 3OYBA 2EQJA 3UGTA 3HRTA 3JB9H 1G3TA 3R07A 3CCMA 1B7YA 2ARTA 1UGPB 1VQNT 3LWIA 3CXCS 2QA4A 3FRNA 3F70A 1G51A 4XU3A 2E1HA 1NJ5A 2JZ2A 1Z7MA 2CKKA 2ZT6A 4C5GA 3C12A 4IUVA 5I2MA 3SDZA 1NJ6A 1IZ6A 2P0KA 1QVGS 4YRSA 1GGMA 2GFUA 2EAYA 2E64A 3A7UA 3LX7A 4RCCA 3DKMA 3I56A 2CIMA 1HXDA 4DPGA 4QQGA 3OBYA 2FL7A 1M1GA 3HRUA 4P71A 4HT9A 2LCCA 2R5MA 5CQXA 4WJ3M 3E9HA 3PGGA 4RMOA 1KC8U 4UPAA 2VXEA 1K9MC 1YJNT 3TEHB 3HHTB 2F69A 4XAXB 3CMAA 3E9GA 2CJAA 4EMHA 2VGMA 3OS0A 1H4SA 4MZMA 4M78D 2RHZA 3MCAB 5CKHA 3ZFJA 5GAOr 5A0GA 4A54A 1BKBA 3PIPA 4H2UA 2QHTA 3CCJT 4YCUA 3RESA 1U1SA 3J7AF 5GMKl 5FU6B 3QUIA 1YI2A 4P71C 1H3ZA 1H4TA 4TVAB 1KQ2A 4QQDA 4HCBA 3TEEA 1WJRA 3OYCA 3RUXA 1VQOT 3HSBA 3S3OA 5C6SA 4JS5A 3OYHA 3QYGB 2ODRC 4A53A 1VQ6T 2XG8D 3M57A 3CCUT 4E7JA 1GXIE 2PMFA 3HRIA 2CYZB 4BDZA 3OA6A 4BDYA 5D6XA 2HQXA 1O75A 1G3WA 2PVOB 1QP3A 4IUQA 2Q5HA 1ATIA 3MEAA 3GPLA 4X9DA 1NPPA 2E10A 2GF7A 1BIAA 1G3YA 4ME7A 3G7ZA 5CQYA 3CCVA 2IY5A 1RL2A 3ASKA 4LDVA 4M7AB 1K8AU 5HY6A 2D9TA 2ZPFB 4HCZA 3CC4A 2JVVA 3P8DA 3ZEHA 2K5IA 4C0ZA 4J6WA 4P74A 2CZ7B 3A8GB 3GNFB 3A8OB 3NELA 4FT4A 4DA4A 1VQLT 2EYQA 2ZZFA 4ELZC 1W4SA 3CCQA 2AKWB 4F7UG 4M77A 4C0FA 3QO7A 3KFUA 2LQKA 4PJOG 4H2VA 5HK3A 1YIJA 5GANg 5GAN8 4M75D 4KUIA 4Q5WA 4XTYA 1U8RA 5KCHA 2RJFA 4M7DG 4HA8A 1X75C 4PL6A 2P5IA 5LJ3d 4QVDA 4E7HA 3X26B 2Y4YA 3SWNC 1VQ9A 4HT4A 5J26A 2C7IA 5FLXE 4EO4A 4KR2A 1E1TA 4LVMA 3HXUA 3M5AA 2OTJA 4EDUA 2M0OA 2XDDA 3JCMQ 3FEOA 5CVIA 3ER0A 5DLOA 5LJ3g 2QEXA 4HVCA 1Q7YU 2ARSA 3V8LA 4XTVA 3CCST 5LJ5g 3A8MB 1Q81U 5ELOA 1KD1C 1N8RC 2M9UA 2RM4A 3HFZA 2RHSA 3RL6A 4BACA 1NJIC 2K5FA 2H3JA 4FM4B 2DZCA 1QF6A 3JCMJ 3QG1A 1VQMA 4CH3A 5L8RE 2K3XA 3GNGA 2K2VA 2M1HA 2EIFA 2RB6A 2DPPB 5CKEA 1NNHA 3UWNA 4OB1B 4F7UA 3VJPA 4XU1A 3X28B 4CS3A 4H2XA 4XEOA 4PJOA 4LDXA 2EFIA 3HRSA 5GAMe 4NOYA 1V29B 1MHNA 2DDZA 2V8KA 4DQ2A 4M7DA 4R55A 4HWSA 4C0GA 3M53A 1H4VB 3QO5A 5A0DA 1BYMA 2CJ9A 3QPHA 2KQWA 1KHIA 2WSEE 4WJ4A 1M9SA 4XTZA 5AYFA 4YROA 3MEYA 1K9MU 3P8HA 1EVKA 4PJOC 3L4GB 3VQYA 4QVZA 1YIJT 2R5AA 3GIBA 2EJFA 3M58A 3JCMV 3PMIA 4M7DC 2DQ0A 2MWOA 4EMKC 1Q86U 2ALYB 4Q15A 4YP0A 5KH6A 1M90C 3EFSA 3QYHB 4FL6A 1WLEA 2VC8A 11ASA 4J83A 3UH0A 4LVLA 5CKFA 2AMCB 3UGQA 3ZBDA 3CPWS 4M7AG 4PNOA 1Q82C 2KK4A 4XU0A 1JJCA 3I55T 1XOVA 5GMKe 1EOVA 1E22A 5A2QE 3A8HB 1YFTA 4M75B 3OS2A 3VQVA 3C94A 3TUPA 2I4NA 4G85A 3FLGA 1X2GA 2RHUA 3TEHA 2VUBA 2FVUA 1K73U 2AHJB 2P0QA 2ZNIA 5GAMd 1VQKA 4F7UE 1W2BA 4P5NA 3HXWA 4LVKA 3M56A 4N0AA 1JJ2S 3L2RA 4PG3A 3R6OA 3KUFA 3L1AA 4XEMA 4PJOE 2DIQA 5FRMA 4BE0A 4QVCA 3HFNA 1VQMT 2DVEA 4C92D 2YLBA 3N5BB 3JCMf 3HXXA 1YB3A 5GMKj 4M7DE 1B70B 4CS4A 2RJEA 2WSCE 2ZPBB 2I2LA 2BKDN 5F5WA 3RMSA 5IAYA 2RI2A 3BW1A 2JUFA 2RA2A 1M5Q1 4LNSA 4BB7A 5KCOA 2DTIA 2LT1A 4C0DC 4UP9A 4PLLA 5GAOl 1I5LA 1M1KC 4AH6A 5C53B 1SRYA 4E47A 3HPWA 2F5KA 4PKCC 1B34B 3MF1A 4P72C 2Q7HA 3OW2A 1OZ2A 2RJDA 3P8VA 2QHSA 4HKEA 2XD0A 4M7AA 2DQ3A 1Y71A 2PQWA 5GAOn 3JCMe 4C92C 3VYGA 2M16A 5DLQE 4YRCA 5GAN2 2P0LA 3MP1A 1X55A 2I4OA 4F7UF 4P75A 4KQEA 3QZ5B 3OQ5A 2YHTA 3QKJA 2XGTA 5GANf 2EQKA 4PJOF 1N9SA 3CD6A 2DJZA 3M54A 3RMQA 4TTVA 3DLMA 3OS1A 1Z7NA 5K1PA 1ADJA 1N8RU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RIQ A;  2IY5 A;  3RER A;  4X9C A;  4M7D F;  1USY A;  4ZTU B;  4M7A B;  3PZC A;  4P3P A;  3HFO A;  3JCM c;  4C8Q G;  4HWP A;  1FYF A;  3M4G A;  3JB9 I;  1ASY A;  4YCV A;  3V8K A;  1G5H A;  3REX A;  2CJB A;  4J6W A;  4P74 A;  4CH6 A;  4YRL A;  1WU7 A;  3OD1 A;  2ODR D;  4ZIB A;  2ZTG A;  4P75 C;  3RKW A;  3NEL A;  2EL9 A;  3V8J A;  2ZZF A;  3ERR A;  1H4Q A;  1E1O A;  4TVA A;  1YCY A;  2AKW B;  5GMK i;  1H64 1;  4F7U G;  4M77 A;  1NJ8 A;  4YYE A;  3A74 A;  3QO7 A;  3KFU A;  3RAC A;  1N9R A;  1NYQ A;  2Y90 A;  5GAM g;  4G84 A;  3LSQ A;  4PJO G;  4H2V A;  4M77 G;  4M78 F;  2I4M A;  4C8Q B;  4MML A;  4WF2 A;  3BY7 A;  2IY5 B;  4RDX A;  5GAN g;  1KOG A;  1D3B A;  1USY C;  2E41 A;  2ZCE A;  1W66 A;  5GAN 8;  4M75 D;  4C92 E;  3RIR A;  4EMK A;  1EVL A;  1QE0 A;  4N0A C;  4XTY A;  3EFR A;  4JRI A;  4M7D G;  4YRN A;  4HA8 A;  4F7U B;  4K88 A;  3JB9 J;  2EJG A;  2P5I A;  5LJ3 d;  4QVD A;  1HC7 A;  3FB9 A;  3DSQ A;  4H2X B;  2QHV A;  4H2S A;  3RKX A;  4M7A D;  4PJO B;  3SWN C;  2QTX A;  4M77 B;  3V7R A;  4M75 E;  3JCM b;  1EIY B;  4C92 G;  1BBU A;  1Y96 A;  1LYL A;  3JCM P;  2E5A A;  2C7I A;  4EO4 A;  4KR2 A;  1E1T A;  1PYS A;  3HXU A;  5GAO m;  2ZT5 A;  5GAM j;  1X01 A;  3TEG A;  3QO3 A;  4O2D A;  1WQW A;  2DZ9 A;  5GMK m;  3HRK A;  4P3O A;  4M7D B;  1D3B B;  1LJO A;  2ZIN A;  2ZT8 A;  3JCM Q;  4EMK B;  5GAN j;  4CH4 A;  5GAM h;  3MF2 A;  4M78 G;  4J5Y A;  5LJ3 g;  4HVC A;  2ARS A;  2CGH A;  3V8L A;  3HFV A;  4XTV A;  2RHQ A;  4BWA A;  5GAO p;  2YLC A;  4K86 A;  5GAN h;  5LJ5 g;  3LSS A;  4H2Y A;  5ELO A;  4C8Q D;  5I21 A;  3QNE A;  4YRM A;  5C51 B;  4JRK A;  1NYR A;  2Q5I A;  2DXT A;  4Y91 A;  2AKW A;  2RM4 A;  4HWO A;  3G1Z A;  3HFZ A;  2FB7 A;  3UFG A;  2I4L A;  2RHS A;  3RL6 A;  3HXZ A;  4BW9 A;  1HK9 A;  4J15 A;  1SES A;  3FJP A;  3ICA A;  1KQ1 A;  1PYS B;  4C8Q A;  4XTU A;  2DZC A;  2G4C A;  4H2T A;  4YRG A;  3JCM J;  1QF6 A;  3NEM A;  4ZTZ B;  4CH3 A;  4MMK A;  2EWN A;  3RF1 A;  4M7A C;  1KMN A;  2HNI A;  3IKM B;  3I7F A;  3QSU A;  4YRT A;  4YCW A;  4M77 D;  2RB6 A;  12AS A;  1NNH A;  3RGL A;  2RHQ B;  4PHC A;  4TVY A;  4C92 F;  2ARU A;  5ELN A;  4F7U A;  1ADY A;  1SET A;  4XU1 A;  4YRP A;  3NET A;  4CS3 A;  4E51 A;  4H2X A;  4YRR A;  4XEO A;  4PJO A;  5LJ3 h;  4YRE A;  1WQ7 A;  2ZZE A;  3HFZ B;  1EIY A;  5LJ3 f;  2JN0 A;  5GAM e;  2RHS B;  3WQZ A;  4J6Y A;  4V2S A;  4NOY A;  4P73 A;  5LJ5 h;  3JCM W;  3L4G A;  1E24 A;  4H02 A;  1JJC B;  2FYK A;  5LJ5 f;  4J6X A;  4M75 F;  1YFS A;  1M8V A;  2DDZ A;  5GAN e;  1JRI A;  4C8Q C;  4RMF A;  2ZR2 A;  1LOJ A;  1JBM A;  4DQ2 A;  3P8T A;  4M7D A;  2Q7G A;  2DU5 A;  4HWS A;  2DKG A;  5GAN 5;  1TH7 A;  4P72 A;  1H4V B;  5GAN 4;  1X2H A;  3QO5 A;  3HXY A;  1NJ1 A;  2Q7E A;  2CJ9 A;  2ALY A;  2K57 A;  2E3C A;  2EJ9 A;  4RQE A;  5GMK h;  4WJ4 A;  1B76 A;  4P74 C;  3P8Y A;  3BDU A;  3VQX A;  4XTZ A;  1HTT A;  3A32 A;  4C92 A;  4YRO A;  4RQF A;  1X56 A;  2ZZG A;  1WPY A;  3MEY A;  3JB9 F;  4YPF A;  2AMC A;  4XU2 A;  3V7S A;  1N9W A;  1EVK A;  4PJO C;  4NL3 A;  1I81 A;  4M77 C;  2QHU A;  4TQF A;  3L4G B;  3VQY A;  1IL2 A;  3JCM d;  4P73 C;  4YDQ A;  3A7R A;  4M78 A;  4TQD A;  1MGQ A;  1YGB A;  4K87 A;  3GIB A;  1NJ2 A;  4HWR A;  2XTI A;  2RD1 A;  2J3M A;  4M7A E;  4UP7 A;  2EJF A;  3JCM V;  3AHU A;  4M7D C;  5LJ3 e;  3QTC A;  1U1T A;  2DQ0 A;  3L2Z A;  4M75 G;  5E3I A;  4EMK C;  1EFW A;  2ALY B;  4Q15 A;  4YRQ A;  3UGT A;  4YP0 A;  5LJ5 e;  3JB9 H;  3QHS A;  2ZGW A;  3EFS A;  1WLE A;  3R07 A;  2VC8 A;  11AS A;  3M4P A;  1B7Y A;  2ART A;  3IG2 A;  4C92 B;  2DXU A;  3JCM X;  3UH0 A;  5GAN 6;  1BBW A;  1C0A A;  2ZIO A;  3JCM g;  2AMC B;  3UGQ A;  4M7A G;  4PNO A;  1G51 A;  3VU3 C;  4XU0 A;  2E1H A;  4XU3 A;  3BJU A;  1JJC A;  4OLF A;  1NJ5 A;  4XTX A;  5GMK e;  3JB9 G;  1EOV A;  1E22 A;  4M78 B;  1YFT A;  4M75 B;  1Z7M A;  4TVW A;  4C8Q E;  4M78 C;  3VQV A;  2ZT6 A;  3TUP A;  2C8M A;  5GAO q;  3HXV A;  2I4N A;  4PJO D;  1L0W A;  1YFR A;  1NJ6 A;  2ZIM A;  4G85 A;  3RKY A;  1X2G A;  4YRS A;  5GAN 7;  1GGM A;  5KNN A;  1WYD A;  3TEH A;  4L87 A;  2PME A;  5LJ3 j;  1G5I A;  3HTZ A;  3A5Y A;  2DTH A;  2EAY A;  1B7Y B;  2E64 A;  3A7U A;  4RCC A;  5K1X A;  2ZNI A;  5GAM d;  2VXF A;  4F7U E;  4CS2 A;  5LJ5 j;  4XTW A;  3HXW A;  4NCX A;  2CIM A;  1HXD A;  4N0A A;  4DPG A;  4M7D D;  2J3L A;  4PG3 A;  5GAN d;  3L1A A;  4EMG A;  3IAL A;  4PJO E;  4XEM A;  3VQW A;  3IKL A;  4M77 E;  3V7C A;  2ZNJ A;  3HY0 A;  3A7A A;  1WNL A;  4QVC A;  5C52 B;  3HFN A;  3FIF A;  4P71 A;  4HT9 A;  4H2W A;  3SB2 A;  2DEQ A;  3CMQ A;  5HGQ A;  3SWN A;  3JCM h;  2DVE A;  4NL2 A;  5DY9 A;  4WJ3 M;  4JLI A;  4C92 D;  2YLB A;  4RCB A;  3E9H A;  4EX5 A;  3JCM f;  3HXX A;  3PGG A;  5GMK j;  1YB3 A;  2ZT7 A;  1SER A;  4M7D E;  1B70 B;  4UPA A;  4CS4 A;  2VXE A;  1B34 A;  2DU7 A;  2I2L A;  3TEH B;  5F5W A;  4M7A F;  2CJA A;  3BW1 A;  1I8F A;  4EMH A;  4OP0 A;  1H4S A;  4M78 D;  2RA2 A;  1M5Q 1;  4YRJ A;  4KR3 A;  4LNS A;  5GAO r;  4A54 A;  2DTI A;  3PCO A;  4H2U A;  2QHT A;  1J5W A;  4UP9 A;  4HT8 A;  4YCU A;  5GAO l;  3RES A;  1I5L A;  4HWT A;  1U1S A;  4YRK A;  4AH6 A;  5GMK l;  3NEN A;  2ZR3 A;  3QUI A;  5C53 B;  3REU A;  4M75 A;  3SWN B;  4UP8 A;  4P71 C;  1H4T A;  1SRY A;  4TVA B;  4CH5 A;  5CAI A;  1KQ2 A;  4M78 E;  3W3S A;  5LJ5 d;  4YRI A;  3RUX A;  3HSB A;  4YRF A;  1B34 B;  3MF1 A;  3JB9 D;  4C8Q F;  4P72 C;  2Q7H A;  4Q6G A;  4JUV A;  2DTO A;  1I4K 1;  2ODR C;  3BFM A;  3P8V A;  4A53 A;  2QHS A;  1ASZ A;  3QO8 A;  3VBB A;  4M7A A;  3HY1 A;  1BIB A;  2DQ3 A;  5GAO n;  3JCM e;  4C92 C;  3E9I A;  2PMF A;  3HRI A;  2ZXF A;  3PCO B;  4YRC A;  5GAN 3;  5GAN 2;  2P0L A;  3M4Q A;  5GAM f;  1X55 A;  2I4O A;  4F7U F;  4P3N A;  4P75 A;  4KQE A;  4XQ3 A;  1EQR A;  2E65 A;  2YHT A;  2XGT A;  5GAN f;  3A31 A;  2Q5H A;  1ATI A;  4PJO F;  1N9S A;  4M77 F;  4X9D A;  2DJZ A;  4M75 C;  4WI1 A;  3INZ A;  2E10 A;  1KMM A;  4TTV A;  1Y96 B;  1B70 A;  1LNX A;  1VQZ A;  3LC0 A;  1B8A A;  1Z7N A;  4TWA A;  1BIA A;  1X54 A;  4X5O A;  3A5Z A;  5K1P A;  1ADJ A; 
#chains in the Genus database with same CATH topology
 1OX8 A;  4J8O A;  1MV3 A;  4M7D F;  1QVP A;  3HFO A;  3LWH A;  4LDU A;  3JCM c;  4C8Q G;  2RQV A;  7AT1 B;  2DBM A;  3V8K A;  1G5H A;  2DX1 A;  2EKO A;  3T9N A;  3CEY A;  2A28 A;  4BI4 A;  2E6Z A;  2ODR D;  3CCM Q;  2VWF A;  4ZIB A;  3CPF A;  4P75 C;  3RKW A;  1VQ7 T;  4VUB A;  2DIG A;  4IIO A;  2EGC A;  2EL9 A;  5A0L A;  2QGF B;  5CCA A;  1H4Q A;  1E1O A;  2ZPH B;  1VQ4 A;  2J6K A;  2QA4 Q;  5GMK i;  1H64 1;  1QQJ A;  2X3X D;  1RAC B;  3S3M A;  1NYQ A;  4G84 A;  3A5Z B;  2XDB A;  3CQT A;  1XNI A;  1FXX A;  1R8O B;  4M77 G;  2I4M A;  2K6D A;  4MML A;  2KI7 A;  3BY7 A;  1OUL A;  2KYM A;  1I07 A;  3JRZ A;  2LCL A;  1KOG A;  1T3L A;  2E41 A;  4HCC A;  3OYD A;  4C92 E;  1W2B P;  2RHI A;  3RIR A;  2A7Y A;  3CC7 A;  1AHJ B;  2MOX A;  1QVG A;  4PFO A;  2M02 A;  4KH0 B;  4AFZ C;  4OGC A;  5J39 A;  2CP0 A;  2YDL A;  1UHF A;  1OZ3 A;  4J9F A;  1QVF A;  3I56 Q;  2HZY A;  1OEB A;  1PC0 A;  3DSQ A;  2VGN A;  2MMP A;  3S3N A;  1KSW A;  2CP3 A;  3V7R A;  2MF2 A;  5M9O A;  1EIY B;  4ELY C;  1Y96 A;  2JM9 A;  1BU1 A;  4OMN A;  1Q95 G;  3O5Z A;  3EFO A;  4C5E A;  1IXD A;  2D8H A;  2DXB A;  4MDX A;  3TEG A;  3MP8 A;  1RAA B;  1K4U S;  2R57 A;  4JLG A;  3X25 B;  3HL8 A;  4P3O A;  4QW2 A;  2ZIN A;  1D3B B;  5GJW B;  2E5K A;  2LQN A;  1UGR B;  5GAN j;  1M3C A;  4JS4 A;  4CH4 A;  5GAM h;  2COZ A;  3G1J A;  2RI5 A;  4BI8 B;  1TOV A;  4RTU A;  3HFV A;  3QZ9 B;  3CMA Q;  2EYX A;  4ESR A;  4L59 A;  2L3S A;  3NFC A;  5GJV B;  4C8Q D;  5I21 A;  3HKS A;  2J6F A;  1W1F A;  1UB4 A;  4JRK A;  2Q5I A;  4OGE A;  1QP2 A;  1OPL A;  3CC7 Q;  5IXF A;  1BI3 A;  3OYL A;  1PD1 A;  2FB7 A;  2DYB A;  3DLL A;  2NUP B;  1RI0 A;  5FU7 C;  1SES A;  3QJY A;  2O2O A;  3ICA A;  4F16 A;  1PYS B;  4C8Q A;  3A8L B;  4BD3 A;  4YRG A;  4NS5 A;  3CCM T;  1YI2 Q;  3IQL A;  2M51 A;  5CKD A;  2WSF E;  1EFN A;  4KH1 B;  2OTL A;  2BUD A;  3MPU B;  4BUG A;  1VOM A;  4IUU A;  2JS0 A;  1KHC A;  1Q82 U;  4BE2 A;  3M59 A;  2QA4 T;  3IKM B;  3I7F A;  3QSU A;  4YRT A;  4M77 D;  1QKX A;  1VIE A;  2RHQ B;  5J3B A;  4PHC A;  4IKF A;  2LJ3 A;  1EZZ B;  2EQM A;  1UE9 A;  2D8J A;  2BE7 D;  1SG5 A;  3VS0 A;  4C92 F;  1ZA2 B;  4E6R A;  1SET A;  1F1B B;  4YRP A;  2DYI A;  3OYN A;  2YXY A;  4E51 A;  4YRR A;  1WQ7 A;  3EGD B;  2ZZE A;  1X6O A;  1WJS A;  1WJQ A;  4J6Y A;  3JCM W;  1IGQ A;  1WLP B;  4JDS A;  1YHQ A;  1E24 A;  3L4G A;  2FYK A;  1YFS A;  3FJ5 A;  2CT4 A;  4OB3 B;  3PMT A;  3NPF A;  4C8Q C;  1ZSZ B;  2QTV A;  1JBM A;  1KD1 R;  3I56 T;  2DL7 A;  1SRM A;  2J05 A;  2DU5 A;  2DKG A;  1AWX A;  2LRQ A;  2Q7E A;  2ALY A;  2K57 A;  4E7K A;  4R0K A;  3MEW A;  3CCE A;  3CCV Q;  2MI6 A;  3H9N A;  5GMK h;  1B76 A;  4P74 C;  3P8Y A;  3BDU A;  3VQX A;  1Y57 A;  1HTT A;  3A32 A;  2OTL Q;  4FW1 A;  4RQF A;  3VV0 A;  3G4S A;  3CC4 Q;  2ZZG A;  5D6W A;  4ZN3 A;  4QQ6 A;  3VKI A;  4OML A;  4YPF A;  4YTL A;  2AMC A;  5HCK A;  1OYX A;  3V7S A;  1N9W A;  3SHW A;  4M77 C;  2G6F X;  2KMT A;  3E2U A;  2QHU A;  1AZG B;  4CC3 A;  4TQF A;  2VKN A;  4FCY A;  1IL2 A;  3URG A;  4J7I A;  1Y7X A;  3CMA T;  1ZBX A;  5I2S A;  1M27 C;  4D8K A;  4MZT A;  1WHK A;  1QLY A;  4K87 A;  1IHV A;  3CCQ Q;  2ZZD A;  2EGE A;  5KYW B;  2OAU A;  1NJ2 A;  4HWR A;  2J3M A;  5FW9 A;  4F17 A;  3CC7 T;  2E5Q A;  1U1T A;  1M1K U;  2QK0 A;  3MJX A;  5E3I A;  2XIC A;  1WDX A;  2EGA A;  1QVG P;  3TVT A;  4YRQ A;  2O88 A;  2EQU A;  1WGS A;  2QQR A;  2ZGW A;  3NTH A;  1NPR A;  4DOV A;  4QKU A;  1YIJ Q;  3M4P A;  2PTK A;  3IG2 A;  2C06 A;  2FRY A;  1YI2 T;  4Z89 A;  2MAM A;  2RHY A;  1QVF P;  4J7F A;  3OS5 A;  2CS7 A;  2NUT A;  1NEG A;  2ZIO A;  3CC2 A;  2O01 E;  1T0H A;  2A3L A;  5I11 A;  4F14 A;  2ECZ A;  1Y0M A;  2QQA A;  4OLF A;  3JB9 G;  1GCP A;  4M78 B;  4JJC A;  3G4S Q;  4E7S A;  4GBQ A;  1M2V B;  4C8Q E;  1LCK A;  1ZUU A;  1VQ9 Q;  1TXQ A;  5GAO q;  1SKU B;  4FYV B;  4LDY A;  4PJO D;  1YFR A;  3RKY A;  2K9G A;  4JJB A;  1RI9 A;  2JM8 A;  1WYD A;  1TWB A;  2PME A;  1G5I A;  3HTZ A;  3M0R A;  1SPK A;  4BY6 B;  2DTH A;  2OTJ Q;  2X35 A;  4OMO A;  2ZCF B;  2VXF A;  4CS2 A;  2LJ1 A;  4XTW A;  1PM3 A;  4NCX A;  1UGS B;  2VV5 A;  1FX7 A;  4M7D D;  2J3L A;  2QEX Q;  8ATC B;  2LVM A;  3SFM A;  1GFD A;  3IKL A;  4M77 E;  4EPC A;  2ZNJ A;  1VQP A;  1KC8 C;  1VQ8 A;  2GTJ A;  1X69 A;  3A7A A;  3CCV T;  1WNL A;  3M0S A;  4IUR A;  5C52 B;  1M90 R;  3FIF A;  2HAX A;  4H2W A;  4FYX B;  1HYO A;  2VYT A;  3JCM h;  2CUB A;  2OTL T;  3VUB A;  4NL2 A;  4LVJ A;  5KYX B;  4CRI A;  4RCB A;  2JS2 A;  3CC4 T;  2HBP A;  3GP8 A;  3QII A;  1B34 A;  2DU7 A;  3P8B B;  2CP2 A;  4J9D A;  4ATO A;  2OI3 A;  1UHC A;  1QWE A;  1YJW A;  2EW3 A;  1I8F A;  2RHX A;  3FC3 A;  2GTO A;  3CCQ T;  4YRJ A;  3WVD B;  2DA9 A;  4HWT A;  1S72 A;  3A98 A;  2ZR3 A;  2V1R A;  3SWN B;  4UP8 A;  3MP6 A;  4A4G A;  1VQN A;  3HP9 A;  3VYH B;  3W3S A;  4YRI A;  3SEM A;  2KVQ G;  1JO8 A;  1PSF A;  3M0T A;  2LNV A;  3JB9 D;  4C8Q F;  2E70 A;  4AG2 C;  2RQU A;  4RKU E;  2BTT A;  2DLP A;  2KY9 A;  2XHC A;  1ASZ A;  3QO8 A;  1AWW A;  2ZPE B;  3HY1 A;  1BIB A;  2AK5 A;  3BDL A;  5KYU A;  3G4S T;  1UTI A;  3E9I A;  1W2B S;  2FZG B;  2GBQ A;  2ZXF A;  2L3Q A;  1VQ9 T;  3PCO B;  1ZQ1 A;  4A4E A;  4FSX A;  3M4Q A;  2A0F B;  1UEB A;  2JJ9 A;  4P3N A;  2QAS A;  4IUP A;  1N27 A;  3WVE B;  4KUD K;  4XQ3 A;  2E65 A;  1M2O A;  1YN8 A;  2KSS A;  4OMF B;  3NTI A;  3A31 A;  2OTJ T;  4OB0 B;  2RF0 A;  4M77 F;  2ZPG B;  3OYK A;  4EIK A;  1K8A C;  1KMM A;  2ARU A;  1UGQ B;  1LNX A;  4B9X A;  1VQZ A;  3LC0 A;  5EG2 A;  3WXM B;  2QEX T;  2P4R A;  4TWA A;  3DB3 A;  4DOW A;  1X54 A;  4X5O A;  2K4Y A;  4J9C A;  2PVG B;  3A5Z A;  1RIQ A;  1OV3 A;  1G3S A;  2DM1 A;  3RER A;  4X9C A;  5FWB A;  1NG2 A;  1HSQ A;  2V26 A;  2EBP A;  2V8I A;  4XK8 E;  4HWP A;  3JB9 I;  1ASY A;  4YCV A;  5LL6 S;  2CJB A;  4CH6 A;  4JRQ A;  1YJN A;  4L6V 5;  4YRL A;  1MV0 B;  2A36 A;  3HTR A;  2LQ8 A;  4Z8A A;  1ZHI A;  2JNG A;  3L2Q A;  3PIO A;  2K7A A;  2RJC A;  4TVA A;  2P4T A;  2C0T A;  2LMJ A;  3A74 A;  2KXC A;  3RAC A;  1N9R A;  4KGV B;  3CCJ A;  5GAM g;  2CZ1 B;  3LSQ A;  2DBK A;  1X27 A;  1VQ5 A;  1YP5 A;  4WF2 A;  2IG0 A;  5KE3 A;  4RDX A;  1TUG B;  1D3B A;  2GQV A;  2O4X B;  2YUP A;  4CC2 A;  1KQS A;  4O5V A;  1FYN A;  3PTA A;  1EVL A;  5CKB A;  1VQO A;  1TSF A;  1QE0 A;  4N0A C;  3L2W A;  3EFR A;  4JRI A;  1PNJ A;  2YSQ A;  2HKN A;  2YRV A;  4YRN A;  2EYW A;  4F7U B;  4K88 A;  3JB9 J;  1IB8 A;  2DL4 A;  2EJG A;  2FPE A;  3CCU A;  1VQK Q;  2RNA A;  3VS7 A;  3GLX A;  1EX4 A;  5FU6 C;  5CR2 A;  4H2X B;  1JJ2 A;  3J81 E;  4H2S A;  1M8M A;  3RKX A;  4M7A D;  4PJO B;  2QTX A;  3JCM b;  4ZGD B;  1TS9 A;  4JZ4 A;  2PU9 B;  2ED0 A;  5FRN A;  1ZA1 B;  1YJ9 A;  1BBU A;  4A4F A;  2JTE A;  5IN1 A;  2HQH A;  1WXU A;  2CZ0 B;  1RAB B;  1PYS A;  1BBZ A;  1Y07 A;  2VAS A;  1YJW T;  4RG2 A;  1X01 A;  2FG0 A;  5GMK m;  3HRK A;  4M7D B;  2R58 A;  5IH2 A;  1Q81 C;  4EMK B;  2V8J A;  4J9I A;  4M78 G;  3OYE A;  5IHI A;  1SSF A;  2CGH A;  4ZNX A;  4FW2 A;  4CC7 A;  2RHQ A;  1VQ5 Q;  4BWA A;  5GAO p;  2YLC A;  1S72 T;  3A1P A;  2SRC A;  1VUB A;  3L2U A;  3LSS A;  2DO3 A;  3QNE A;  1YIT A;  2C0I A;  3MO8 A;  4YRM A;  5C51 B;  1NYR A;  1BB9 A;  4Y91 A;  2AKW A;  1JEG A;  3G1Z A;  2RI3 A;  1R0C B;  2FPF A;  5D7U A;  2JTM A;  1AD5 A;  1HK9 A;  4J15 A;  3TSZ A;  2HD0 A;  4R56 A;  1KD1 U;  1KQ1 A;  1P92 A;  2DEU A;  1B7T A;  3NEM A;  1VQL A;  2HL3 A;  2DET A;  1ZSZ A;  1RAH B;  2EWN A;  2MK5 A;  3M4Y A;  1T3S A;  2BIV A;  2MIO A;  4M7A C;  1KMN A;  1D1B A;  1NJI U;  2HNI A;  1YJ9 Q;  4YCW A;  3KXT A;  2RK2 A;  1R0B G;  2KDS A;  2NS6 A;  3RGL A;  2GQI A;  1X2K A;  4FIB A;  4TVY A;  1ADY A;  2LP5 A;  3MHX A;  2KT8 A;  1RLP C;  1Q86 R;  4L5G A;  4LE9 A;  4BE1 A;  3NET A;  1QVF S;  3CXC A;  4Z02 A;  5I22 A;  4YRE A;  2K2M A;  4Y28 E;  4PLI A;  5LJ3 f;  3WQZ A;  4H02 A;  3LW5 E;  1JJC B;  3CBO A;  5LJ5 f;  1ZUK A;  3PVQ A;  4J6X A;  1AOJ A;  5GAN e;  3OMC A;  1YIT Q;  1BCO A;  3CD6 Q;  1CSK A;  4RMF A;  1VQK T;  3JV3 A;  1LOJ A;  3QJ6 A;  3LGF A;  4LN2 A;  1RAF B;  2COW A;  1N5Z A;  4FYY B;  5GAN 5;  1TH7 A;  3MEV A;  4J9B A;  2A37 A;  1X2H A;  3HXY A;  3VS6 A;  3C0C A;  1NJ1 A;  3FDR A;  1FMW A;  2LT4 A;  2DD4 A;  1WHM A;  2EJ9 A;  4WTO B;  3M55 A;  2ABL A;  4E7L A;  4JRP A;  1W6X A;  2QQ9 A;  3QXE B;  1YCS B;  3ZL7 C;  4B9W A;  3M0P A;  2IPO B;  4J9E A;  3CCL A;  1T0J A;  3THK A;  1WPY A;  2EPD A;  1K73 R;  3JB9 F;  1K76 A;  4C5I A;  3EG3 A;  2SEM A;  2PVD B;  4C0D B;  3E19 A;  1H3H A;  2H8H A;  1NE8 A;  3CCS A;  2QXF A;  4OB2 B;  3JCM d;  1VQ5 T;  1WXB A;  4YDQ A;  1Q86 C;  3UPU A;  3A7R A;  4M78 A;  4TQD A;  1MGQ A;  1YGB A;  1VQ4 Q;  3OYF A;  2DJQ A;  2E12 A;  2XTI A;  2RD1 A;  4UP7 A;  4M7A E;  1KQS P;  3CME A;  5LJ3 e;  4KGX B;  3QTC A;  2GNC A;  4M75 G;  3CBM A;  1EFW A;  2DXC A;  3OB9 A;  1OI1 A;  2LTO A;  4Z88 A;  5LJ5 e;  4MZP A;  3QHS A;  2MWP A;  2PUO B;  1JB0 E;  1WXT A;  3TCJ A;  4C92 B;  1MUZ A;  3OBW A;  2DXU A;  2J6O A;  3JCM X;  3S6W A;  2CUD A;  2K5L A;  5GAN 6;  1CKB A;  1BBW A;  1JJ2 P;  1C0A A;  3JCM g;  1UFF A;  6AT1 B;  3X24 B;  2IVW A;  2A8E A;  1YJ9 T;  3PFS A;  1M90 U;  2L0A A;  4J9H A;  1AWJ A;  3VU3 C;  3BJU A;  1GCQ A;  3DB4 A;  2XU8 A;  3OSV A;  4XTX A;  5CK9 A;  2NLU A;  3OW2 P;  3OMG A;  2HEQ A;  2E3H A;  1H8K A;  4TVW A;  1K73 C;  1I1J A;  2LC4 A;  4M78 C;  2DD5 A;  5KYX A;  4OMP A;  4OVA A;  5C0M A;  2C8M A;  2HMA A;  3HXV A;  1L0W A;  2ZIM A;  2Y4X A;  1G5V A;  1E6G A;  5CIU A;  2D6F A;  5GAN 7;  1O9S A;  2AIR B;  2DAQ A;  5KNN A;  4L87 A;  4ANJ A;  3CBP A;  3EG0 A;  5LJ3 j;  2K3Y A;  3A5Y A;  2AZV A;  1B7Y B;  4PFP A;  2X4W A;  3E9F A;  5K1X A;  1SF9 A;  4BY6 C;  3VS3 A;  1YIT T;  1PRM C;  3MEU A;  5LJ5 j;  2HSP A;  3CD6 T;  2ROT A;  1SHG A;  3CME Q;  1M1F A;  5GAN d;  4EMG A;  2L8D A;  1MNE A;  3IAL A;  3VQW A;  3V7C A;  4E7I A;  2ATC B;  4RG8 A;  3HY0 A;  3EG1 A;  3GOX A;  3MQZ A;  1C1A A;  2DEQ A;  3SB2 A;  3CMQ A;  2DL3 A;  3SWN A;  5HGQ A;  2KAF A;  5DY9 A;  4JLI A;  3VUZ A;  1PWT A;  2EQI A;  3RBB B;  4EX5 A;  2ZT7 A;  2YRC A;  1YBY A;  1SER A;  1W70 A;  1JQQ A;  1AEY A;  2DRK A;  3OYY A;  4FU6 A;  2X4Y A;  1YNZ A;  4D6W A;  4M7A F;  2L5Q A;  2NYS A;  2K3B A;  4OP0 A;  3REB B;  4GLK A;  2D0N A;  1VQ4 T;  3R6N A;  1M3B A;  3CXC P;  4KR3 A;  2MYS A;  2D0Q B;  2O9V A;  2K79 A;  4LD6 A;  3PCO A;  1X6B A;  2B8A A;  1J5W A;  2DVJ A;  2JOY A;  3UF4 A;  4HT8 A;  3E1S A;  2EYZ A;  4YRK A;  3GF5 A;  4E7Z A;  1MMA A;  2L3R A;  4N4G A;  3NEN A;  2YUN A;  3U23 A;  3REU A;  4M75 A;  1B3Q A;  4CH5 A;  3QBY A;  5CAI A;  4M78 E;  3X20 B;  5LJ5 d;  8AT1 B;  4YRF A;  3JSC A;  1UG1 A;  1K0S A;  1YHQ Q;  4Q6G A;  1N6A A;  4JUV A;  2DTO A;  1I4K 1;  3I55 A;  1KC8 R;  3BFM A;  2KRO A;  1QW1 A;  1GL5 A;  2P84 A;  3VS4 A;  2B86 A;  3VBB A;  2JMC A;  2AKL A;  3CCL T;  1YWO A;  4ZN1 A;  1WA7 A;  1IHW A;  1XTD A;  4KT0 E;  5GAN 3;  2RN8 A;  3QDR B;  3OY9 A;  3CCE Q;  5GAM f;  1IRE B;  1K1Z A;  3UA6 A;  1KFZ A;  3RR6 A;  1EQR A;  3NGP A;  1ABO A;  2QYZ A;  2GCX A;  3NTK A;  4A4K A;  1ZLM A;  2HBW A;  2HL5 C;  4M75 C;  3VS2 A;  4WI1 A;  2QGG A;  3INZ A;  5FU7 B;  4E2F B;  3CME T;  1Y96 B;  1B70 A;  2E4H A;  1D09 B;  1B8A A;  3EFO B;  2KGT A;  2JMA A;  2RO0 A;  4MDW A;  3H6Z A;  2RQR A;  2YT6 A;  1NLO C;  1USY A;  3PZC A;  3MET A;  4ZTU B;  2P0P A;  1FMK A;  4P3P A;  2O4X A;  4OMQ A;  1FYF A;  3M4G A;  1QCN A;  2LNH B;  1VYU A;  4X34 A;  3REX A;  1VIF A;  3EG9 A;  4LVI A;  2DRM A;  5HK0 A;  2DF6 A;  3G6E A;  1WU7 A;  3OD1 A;  4AT1 B;  2HSE B;  2KE9 A;  3LLR A;  4BI3 A;  2EYY A;  3TU4 K;  2ZTG A;  3TRE A;  1WIE A;  3LH5 A;  2FHD A;  3V8J A;  1BI1 A;  3ERR A;  2YRD A;  1FWZ A;  3OSS C;  2F5T X;  1YCY A;  4CC4 B;  4ZTF A;  3CC2 Q;  2ESW A;  1LVK A;  1NJ8 A;  3OYI A;  4YYE A;  3I5S A;  4OF1 A;  3KBG A;  2Y90 A;  3GBQ A;  3CCR A;  5IT9 E;  5HKC A;  4M78 F;  4C8Q B;  2CZ6 B;  4IIM A;  5K1P A;  2IY5 B;  3EAE A;  4UC4 A;  1VA7 A;  2E6N A;  3EHR A;  2XI9 A;  3L2V A;  1USY C;  2ZCE A;  1W66 A;  4Y92 A;  1K0X A;  3G71 A;  4EMK A;  2PNI A;  1K8A R;  4IUT A;  2JTF A;  5KYY B;  1YHQ T;  1XQH A;  4KBM B;  2RPN A;  1HC7 A;  1NEB A;  4FT2 A;  3C4S A;  3FB9 A;  2QHV A;  4KUL A;  1BI0 A;  1LPL A;  4M77 B;  4M75 E;  4GY5 A;  4C92 G;  2H3E B;  4B6M A;  1LYL A;  2DE0 X;  1V76 A;  3JCM P;  3G6E Q;  1VQP Q;  1VQ8 Q;  3UAT A;  1KK7 A;  4RUG A;  2E5A A;  4OMM A;  3CCE T;  1ABQ A;  2DK3 A;  5GAO m;  2ZT5 A;  5GAM j;  1UUE A;  1HJD A;  1E7O A;  3OYA A;  3QO3 A;  4O2D A;  1WQW A;  2DZ9 A;  1LJO A;  1AZE A;  2ZT8 A;  1BI2 A;  1QCO A;  2X4X A;  3MF2 A;  4J5Y A;  2L89 A;  3CCR Q;  3LH0 A;  4C5H A;  2XID A;  2QG9 B;  1TUD A;  4DBR A;  1YJW Q;  4ZTJ A;  1NZ9 A;  3H41 A;  5GAN h;  2ED1 A;  4A4H A;  4K86 A;  2QI2 A;  2LDM A;  1IRX A;  4H2Y A;  4N4I A;  1M4Z A;  2CH4 W;  1AWO A;  1KG1 A;  1M3A A;  4PJJ A;  2DXT A;  4DBQ A;  4HWO A;  2AZS A;  2PUK B;  3UFG A;  1RAG B;  4CI0 C;  2QQB A;  2I4L A;  3OYG A;  3HXZ A;  4BW9 A;  1S72 Q;  5KE2 A;  3FJP A;  2G3R A;  3H0H A;  2W0Z A;  4XTU A;  2G4C A;  4H2T A;  4ZTZ B;  1VQ7 A;  1VQN Q;  2EVR A;  3JAM E;  4MMK A;  2NWM A;  3RF1 A;  3O8V A;  3CC2 T;  1KQS S;  2GGR A;  5FRO A;  1G2B A;  4K11 A;  12AS A;  4II1 A;  3SD4 A;  3LYI A;  3OYJ A;  1WZO A;  5ELN A;  2XDP A;  2F1L A;  1Q7Y R;  2XKO C;  2ZPI B;  2F2V A;  2NUT B;  5LJ3 h;  3CPW A;  3NHN A;  2LX9 A;  1Q81 R;  3HFZ B;  1EIY A;  2JN0 A;  1MMG A;  1H92 A;  2RHS B;  4V2S A;  2XK0 A;  1PCX A;  1TG0 A;  5AT1 B;  5LJ5 h;  4P73 A;  5D6Y A;  2J7I A;  2RH2 A;  4M75 F;  1M8V A;  3OW2 S;  1HD3 A;  1EIF A;  1DJ7 B;  1JRI A;  2DIL A;  2ZR2 A;  3P8T A;  2Q7G A;  4RTW A;  3PT9 A;  3UDC A;  3BE3 A;  2L3P A;  4P72 A;  5CO7 A;  5GAN 4;  2X4J A;  3Q1J A;  1OOT A;  3L42 A;  4O6J A;  2E3C A;  3G6E T;  1VQP T;  1VQ8 T;  3C95 A;  1PSE A;  4RQE A;  2HQE A;  2O31 A;  1VQ6 A;  2FPD A;  4PJL A;  4TVR A;  5DM7 R;  2DL5 A;  2HCK A;  4C92 A;  2GFA A;  4LD9 K;  3M9Q A;  1X56 A;  3H8Z A;  2KR3 A;  2KBT A;  4AMC A;  2RK1 A;  2AKK A;  4XU2 A;  4ZGE B;  4NL3 A;  1I81 A;  1YJN Q;  2NUP A;  2DMO A;  3PNW C;  4ZGJ B;  2LJ0 A;  4LDW A;  1FMV A;  3CCR T;  1ARK A;  2DNU A;  4JJN K;  3UT1 A;  4P73 C;  3J80 E;  1Q7Y C;  1D0Y A;  2WAC A;  3ME9 A;  2QQS A;  2ROL A;  3LGL A;  2LCS A;  3VRZ A;  4N4H A;  4JZ3 A;  3G71 T;  3AHU A;  3OYM A;  2QDY B;  3CCJ Q;  3L2Z A;  3OYB A;  2EQJ A;  3UGT A;  3EHQ A;  3HRT A;  1WHH A;  4PJN A;  3JB9 H;  4J9G A;  1G3T A;  1ZX6 A;  1VYT A;  5KYN A;  3R07 A;  2PZ1 A;  3CCM A;  1B7Y A;  2ART A;  3VRY A;  1UGP B;  1VQN T;  2W10 A;  3LWI A;  3CXC S;  1UEC A;  1VQO Q;  2QA4 A;  2X3W D;  3EGD A;  3FRN A;  3F70 A;  1G51 A;  4JPB W;  4XU3 A;  2E1H A;  2HDA A;  1VQ6 Q;  4HVU A;  1K9M R;  4DEX A;  2IIM A;  1NJ5 A;  3CCU Q;  2E3I A;  1IO6 A;  1NYG A;  1TTH B;  2JZ2 A;  1Z7M A;  2D1X A;  1IGU A;  1RLQ C;  2CKK A;  2ZT6 A;  3M0Q A;  4C5G A;  3C12 A;  4IUV A;  5I2M A;  3SDZ A;  1NJ6 A;  4LUD A;  1IZ6 A;  2P0K A;  1QVG S;  4YRS A;  3EGX B;  1GGM A;  1JXO A;  2GFU A;  2EAY A;  2E64 A;  3A7U A;  3LX7 A;  4RCC A;  2AT1 B;  3DKM A;  5KYU B;  3VS5 A;  3I56 A;  4PFZ A;  2CIM A;  1HXD A;  4DPG A;  2MCN A;  2CP7 A;  4DEY A;  4QQG A;  3OBY A;  1QMC A;  2FL7 A;  1D0Z A;  4AFS C;  1M1G A;  3HRU A;  4F04 B;  4P71 A;  4HT9 A;  2LCC A;  2R5M A;  5CQX A;  4WJ3 M;  1AVZ C;  4HVV A;  5KYW A;  3E9H A;  1E6H A;  3PGG A;  1G8X A;  1ZSZ C;  3H0F A;  4RMO A;  1KC8 U;  2OJ2 A;  4UPA A;  2VXE A;  1K9M C;  1YJN T;  3I35 A;  2C0O A;  4JJD A;  3TEH B;  1C6V X;  3HHT B;  2F69 A;  4XAX B;  3CMA A;  1VQL Q;  3E9G A;  4HVW A;  2CJA A;  4EMH A;  2VGM A;  3OS0 A;  1H4S A;  4MZM A;  4M78 D;  2RHZ A;  3MCA B;  5CKH A;  3ZFJ A;  5GAO r;  3PE0 A;  5A0G A;  4A54 A;  1BKB A;  3CPW P;  3PIP A;  4H2U A;  2QHT A;  1GBR A;  3CCJ T;  4YCU A;  1GFC A;  1JXM A;  3RES A;  1U1S A;  2ZAE A;  3J7A F;  5GMK l;  5FU6 B;  4PJM A;  3QUI A;  1PKT A;  1YI2 A;  1M2V A;  4P71 C;  1H3Z A;  1H4T A;  4TVA B;  1KQ2 A;  4QQD A;  4HCB A;  3TEE A;  1WJR A;  3OYC A;  2FEI A;  3RUX A;  1WHG A;  1VQO T;  3S3O A;  3HSB A;  1SHF A;  4A63 B;  5C6S A;  4JS5 A;  2CDT A;  2JT4 A;  3QYG B;  3OYH A;  2ODR C;  4A53 A;  1VQ6 T;  2XG8 D;  3MKD A;  3M57 A;  4LUE A;  3CCU T;  2RQT A;  2L2P A;  4E7J A;  2XMF A;  1GXI E;  2VB6 A;  2PMF A;  3HRI A;  1D0X A;  2CYZ B;  4BDZ A;  3OA6 A;  2Z0W A;  4BDY A;  5D6X A;  2HQX A;  1O75 A;  1G3W A;  2PVO B;  1QP3 A;  3CCL Q;  4IUQ A;  1B07 A;  2Q5H A;  1ATI A;  3MEA A;  3GPL A;  4X9D A;  1GBQ A;  1OU9 A;  3RDV A;  1NPP A;  2FO0 A;  2E10 A;  2KYB A;  2X51 A;  2GF7 A;  1SEM A;  3CCS Q;  1BIA A;  2CT3 A;  1G3Y A;  4ME7 A;  3G7Z A;  5CQY A;  2ENM A;  3CCV A;  2IY5 A;  1RL2 A;  1PHT A;  3ASK A;  4LDV A;  4M7A B;  1K8A U;  5HY6 A;  3M0U A;  2D9T A;  2ZPF B;  4HCZ A;  1I5O B;  3CC4 A;  4HCK A;  2JVV A;  3P8D A;  1TU0 B;  1K9A A;  4RTT A;  3ZEH A;  2K5I A;  4C0Z A;  4KRT A;  1RAD B;  4J6W A;  4P74 A;  5KYY A;  1YFN A;  2CP5 A;  2CZ7 B;  3A8G B;  3GNF B;  1GCQ C;  3A8O B;  3NEL A;  1OU8 A;  4FT4 A;  4DA4 A;  1VQL T;  4RTY A;  2EYQ A;  2ZZF A;  4ELZ C;  1W4S A;  3CCQ A;  2AKW B;  1GRI A;  4AG1 C;  4F7U G;  4M77 A;  4C0F A;  1MND A;  3QO7 A;  3KFU A;  2LQK A;  1WHL A;  2O9S A;  4PJO G;  4H2V A;  1X43 A;  3QWY A;  5HK3 A;  1YIJ A;  1U5S A;  5GAN g;  1N8R R;  1MMD A;  5GAN 8;  4M75 D;  2MPX C;  4KUI A;  2YWW A;  4Q5W A;  2F2X A;  4XTY A;  1U8R A;  5KCH A;  2RJF A;  4M7D G;  1Z9Z A;  1BK2 A;  4HA8 A;  1NJI R;  1X75 C;  2JXB A;  1XJW B;  4PL6 A;  2P5I A;  5LJ3 d;  5ECA A;  4QVD A;  4E7H A;  3X26 B;  1BCM A;  2Y4Y A;  3SWN C;  1VQ9 A;  4KGZ B;  4HT4 A;  1M30 A;  5J26 A;  1QKW A;  2C7I A;  5FLX E;  4EO4 A;  4KR2 A;  2CSQ A;  1E1T A;  4LVM A;  3HXU A;  3M5A A;  1ZSG A;  3KFV A;  1CKA A;  2OTJ A;  4EDU A;  2M0O A;  3AT1 B;  2XDD A;  4GLM A;  1PKS A;  3JCM Q;  3FEO A;  5CVI A;  3ER0 A;  5DLO A;  5LJ3 g;  2QEX A;  3QDF A;  4HVC A;  1Q7Y U;  2ARS A;  3V8L A;  4XTV A;  3CCS T;  2BZY A;  5LJ5 g;  3A8M B;  1Q81 U;  3H0I A;  5ELO A;  1KD1 C;  1N8R C;  2QAZ A;  1OPK A;  2M9U A;  2RM4 A;  2DL8 A;  4D8D A;  3HFZ A;  2RHS A;  3RL6 A;  4BAC A;  1NJI C;  5L23 A;  2K5F A;  2H3J A;  4FM4 B;  2DZC A;  1QF6 A;  3JCM J;  2HKQ B;  3QG1 A;  1VQM A;  4CH3 A;  2J06 A;  5L8R E;  2K3X A;  4DBH A;  3TSW A;  1I0C A;  3GNG A;  2K2V A;  2M1H A;  2EIF A;  2RB6 A;  2DPP B;  5CKE A;  1NNH A;  3I55 Q;  4RTV A;  3UWN A;  4AFU C;  4OB1 B;  4DBF A;  2KT1 A;  4F7U A;  1TUC A;  3VJP A;  3TQ7 P;  4XU1 A;  4LNP A;  3X28 B;  4CS3 A;  4H2X A;  2A08 A;  4XEO A;  3I9Q A;  4LDX A;  4PJO A;  1ZUY A;  2EFI A;  1NYF A;  2COY A;  3HRS A;  5GAM e;  2JW4 A;  4NOY A;  1QWF A;  1V29 B;  4FYW B;  2NUZ A;  1MHN A;  2DDZ A;  5IXB A;  1WYX A;  2V8K A;  3RNJ A;  1RAE B;  1NLP C;  4LXC A;  4DQ2 A;  4M7D A;  3EH2 A;  1C0M A;  1WFW A;  4R55 A;  4HWS A;  4C0G A;  1Z9Q A;  3M53 A;  2I0N A;  1H4V B;  3QO5 A;  5A0D A;  1BYM A;  2CJ9 A;  1X2Q A;  3QPH A;  2KQW A;  1KHI A;  1Q82 R;  2WSE E;  4WJ4 A;  1M9S A;  1J3T A;  2LQW A;  1S1N A;  4XTZ A;  1G83 A;  5AYF A;  1VQM Q;  9ATC B;  4YRO A;  2CRE A;  3MEY A;  3EGU A;  1ACM B;  1D1A A;  4M4Z A;  3REA B;  1K9M U;  1SSH A;  3P8H A;  1EVK A;  4PJO C;  2CP6 A;  3L4G B;  3VQY A;  3QWX X;  2OX7 A;  4AFQ C;  4QVZ A;  3UA7 A;  1YIJ T;  2R5A A;  2V1Q A;  1AT1 B;  2YUQ A;  3GIB A;  1U3O A;  1ZBJ A;  2EJF A;  3M58 A;  3JCM V;  3PMI A;  4M7D C;  5EC7 A;  2DQ0 A;  2MWO A;  4EMK C;  2YUO A;  1Q86 U;  2ALY B;  4Q15 A;  2FZC B;  3EGX A;  4YP0 A;  5KH6 A;  1M90 C;  3EFS A;  3QYH B;  4FL6 A;  1WLE A;  2VC8 A;  11AS A;  4J83 A;  1JU5 C;  3I5R A;  3PVL A;  1D1C A;  3UH0 A;  3G71 Q;  2DER A;  4LVL A;  5CKF A;  2AMC B;  3UGQ A;  3ZBD A;  3CPW S;  2KRN A;  4M7A G;  1PRL C;  4PNO A;  1Q82 C;  2KK4 A;  4XU0 A;  2OAW A;  1JJC A;  2CH4 A;  3I55 T;  1XOV A;  5GMK e;  1EOV A;  2BZX A;  1E22 A;  5A2Q E;  2KRM A;  3A8H B;  1YFT A;  1UGV A;  4M75 B;  4RTZ A;  3OS2 A;  3VQV A;  4RTX A;  3C94 A;  3TUP A;  2RQW A;  2I4N A;  4G85 A;  3FLG A;  1UJY A;  1X2G A;  2QDL A;  2BZ8 A;  2RHU A;  3TEH A;  2VUB A;  2FVU A;  2KEA A;  1K73 U;  2AHJ B;  1M1K R;  2P0Q A;  4ORZ A;  2ZNI A;  5GAM d;  1VQK A;  4F7U E;  1W2B A;  4P5N A;  3HXW A;  2RMO A;  4LVK A;  3M56 A;  4N0A A;  1JJ2 S;  3L2R A;  4PG3 A;  1U06 A;  3R6O A;  1SRL A;  3KUF A;  3L1A A;  4XEM A;  4PJO E;  1YWP A;  3ULR B;  2KNB B;  2DIQ A;  5FWC A;  5FRM A;  4BE0 A;  4QVC A;  2LZ6 B;  3HFN A;  1VQM T;  2DVE A;  2CSI A;  4C92 D;  1RAI B;  2YLB A;  3N5B B;  3JCM f;  3HXX A;  1YB3 A;  5GMK j;  4PK4 A;  2LX7 A;  3EG2 A;  4M7D E;  1B70 B;  1KJW A;  1PG5 B;  1X6G A;  4CS4 A;  2RJE A;  2WSC E;  2ZPB B;  2I2L A;  1NM7 A;  2BKD N;  5F5W A;  3RMS A;  1VQ7 Q;  5IAY A;  1WX6 A;  2RI2 A;  3BW1 A;  1A0N B;  2JUF A;  2RA2 A;  1M5Q 1;  4LNS A;  4BB7 A;  2FZK B;  2DTI A;  5KCO A;  2LT1 A;  4C0D C;  3EG9 B;  4UP9 A;  4PLL A;  5GAO l;  2F2W A;  1NBE B;  1I5L A;  1M1K C;  2DFU A;  1OX9 A;  4AH6 A;  1R77 A;  1WHJ A;  5C53 B;  2VVK A;  1KIK A;  3EH1 A;  1SRY A;  4HXJ A;  4E47 A;  1UJ0 A;  3HPW A;  2F5K A;  4PKC C;  2X9H A;  1B34 B;  3MF1 A;  4WCI A;  1UDL A;  4P72 C;  2Q7H A;  3VS1 A;  3OW2 A;  1OZ2 A;  1PD0 A;  2RJD A;  3P8V A;  2QHS A;  4HKE A;  1WI7 A;  2XD0 A;  4M7A A;  5IHN A;  2DQ3 A;  1Y71 A;  1QCF A;  2PQW A;  5GAO n;  3JCM e;  4C92 C;  3VYG A;  1OQK A;  5IHK A;  2M16 A;  5DLQ E;  2KRS A;  4YRC A;  2M0Y A;  5GAN 2;  2P0L A;  3MP1 A;  1X55 A;  2I4O A;  4F7U F;  4P75 A;  1V1C A;  4KQE A;  2BE9 B;  3QZ5 B;  2EKH A;  3OQ5 A;  2YHT A;  3QKJ A;  2KXD A;  4FSS A;  2XGT A;  4X1V A;  5GAN f;  2EQK A;  1RUW A;  4PJO F;  1N9S A;  1MMN A;  3CD6 A;  1VYV A;  2DJZ A;  3D7S B;  2FRW A;  3M54 A;  3RMQ A;  4TTV A;  3DLM A;  3OS1 A;  3NMZ C;  1Z7N A;  4QT7 A;  1ADJ A;  1N8R U; 
#chains in the Genus database with same CATH homology
 4J8O A;  4M7D F;  1QVP A;  3HFO A;  3LWH A;  4LDU A;  3JCM c;  4C8Q G;  3V8K A;  1G5H A;  2EKO A;  3T9N A;  3CEY A;  4BI4 A;  2E6Z A;  2ODR D;  4ZIB A;  3CPF A;  4P75 C;  3RKW A;  1VQ7 T;  4VUB A;  2DIG A;  2EL9 A;  5A0L A;  5CCA A;  1H4Q A;  1E1O A;  2ZPH B;  1VQ4 A;  5GMK i;  1H64 1;  3S3M A;  1NYQ A;  4G84 A;  3A5Z B;  2XDB A;  1XNI A;  1FXX A;  1R8O B;  4M77 G;  2I4M A;  4MML A;  3BY7 A;  3JRZ A;  2LCL A;  1KOG A;  2E41 A;  4HCC A;  3OYD A;  4C92 E;  2RHI A;  3RIR A;  2A7Y A;  3CC7 A;  1AHJ B;  1QVG A;  4OGC A;  5J39 A;  1OZ3 A;  1QVF A;  3DSQ A;  2VGN A;  2MMP A;  3S3N A;  3V7R A;  2MF2 A;  5M9O A;  1EIY B;  4ELY C;  1Y96 A;  4C5E A;  2DXB A;  4MDX A;  3TEG A;  3MP8 A;  2R57 A;  4JLG A;  3X25 B;  3HL8 A;  4P3O A;  4QW2 A;  2ZIN A;  1D3B B;  1UGR B;  5GAN j;  4JS4 A;  4CH4 A;  5GAM h;  2RI5 A;  4BI8 B;  3HFV A;  3QZ9 B;  4L59 A;  3NFC A;  4C8Q D;  5I21 A;  3HKS A;  1UB4 A;  4JRK A;  2Q5I A;  4OGE A;  1QP2 A;  1BI3 A;  3OYL A;  2FB7 A;  3DLL A;  1RI0 A;  5FU7 C;  1SES A;  3QJY A;  3ICA A;  1PYS B;  4C8Q A;  3A8L B;  4BD3 A;  4YRG A;  4NS5 A;  3CCM T;  5CKD A;  2WSF E;  2OTL A;  2BUD A;  4BUG A;  4IUU A;  1KHC A;  1Q82 U;  4BE2 A;  3M59 A;  2QA4 T;  3IKM B;  3I7F A;  3QSU A;  4YRT A;  4M77 D;  1VIE A;  2RHQ B;  5J3B A;  4PHC A;  4IKF A;  2EQM A;  4C92 F;  2ARU A;  1SET A;  4YRP A;  3OYN A;  4E51 A;  4YRR A;  1WQ7 A;  2ZZE A;  1X6O A;  1WJS A;  1WJQ A;  4J6Y A;  3JCM W;  4JDS A;  1YHQ A;  1E24 A;  3L4G A;  2FYK A;  1YFS A;  4OB3 B;  3PMT A;  4C8Q C;  1JBM A;  3I56 T;  2DU5 A;  2DKG A;  2LRQ A;  2Q7E A;  2ALY A;  4E7K A;  2K57 A;  3MEW A;  3CCE A;  2MI6 A;  5GMK h;  1B76 A;  4P74 C;  3P8Y A;  3BDU A;  3VQX A;  1HTT A;  3A32 A;  4RQF A;  3VV0 A;  3G4S A;  2ZZG A;  5D6W A;  4ZN3 A;  4QQ6 A;  3VKI A;  4YPF A;  4YTL A;  2AMC A;  1OYX A;  3V7S A;  1N9W A;  4M77 C;  2KMT A;  2QHU A;  4TQF A;  1IL2 A;  3URG A;  4J7I A;  1Y7X A;  3CMA T;  1ZBX A;  5I2S A;  4MZT A;  4K87 A;  2ZZD A;  2OAU A;  1NJ2 A;  4HWR A;  2J3M A;  3CC7 T;  2E5Q A;  1U1T A;  1M1K U;  5E3I A;  2XIC A;  4YRQ A;  2EQU A;  1WGS A;  2QQR A;  2ZGW A;  3NTH A;  1NPR A;  4DOV A;  3M4P A;  3IG2 A;  2C06 A;  1YI2 T;  2MAM A;  2RHY A;  4J7F A;  3OS5 A;  2CS7 A;  2ZIO A;  3CC2 A;  2O01 E;  2A3L A;  2QQA A;  4OLF A;  3JB9 G;  4M78 B;  4C8Q E;  5GAO q;  4LDY A;  4PJO D;  1YFR A;  3RKY A;  1WYD A;  2PME A;  1G5I A;  3HTZ A;  4BY6 B;  2DTH A;  2X35 A;  2ZCF B;  2VXF A;  4CS2 A;  4XTW A;  4NCX A;  1UGS B;  2VV5 A;  1FX7 A;  4M7D D;  2J3L A;  2LVM A;  3SFM A;  3IKL A;  4M77 E;  4EPC A;  2ZNJ A;  1VQP A;  1KC8 C;  1VQ8 A;  3A7A A;  3CCV T;  1WNL A;  4IUR A;  5C52 B;  3FIF A;  2HAX A;  4H2W A;  2VYT A;  3JCM h;  4LVJ A;  2OTL T;  3VUB A;  4NL2 A;  4CRI A;  4RCB A;  3CC4 T;  2HBP A;  3GP8 A;  3QII A;  1B34 A;  2DU7 A;  3P8B B;  4ATO A;  1YJW A;  1I8F A;  2RHX A;  3FC3 A;  3CCQ T;  4YRJ A;  3WVD B;  4HWT A;  1S72 A;  2ZR3 A;  3SWN B;  4UP8 A;  3MP6 A;  4A4G A;  1VQN A;  3HP9 A;  3VYH B;  3W3S A;  4YRI A;  2KVQ G;  1PSF A;  2LNV A;  3JB9 D;  4C8Q F;  2E70 A;  4RKU E;  2KY9 A;  2XHC A;  1ASZ A;  3QO8 A;  2ZPE B;  3HY1 A;  1BIB A;  3BDL A;  3G4S T;  3E9I A;  1W2B S;  2ZXF A;  1VQ9 T;  3PCO B;  1ZQ1 A;  4A4E A;  4FSX A;  3M4Q A;  1UEB A;  4P3N A;  4IUP A;  1N27 A;  3WVE B;  4KUD K;  4XQ3 A;  2E65 A;  4OMF B;  2KSS A;  3NTI A;  3A31 A;  2OTJ T;  4OB0 B;  4M77 F;  2ZPG B;  3OYK A;  1K8A C;  1KMM A;  1UGQ B;  1LNX A;  4B9X A;  1VQZ A;  3LC0 A;  5EG2 A;  3WXM B;  2QEX T;  4TWA A;  3DB3 A;  4DOW A;  1X54 A;  4X5O A;  2K4Y A;  3A5Z A;  2PVG B;  1RIQ A;  1G3S A;  3RER A;  4X9C A;  2V8I A;  4XK8 E;  4HWP A;  3JB9 I;  1ASY A;  4YCV A;  5LL6 S;  2CJB A;  4CH6 A;  4JRQ A;  1YJN A;  4L6V 5;  4YRL A;  2LQ8 A;  1ZHI A;  2JNG A;  3L2Q A;  3PIO A;  2RJC A;  4TVA A;  2P4T A;  3A74 A;  3RAC A;  1N9R A;  3CCJ A;  5GAM g;  2CZ1 B;  3LSQ A;  1VQ5 A;  4WF2 A;  2IG0 A;  5KE3 A;  4RDX A;  1D3B A;  2GQV A;  2O4X B;  1KQS A;  4O5V A;  3PTA A;  1EVL A;  5CKB A;  1VQO A;  1QE0 A;  4N0A C;  3L2W A;  3EFR A;  4JRI A;  2YRV A;  4YRN A;  4F7U B;  4K88 A;  3JB9 J;  2EJG A;  3CCU A;  3GLX A;  5FU6 C;  5CR2 A;  4H2X B;  1JJ2 A;  3J81 E;  4H2S A;  3RKX A;  4M7A D;  4PJO B;  2QTX A;  3JCM b;  4ZGD B;  2PU9 B;  5FRN A;  1YJ9 A;  1BBU A;  4A4F A;  5IN1 A;  2CZ0 B;  1PYS A;  1Y07 A;  1YJW T;  4RG2 A;  1X01 A;  5GMK m;  3HRK A;  4M7D B;  2R58 A;  1Q81 C;  4EMK B;  2V8J A;  4M78 G;  3OYE A;  1SSF A;  2CGH A;  2RHQ A;  4BWA A;  5GAO p;  2YLC A;  1S72 T;  1VUB A;  3L2U A;  3LSS A;  2DO3 A;  3QNE A;  1YIT A;  3MO8 A;  4YRM A;  5C51 B;  1NYR A;  4Y91 A;  2AKW A;  3G1Z A;  2RI3 A;  2JTM A;  1HK9 A;  4J15 A;  2HD0 A;  4R56 A;  1KD1 U;  1KQ1 A;  1P92 A;  3NEM A;  1VQL A;  2EWN A;  3M4Y A;  2BIV A;  4M7A C;  1KMN A;  1NJI U;  2HNI A;  4YCW A;  3KXT A;  2RK2 A;  2KDS A;  2NS6 A;  3RGL A;  4FIB A;  4TVY A;  1ADY A;  3MHX A;  4L5G A;  4BE1 A;  3NET A;  1QVF S;  3CXC A;  4Z02 A;  4YRE A;  4Y28 E;  4PLI A;  5LJ3 f;  3WQZ A;  4H02 A;  3LW5 E;  1JJC B;  3CBO A;  5LJ5 f;  4J6X A;  5GAN e;  3OMC A;  4RMF A;  1VQK T;  1LOJ A;  3QJ6 A;  3LGF A;  5GAN 5;  1TH7 A;  3MEV A;  1X2H A;  3HXY A;  1NJ1 A;  3FDR A;  2LT4 A;  2DD4 A;  2EJ9 A;  3M55 A;  4E7L A;  4JRP A;  2QQ9 A;  3QXE B;  4B9W A;  3CCL A;  1WPY A;  3JB9 F;  4C5I A;  2PVD B;  4C0D B;  3E19 A;  1NE8 A;  3CCS A;  2QXF A;  4OB2 B;  3JCM d;  1VQ5 T;  4YDQ A;  1Q86 C;  3UPU A;  3A7R A;  4M78 A;  4TQD A;  1MGQ A;  1YGB A;  3OYF A;  2E12 A;  2XTI A;  2RD1 A;  4UP7 A;  4M7A E;  3CME A;  5LJ3 e;  3QTC A;  4M75 G;  3CBM A;  1EFW A;  2DXC A;  3OB9 A;  1OI1 A;  2LTO A;  5LJ5 e;  4MZP A;  3QHS A;  2MWP A;  2PUO B;  1JB0 E;  3TCJ A;  4C92 B;  3OBW A;  2DXU A;  3JCM X;  3S6W A;  2K5L A;  5GAN 6;  1BBW A;  1C0A A;  3JCM g;  3X24 B;  2IVW A;  2A8E A;  1YJ9 T;  3PFS A;  1M90 U;  3VU3 C;  3BJU A;  3DB4 A;  2XU8 A;  3OSV A;  4XTX A;  5CK9 A;  2NLU A;  3OMG A;  4TVW A;  1K73 C;  2LC4 A;  4M78 C;  2DD5 A;  4OVA A;  5C0M A;  2C8M A;  3HXV A;  1L0W A;  2ZIM A;  2Y4X A;  1G5V A;  5CIU A;  2D6F A;  5GAN 7;  1O9S A;  2DAQ A;  5KNN A;  4L87 A;  3CBP A;  5LJ3 j;  2K3Y A;  3A5Y A;  1B7Y B;  2X4W A;  3E9F A;  5K1X A;  4BY6 C;  1YIT T;  3CD6 T;  3MEU A;  5LJ5 j;  1M1F A;  5GAN d;  4EMG A;  2L8D A;  3IAL A;  3VQW A;  3V7C A;  4E7I A;  4RG8 A;  3HY0 A;  3GOX A;  3MQZ A;  2DEQ A;  3SB2 A;  3CMQ A;  5HGQ A;  3SWN A;  2KAF A;  5DY9 A;  4JLI A;  3VUZ A;  4EX5 A;  2ZT7 A;  1YBY A;  1SER A;  3OYY A;  4FU6 A;  2X4Y A;  4D6W A;  4M7A F;  2L5Q A;  4OP0 A;  4GLK A;  1VQ4 T;  4KR3 A;  2D0Q B;  4LD6 A;  3PCO A;  2B8A A;  1J5W A;  2JOY A;  4HT8 A;  3E1S A;  4YRK A;  3GF5 A;  2L3R A;  4N4G A;  3NEN A;  3REU A;  4M75 A;  4CH5 A;  3QBY A;  5CAI A;  4M78 E;  3X20 B;  5LJ5 d;  4YRF A;  3JSC A;  4Q6G A;  1N6A A;  4JUV A;  2DTO A;  1I4K 1;  3I55 A;  3BFM A;  1QW1 A;  3VBB A;  3CCL T;  4ZN1 A;  1XTD A;  4KT0 E;  5GAN 3;  3QDR B;  3OY9 A;  5GAM f;  1IRE B;  1EQR A;  2GCX A;  3NTK A;  4A4K A;  4M75 C;  4WI1 A;  3INZ A;  5FU7 B;  3CME T;  1Y96 B;  1B70 A;  1B8A A;  2RO0 A;  4MDW A;  3H6Z A;  1USY A;  4ZTU B;  3PZC A;  3MET A;  2P0P A;  4P3P A;  2O4X A;  1FYF A;  3M4G A;  4X34 A;  3REX A;  1VIF A;  4LVI A;  3G6E A;  5HK0 A;  1WU7 A;  3OD1 A;  3LLR A;  4BI3 A;  3TU4 K;  2ZTG A;  3TRE A;  2FHD A;  3V8J A;  1BI1 A;  3ERR A;  1FWZ A;  3OSS C;  2F5T X;  1YCY A;  4ZTF A;  1NJ8 A;  3OYI A;  4YYE A;  4OF1 A;  3KBG A;  2Y90 A;  3CCR A;  5IT9 E;  5HKC A;  4M78 F;  4C8Q B;  2CZ6 B;  2IY5 B;  3EAE A;  4UC4 A;  2E6N A;  2XI9 A;  3L2V A;  1USY C;  2ZCE A;  1W66 A;  3G71 A;  4EMK A;  4IUT A;  2JTF A;  1YHQ T;  1XQH A;  4KBM B;  1HC7 A;  4FT2 A;  3C4S A;  3FB9 A;  2QHV A;  4KUL A;  1BI0 A;  4M77 B;  4M75 E;  4GY5 A;  4C92 G;  1LYL A;  3JCM P;  2E5A A;  3CCE T;  2DK3 A;  5GAO m;  2ZT5 A;  5GAM j;  3OYA A;  3QO3 A;  4O2D A;  1WQW A;  2DZ9 A;  1LJO A;  2ZT8 A;  1BI2 A;  2X4X A;  3MF2 A;  4J5Y A;  2L89 A;  3LH0 A;  4C5H A;  2XID A;  4K86 A;  4ZTJ A;  1NZ9 A;  5GAN h;  4A4H A;  2QI2 A;  2LDM A;  4H2Y A;  4N4I A;  1M4Z A;  1KG1 A;  2DXT A;  4HWO A;  2PUK B;  3UFG A;  4CI0 C;  2QQB A;  2I4L A;  3OYG A;  3HXZ A;  4BW9 A;  5KE2 A;  3FJP A;  2G3R A;  4XTU A;  2G4C A;  4H2T A;  4ZTZ B;  1VQ7 A;  3JAM E;  4MMK A;  3RF1 A;  3O8V A;  3CC2 T;  1KQS S;  5FRO A;  12AS A;  4II1 A;  3SD4 A;  3LYI A;  3OYJ A;  5ELN A;  2XDP A;  2XKO C;  2ZPI B;  5LJ3 h;  3CPW A;  2LX9 A;  3HFZ B;  1EIY A;  2JN0 A;  2RHS B;  4V2S A;  2XK0 A;  4P73 A;  5LJ5 h;  5D6Y A;  2RH2 A;  4M75 F;  1M8V A;  3OW2 S;  1EIF A;  1DJ7 B;  1JRI A;  2ZR2 A;  3P8T A;  2Q7G A;  3PT9 A;  3UDC A;  4P72 A;  5CO7 A;  5GAN 4;  2X4J A;  3Q1J A;  3L42 A;  2E3C A;  4O6J A;  3G6E T;  1VQP T;  1VQ8 T;  3C95 A;  1PSE A;  4RQE A;  2HQE A;  1VQ6 A;  4TVR A;  5DM7 R;  4C92 A;  2GFA A;  4LD9 K;  3M9Q A;  1X56 A;  3H8Z A;  2RK1 A;  4XU2 A;  4ZGE B;  4NL3 A;  1I81 A;  3PNW C;  4ZGJ B;  4LDW A;  3CCR T;  4JJN K;  3UT1 A;  4P73 C;  3J80 E;  1Q7Y C;  2WAC A;  3ME9 A;  2QQS A;  3LGL A;  4N4H A;  3G71 T;  3AHU A;  3OYM A;  2QDY B;  3L2Z A;  3OYB A;  2EQJ A;  3UGT A;  3HRT A;  3JB9 H;  1G3T A;  3R07 A;  3CCM A;  1B7Y A;  2ART A;  1UGP B;  1VQN T;  3LWI A;  3CXC S;  2QA4 A;  3FRN A;  3F70 A;  1G51 A;  4XU3 A;  2E1H A;  1NJ5 A;  2JZ2 A;  1Z7M A;  2CKK A;  2ZT6 A;  4C5G A;  3C12 A;  4IUV A;  5I2M A;  3SDZ A;  1NJ6 A;  1IZ6 A;  2P0K A;  1QVG S;  4YRS A;  1GGM A;  2GFU A;  2EAY A;  2E64 A;  3A7U A;  3LX7 A;  4RCC A;  3DKM A;  3I56 A;  2CIM A;  1HXD A;  4DPG A;  4QQG A;  3OBY A;  2FL7 A;  1M1G A;  3HRU A;  4P71 A;  4HT9 A;  2LCC A;  2R5M A;  5CQX A;  4WJ3 M;  3E9H A;  3PGG A;  4RMO A;  1KC8 U;  4UPA A;  2VXE A;  1K9M C;  1YJN T;  3TEH B;  3HHT B;  2F69 A;  4XAX B;  3CMA A;  3E9G A;  2CJA A;  4EMH A;  2VGM A;  3OS0 A;  1H4S A;  4MZM A;  4M78 D;  2RHZ A;  3MCA B;  5CKH A;  3ZFJ A;  5GAO r;  5A0G A;  4A54 A;  1BKB A;  3PIP A;  4H2U A;  2QHT A;  3CCJ T;  4YCU A;  3RES A;  1U1S A;  3J7A F;  5GMK l;  5FU6 B;  3QUI A;  1YI2 A;  4P71 C;  1H3Z A;  1H4T A;  4TVA B;  1KQ2 A;  4QQD A;  4HCB A;  3TEE A;  1WJR A;  3OYC A;  3RUX A;  1VQO T;  3HSB A;  3S3O A;  5C6S A;  4JS5 A;  3OYH A;  3QYG B;  2ODR C;  4A53 A;  1VQ6 T;  2XG8 D;  3M57 A;  3CCU T;  4E7J A;  1GXI E;  2PMF A;  3HRI A;  2CYZ B;  4BDZ A;  3OA6 A;  4BDY A;  5D6X A;  2HQX A;  1O75 A;  1G3W A;  2PVO B;  1QP3 A;  4IUQ A;  2Q5H A;  1ATI A;  3MEA A;  3GPL A;  4X9D A;  1NPP A;  2E10 A;  2GF7 A;  1BIA A;  1G3Y A;  4ME7 A;  3G7Z A;  5CQY A;  3CCV A;  2IY5 A;  1RL2 A;  3ASK A;  4LDV A;  4M7A B;  1K8A U;  5HY6 A;  2D9T A;  2ZPF B;  4HCZ A;  3CC4 A;  2JVV A;  3P8D A;  3ZEH A;  2K5I A;  4C0Z A;  4J6W A;  4P74 A;  2CZ7 B;  3A8G B;  3GNF B;  3A8O B;  3NEL A;  4FT4 A;  4DA4 A;  1VQL T;  2EYQ A;  2ZZF A;  4ELZ C;  1W4S A;  3CCQ A;  2AKW B;  4F7U G;  4M77 A;  4C0F A;  3QO7 A;  3KFU A;  2LQK A;  4PJO G;  4H2V A;  5HK3 A;  1YIJ A;  5GAN g;  5GAN 8;  4M75 D;  4KUI A;  4Q5W A;  4XTY A;  1U8R A;  5KCH A;  2RJF A;  4M7D G;  4HA8 A;  1X75 C;  4PL6 A;  2P5I A;  5LJ3 d;  4QVD A;  4E7H A;  3X26 B;  2Y4Y A;  3SWN C;  1VQ9 A;  4HT4 A;  5J26 A;  2C7I A;  5FLX E;  4EO4 A;  4KR2 A;  1E1T A;  4LVM A;  3HXU A;  3M5A A;  2OTJ A;  4EDU A;  2M0O A;  2XDD A;  3JCM Q;  3FEO A;  5CVI A;  3ER0 A;  5DLO A;  5LJ3 g;  2QEX A;  4HVC A;  1Q7Y U;  2ARS A;  3V8L A;  4XTV A;  3CCS T;  5LJ5 g;  3A8M B;  1Q81 U;  5ELO A;  1KD1 C;  1N8R C;  2M9U A;  2RM4 A;  3HFZ A;  2RHS A;  3RL6 A;  4BAC A;  1NJI C;  2K5F A;  2H3J A;  4FM4 B;  2DZC A;  1QF6 A;  3JCM J;  3QG1 A;  1VQM A;  4CH3 A;  5L8R E;  2K3X A;  3GNG A;  2K2V A;  2M1H A;  2EIF A;  2RB6 A;  2DPP B;  5CKE A;  1NNH A;  3UWN A;  4OB1 B;  4F7U A;  3VJP A;  4XU1 A;  3X28 B;  4CS3 A;  4H2X A;  4XEO A;  4PJO A;  4LDX A;  2EFI A;  3HRS A;  5GAM e;  4NOY A;  1V29 B;  1MHN A;  2DDZ A;  2V8K A;  4DQ2 A;  4M7D A;  4R55 A;  4HWS A;  4C0G A;  3M53 A;  1H4V B;  3QO5 A;  5A0D A;  1BYM A;  2CJ9 A;  3QPH A;  2KQW A;  1KHI A;  2WSE E;  4WJ4 A;  1M9S A;  4XTZ A;  5AYF A;  4YRO A;  3MEY A;  1K9M U;  3P8H A;  1EVK A;  4PJO C;  3L4G B;  3VQY A;  4QVZ A;  1YIJ T;  2R5A A;  3GIB A;  2EJF A;  3M58 A;  3JCM V;  3PMI A;  4M7D C;  2DQ0 A;  2MWO A;  4EMK C;  1Q86 U;  2ALY B;  4Q15 A;  4YP0 A;  5KH6 A;  1M90 C;  3EFS A;  3QYH B;  4FL6 A;  1WLE A;  2VC8 A;  11AS A;  4J83 A;  3UH0 A;  4LVL A;  5CKF A;  2AMC B;  3UGQ A;  3ZBD A;  3CPW S;  4M7A G;  4PNO A;  1Q82 C;  2KK4 A;  4XU0 A;  1JJC A;  3I55 T;  1XOV A;  5GMK e;  1EOV A;  1E22 A;  5A2Q E;  3A8H B;  1YFT A;  4M75 B;  3OS2 A;  3VQV A;  3C94 A;  3TUP A;  2I4N A;  4G85 A;  3FLG A;  1X2G A;  2RHU A;  3TEH A;  2VUB A;  2FVU A;  1K73 U;  2AHJ B;  2P0Q A;  2ZNI A;  5GAM d;  1VQK A;  4F7U E;  1W2B A;  4P5N A;  3HXW A;  4LVK A;  3M56 A;  4N0A A;  1JJ2 S;  3L2R A;  4PG3 A;  3R6O A;  3KUF A;  3L1A A;  4XEM A;  4PJO E;  2DIQ A;  5FRM A;  4BE0 A;  4QVC A;  3HFN A;  1VQM T;  2DVE A;  4C92 D;  2YLB A;  3N5B B;  3JCM f;  3HXX A;  1YB3 A;  5GMK j;  4M7D E;  1B70 B;  4CS4 A;  2RJE A;  2WSC E;  2ZPB B;  2I2L A;  2BKD N;  5F5W A;  3RMS A;  5IAY A;  2RI2 A;  3BW1 A;  2JUF A;  2RA2 A;  1M5Q 1;  4LNS A;  4BB7 A;  5KCO A;  2DTI A;  2LT1 A;  4C0D C;  4UP9 A;  4PLL A;  5GAO l;  1I5L A;  1M1K C;  4AH6 A;  5C53 B;  1SRY A;  4E47 A;  3HPW A;  2F5K A;  4PKC C;  1B34 B;  3MF1 A;  4P72 C;  2Q7H A;  3OW2 A;  1OZ2 A;  2RJD A;  3P8V A;  2QHS A;  4HKE A;  2XD0 A;  4M7A A;  2DQ3 A;  1Y71 A;  2PQW A;  5GAO n;  3JCM e;  4C92 C;  3VYG A;  2M16 A;  5DLQ E;  4YRC A;  5GAN 2;  2P0L A;  3MP1 A;  1X55 A;  2I4O A;  4F7U F;  4P75 A;  4KQE A;  3QZ5 B;  3OQ5 A;  2YHT A;  3QKJ A;  2XGT A;  5GAN f;  2EQK A;  4PJO F;  1N9S A;  3CD6 A;  2DJZ A;  3M54 A;  3RMQ A;  4TTV A;  3DLM A;  3OS1 A;  1Z7N A;  5K1P A;  1ADJ A;  1N8R U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...