4XU2A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 87 with a 3'deoxy ribose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
264
structure length
262
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 90
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu2A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu2A01
1HXDA 2Q5IA 2QHVA 1B7YB 3BW1A 4C92F 1HTTA 4YCUA 4EX5A 4M7AA 1M8VA 3RL6A 2ARSA 1YB3A 4HT8A 3JB9D 1G5IA 4YRFA 3IKLA 4DPGA 3HXZA 1H4TA 4MMKA 3JB9I 5GANj 2DDZA 2DVEA 2CJBA 3PCOA 3HFNA 5C52B 4M75C 3HXUA 4C8QC 1H641 3L1AA 2AMCA 1C0AA 3REUA 3A32A 5GMKh 2IY5B 3MEYA 1I8FA 3V7SA 1NJ8A 3RKYA 3RUXA 5LJ3j 2YLBA 4JRIA 2ZIOA 4M78A 4X9DA 4C8QB 2VC8A 1E22A 3L2ZA 4M78D 5GMKj 3FJPA 4M78F 3MF2A 2DXTA 1YFRA 2ZNJA 4H2VA 4XTVA 4XU3A 3LC0A 4RMFA 3W3SA 4PJOE 1IL2A 3V8LA 1WQ7A 4F7UE 5LJ3e 2DKGA 2ARTA 2I4OA 4YRJA 3CMQA 5LJ5h 3JCMW 4P73C 5GMKl 3HXWA 5DY9A 4P3PA 5GAOq 3RIRA 4C92B 5K1PA 4PJOC 4N0AA 4XTXA 3A5ZA 2ZTGA 4M78G 5LJ5d 5HGQA 2AKWB 3REXA 3INZA 1USYA 1NJ1A 3MF1A 2J3MA 1NYQA 4J6XA 4WI1A 1ADJA 3P8YA 4LNSA 1Y96A 4XU2A 5I21A 3L4GA 5GAMh 3V8KA 3G1ZA 4TVYA 5ELNA 4YRPA 4M75G 4Q15A 5GMKe 4OLFA 4G84A 3TEGA 4RCCA 3HXXA 1B76A 4M77A 3VQXA 4P74C 1EIYA 1EQRA 4M7DB 5KNNA 4HWRA 4CH3A 4PNOA 5LJ5j 3A7RA 4XTWA 2E3CA 3VQWA 4HWTA 4HA8A 3V8JA 2DTIA 2DQ0A 1D3BA 5GAN6 2DXUA 3JCMd 2ALYA 1YCYA 3M4GA 1HK9A 4WF2A 4H2YA 2Q5HA 1B70B 3HXVA 4BWAA 5GAOl 2I2LA 2VXEA 2ODRD 3TUPA 1MGQA 1U1TA 4X9CA 4KR3A 4H2WA 3V7CA 4YRMA 1VQZA 5CAIA 3JCMP 2I4MA 4NCXA 3HRIA 3RGLA 4Q6GA 1SRYA 4C92C 4YRKA 4QVDA 4F7UG 1Z7MA 2ZR2A 2EJFA 2XGTA 4YPFA 1G5HA 2ZZGA 2QHUA 4C92G 1BBWA 3HFZA 1E1OA 2ZT5A 2EAYA 2RA2A 1KQ1A 2DZ9A 1YFSA 3P8VA 4YRIA 4C8QD 3JCMf 5GAN8 3QUIA 3QSUA 3L4GB 4C8QE 1X55A 2I4NA 3UGQA 1KMMA 2Q7HA 1KMNA 2ZR3A 1X54A 4P71C 4K88A 4EMKA 4C8QG 4EMGA 4CS2A 2FYKA 1WLEA 4OP0A 4UPAA 5GANe 2DZCA 4CH4A 3TEHA 3QO8A 2EJ9A 3QNEA 3JCMg 3R07A 4NOYA 1U1SA 4YP0A 4YRNA 5GAN2 4V2SA 4NL2A 3JCMJ 2J3LA 2AMCB 1B8AA 4UP8A 4C92D 4P75C 4P72C 3HFZB 3A5YA 4CS4A 3PZCA 3HSBA 4H2UA 3JCMh 2E41A 4M75B 2ZZEA 1X2HA 5GAN5 2I4LA 3HY0A 4J6WA 4E51A 2Y90A 2XTIA 5GMKi 1BBUA 4YROA 4YYEA 3JCMQ 1NYRA 4M78C 4XTZA 2C7IA 4EMKB 4YRGA 3HFOA 4P3NA 3NEMA 4ZTZB 4PHCA 4RCBA 3KFUA 3SB2A 3UH0A 4ZTUB 1X56A 4M7DA 3SWNC 4M77F 2DU5A 2DJZA 4M7DD 4M7AF 3VBBA 1N9SA 3PGGA 3FB9A 4M75F 1PYSA 4TQDA 2ARUA 2ZT7A 4M78E 1JRIA 1KQ2A 2RHQA 4RQFA 4WJ3M 2RHQB 4P73A 2ZIMA 4M7AE 5GAMg 4HWSA 4PJOD 4DQ2A 1NJ5A 5LJ3g 5GAN7 4M75A 4NL3A 5GANh 5GANf 2K57A 3BJUA 3NELA 3WQZA 4PJOA 3A31A 3I7FA 1NNHA 4F7UA 2QHTA 3A7UA 2E64A 1WU7A 4M75D 5LJ5g 1I81A 1ADYA 3HY1A 1B7YA 1GGMA 1KOGA 5GMKm 3JCMb 3RACA 4M7AC 2P5IA 2RHSA 3QO5A 4K86A 4JLIA 2EJGA 1EVKA 3JCMc 3JCMX 3AHUA 1H4SA 1N9RA 4C8QA 5E3IA 4ZIBA 4XTUA 2QHSA 4C92E 4HWOA 1B34A 5C51B 4M77B 1H4VB 3IKMB 1N9WA 3BDUA 4RQEA 3JB9H 2ZZFA 4TVWA 4PJOG 3SWNB 4H2SA 4A53A 5GAMj 2DU7A 2ZCEA 1W66A 1ASZA 1JJCA 2E5AA 2YHTA 1PYSB 4L87A 2EL9A 4K87A 4MMLA 1WQWA 3JB9G 4F7UB 3TEHB 2QTXA 2ZNIA 1BIBA 5GAN4 1SESA 2ALYB 1Z7NA 4CH6A 4UP9A 2CJ9A 2ZT6A 5C53B 1I5LA 2EWNA 2E65A 5LJ3f 3HRKA 1WPYA 2HNIA 1D3BB 4J15A 4CH5A 1TH7A 2RD1A 3GIBA 3LSSA 1YFTA 4JRKA 4CS3A 4PJOF 1WYDA 4M7AB 4YREA 3BY7A 4N0AC 5GANd 4HVCA 4BW9A 3QHSA 2RHSB 1E24A 2AKWA 3LSQA 3DSQA 4YCWA 2YLCA 4M7DF 3IALA 3VU3C 3JCMV 1NJ6A 4YRLA 4M77D 3QO7A 4QVCA 1SETA 4UP7A 4EMHA 4M7DE 3ERRA 2C8MA 1X01A 3V7RA 5GAMd 5GAMe 4PG3A 5LJ3h 4EMKC 5F5WA 1JJCB 3RF1A 1B70A 2PMFA 4H2XB 4XEMA 3UGTA 3VQVA 5LJ5e 5K1XA 3M4PA 4A54A 4M75E 4YRQA 3JB9J 3QO3A 1JBMA 1QE0A 2DTOA 3P8TA 4TTVA 4P3OA 4HWPA 4PJOB 4J5YA 4X5OA 1QF6A 5GANg 2VXFA 11ASA 4P72A 2DQ3A 4M7AD 3RKXA 1USYC 3JCMe 4HT9A 4YCVA 2CJAA 3RKWA 1BIAA 4RDXA 4XTYA 1RIQA 3RERA 2ZT8A 3E9HA 1Y96B 2CGHA 2RB6A 4TVAB 5GAMf 1ASYA 1H4QA 4F7UF 3BFMA 1EFWA 2CIMA 4M78B 4EO4A 2FB7A 3ICAA 3M4QA 1G51A 2ZGWA 1X2GA 3A74A 3HTZA 4M77C 4P74A 1EVLA 1SERA 1FYFA 2RM4A 5LJ5f 4Y91A 1WNLA 2ZXFA 4M7DC 1LOJA 3SWNA 4AH6A 1LYLA 3HFVA 1E1TA 4O2DA 1LJOA 3OD1A 5GAOm 1EIYB 3QTCA 2PMEA 2P0LA 4KR2A 3EFRA 4KQEA 4H02A 2Q7GA 4J6YA 4WJ4A 3NETA 3EFSA 5LJ3d 4M7AG 4H2XA 2DEQA 4JUVA 4H2TA 2E1HA 1NJ2A 4G85A 2DTHA 1LNXA 3HXYA 4XQ3A 12ASA 1ATIA 3A7AA 4YRSA 4C92A 4M77G 3PCOB 5GAN3 4YRTA 2E10A 3FIFA 4YDQA 2ZINA 5ELOA 1YGBA 2IY5A 4TVAA 4P75A 4XEOA 4M7DG 4YRCA 4YRRA 5GAOp 3IG2A 3RESA 4XU1A 5GAOr 1L0WA 3NENA 1B34B 1I4K1 1M5Q1 4TWAA 1HC7A 1J5WA 2Q7EA 3E9IA 4M77E 4P71A 1EOVA 3VQYA 4XU0A 5GAOn 3UFGA 4C8QF 3JB9F 2G4CA 2JN0A 4TQFA 2ODRC
chains in the Genus database with same CATH superfamily
5CQYA 1RI9A 2Q5IA 2CP6A 1VQ4A 1QCNA 3CCJQ 1M90U 2RHXA 1YJNQ 4YCUA 3RMSA 1WA7A 2KR3A 2ZPBB 3GNGA 3RDVA 2DL8A 3EH1A 3JB9I 5D6YA 2HKNA 3PCOA 3G6ET 4KUDK 4KGXB 5CQXA 2A8EA 3HXUA 2RI3A 5HY6A 1G3YA 1C0AA 1K73U 3I55A 3CCEA 5FWBA 3V7SA 1NJ8A 1CKBA 3RKYA 3X28B 4JRIA 3CPWS 3L2RA 4ATOA 1QQJA 1VQKT 3C0CA 3MEWA 3KFVA 1E22A 2HMAA 5GMKj 2CZ6B 3FJPA 4HCZA 3MF2A 2QEXT 1WLPB 1TSFA 2LTOA 4XU3A 4RMFA 2P4RA 3W3SA 4PJOE 2DVJA 2ED0A 4F7UE 2MIOA 1UGVA 1VQOA 1YBYA 5I2MA 1QKXA 6AT1B 1YJWT 1VIEA 5HKCA 3CMAT 1I5OB 1VQLA 3A8GB 1NLPC 4C92B 3L42A 1MV0B 2DYIA 2ENMA 3A5ZB 2AKLA 2RQWA 4O6JA 3REXA 2EGCA 2O4XB 3INZA 1NJ1A 2KROA 1OOTA 2K5FA 2J3MA 2DL5A 3OYNA 1ADJA 3P8YA 3S3MA 4LNSA 4J9HA 4XU2A 5I21A 2V26A 5GAMh 3V8KA 2GGRA 2X51A 2FG0A 1K1ZA 4YRPA 1AHJB 5GMKe 4G84A 3TEGA 2HQXA 3BE3A 4RCCA 1B76A 3HXXA 4M77A 1AVZC 4P74C 1EIYA 4VUBA 3M58A 4M7DB 4CH3A 4PNOA 5LJ5j 3A7RA 1YHQQ 4HA8A 3V8JA 2DTIA 4E7KA 1NM7A 2FO0A 3E2UA 3I56A 2WSFE 2VXEA 1ZSZA 3TUPA 1OPKA 1MGQA 1Z9ZA 2HL5C 2QQBA 2J6FA 1M8MA 2ZPGB 3DLMA 2I4MA 3RGLA 1UEBA 2M1HA 3E19A 1SRYA 4C92C 4YRKA 3M0TA 4PKCC 1VOMA 2EJFA 4C0GA 2GFUA 2XGTA 2D0NA 4ZTFA 4JPBW 4LNPA 2QHUA 4C92G 2X4JA 4K11A 3HFZA 1YJNT 2GQIA 2EAYA 2M51A 2YRCA 4RTZA 5KYXA 1S72T 2QK0A 2FHDA 2CT4A 2FPEA 1YP5A 2J6KA 3P8VA 4YRIA 4C8QD 2IVWA 3X26B 3UGQA 3MEUA 4RG8A 3P8DA 4P71C 4EMKA 4C8QG 4EMGA 4CS2A 5A0LA 1B3QA 2F5TX 8AT1B 4OP0A 1Q81U 2KXCA 2M02A 3VS6A 2K3YA 2EJ9A 3VV0A 3JCMg 4LVMA 2PQWA 4RTVA 1U1SA 5CKHA 4Z02A 1PG5B 1T3LA 3JCMJ 3EGXA 1TWBA 2J3LA 2QTVA 1B8AA 2LNHB 4UP8A 4JJNK 4P75C 3HFZB 1UFFA 2LMJA 2LJ1A 3LWHA 1VQ8Q 3PZCA 4H2UA 3OW2S 2HEQA 2M0OA 1VQ6A 4QW2A 3HY0A 2MAMA 2P4TA 3H8ZA 5CKFA 3FLGA 4DBFA 2Y90A 2O4XA 1BBUA 2LQKA 3CCVT 3JCMQ 4NS5A 2YRVA 2C7IA 1NEBA 4P3NA 4MZPA 3SB2A 5FRMA 5D7UA 2JM8A 2MYSA 1O9SA 3H9NA 4HCKA 3HP9A 1PYSA 3CC4A 4ZNXA 3EGDB 4M78E 2R5AA 4CI0C 2AZVA 3PFSA 1NJ5A 3M0SA 5GAN7 4CC7A 1R0BG 2ECZA 4M75A 4NL3A 2K57A 3WQZA 4PJOA 2QQRA 3A31A 3C4SA 4Q5WA 1VQMA 1WU7A 2LC4A 4M75D 5LJ5g 2MOXA 1JQQA 2QQSA 1QVGP 2ATCB 5HK3A 4M7AC 4C5HA 2P5IA 2VV5A 4LUEA 4LUDA 2OTLQ 2RHSA 2I0NA 2QASA 4K86A 4FL6A 2C0TA 2EJGA 1H4SA 1M90R 2OTLA 3U23A 3OYIA 1N6AA 4XTUA 4ZIBA 4C92E 1B34A 3C94A 4GY5A 3G71A 1ZUKA 4JS4A 1NLOC 3VYGA 1XOVA 4H2SA 1RAIB 2EQMA 2KNBB 2YT6A 5GAMj 3CCVA 2ZCEA 1U5SA 2YHTA 2EL9A 1LCKA 2EYZA 4JJBA 3SDZA 4F7UB 1SEMA 4C0FA 3S3OA 3OMCA 3VS7A 2KRNA 2ZNIA 1F1BB 2OAUA 3OSVA 2O9VA 3HL8A 1RAEB 3LW5E 1VQ6T 2FPFA 3M0PA 3L2VA 5IHNA 4BY6B 1XNIA 2JMCA 5DLOA 2EWNA 1WDXA 5A0GA 3OYHA 4PJJA 1D3BB 1D0YA 1UDLA 3O8VA 1YITA 1TH7A 3LSSA 3VS4A 4JRKA 1KQSS 1M3BA 2QGFB 1BB9A 1VQPQ 3FJ5A 3BY7A 3QIIA 2CDTA 2J7IA 4BW9A 2RHSB 4YCWA 3L2WA 3DSQA 2JTEA 4OB0B 3IALA 4ZGJB 3VU3C 2EGAA 3JCMV 3VS2A 3FDRA 4YRLA 3I5SA 1KQSA 1VQ8T 2E5QA 2QQ9A 1RADB 1G5VA 1CKAA 2EW3A 2YWWA 5IXFA 4ME7A 4PJMA 5GAMe 4PG3A 5LJ3h 1YI2T 1QKWA 2EQJA 3NGPA 3CCMQ 3RF1A 2K5LA 2KDSA 1ZX6A 1FYNA 1VQKQ 2X3WD 3C12A 2OI3A 4QQ6A 2YDLA 4M75E 4YRQA 1M1KU 1QE0A 1QP2A 3LWIA 1W2BA 4TTVA 2Y4YA 4P3OA 4X5OA 1QF6A 5GANg 1B7TA 3GBQA 3E1SA 4KH1B 2HQHA 2JVVA 1QMCA 2D0QB 2DETA 1BIAA 4RDXA 3OYFA 1NJIR 2XDBA 1RIQA 4RUGA 1SKUB 2ZT8A 1Y96B 3VUBA 2EYQA 2EFIA 2KBTA 2X4WA 2QA4Q 1MMNA 1ZUUA 4TVAB 1ASYA 4AT1B 3CMET 1EFWA 1KFZA 5EG2A 2DYBA 2DBKA 2NUTA 1G51A 2WSCE 2ZGWA 2BTTA 4OVAA 2DLPA 1UECA 3GNFB 3M4YA 1RACB 2XDDA 1EVLA 2ESWA 1SERA 2MI6A 1WNLA 2K5IA 4M7DC 3SWNA 4AH6A 3QDFA 1NJIU 3HFVA 4E7IA 1IZ6A 2RH2A 2PMEA 3H0FA 9ATCB 1FMVA 4A63B 4H02A 1M9SA 4AFQC 1IHVA 1GFDA 5KH6A 4JUVA 3I35A 4OB3B 4XQ3A 3X20B 1ATIA 3MPUB 3CCLA 3N5BB 1K0XA 5KYYB 4OGEA 3META 2AIRB 5GAN3 4YRTA 5CIUA 4A4GA 1Q81R 1EX4A 3FIFA 4YDQA 5ELOA 2QG9B 1Y57A 2KRMA 4XEOA 4YRRA 2E3HA 1K9MU 1QP3A 4LD9K 4CC4B 4M4ZA 1PRMC 1W4SA 2RI5A 2HBPA 2K3BA 4OB2B 1U3OA 4E7SA 4PFZA 4JRPA 3CC2T 4TWAA 1RLPC 2E6NA 1W2BP 3SHWA 4BDZA 1HYOA 1ZQ1A 2Q7EA 2K3XA 3CBPA 3HRTA 2KI7A 1BCOA 3UFGA 1S72Q 3JB9F 1WJRA 1ZSGA 3I55T 3EHQA 1HXDA 2QHVA 1B7YB 5KCHA 3BW1A 3M53A 2BE7D 4M7AA 3VUZA 1VQNT 4D8KA 3RL6A 1YNZA 4HT8A 3JB9D 3OA6A 3CCUA 1G5IA 4YRFA 2HAXA 3HXZA 2RNAA 4MMKA 1H4TA 2DDZA 3HFNA 2DBMA 3UT1A 4C8QC 3REUA 3UWNA 2IY5B 3UATA 4E7ZA 3M0QA 2OTJT 1ZA1B 5LJ3j 1Q7YR 2YLBA 3CCUQ 7AT1B 2RQUA 5FROA 2BIVA 3G71T 3I55Q 4P5NA 3HKSA 2L8DA 2K2MA 3PVLA 3G6EQ 4OMLA 4OMMA 2CYZB 4M78F 2DXTA 1UE9A 2RHIA 1AOJA 1YFRA 2ZNJA 4H2VA 2K4YA 1WQ7A 3CCSQ 1ZHIA 1VQNQ 5LJ3e 1S72A 2C0OA 2CSIA 2PNIA 2FPDA 2DKGA 2I4OA 2ABLA 2KXDA 3CMQA 2XU8A 2DJQA 3J80E 3F70A 5K1PA 4ZTJA 5KYWB 2ZTGA 4M78G 3OS2A 1WHGA 2V8JA 3CCUT 4E7JA 4N4HA 5HGQA 2MWPA 3G71Q 1USYA 3M57A 4CRIA 1K4US 3MF1A 1AEYA 2CZ1B 2AHJB 3CCRA 4LVJA 1OU8A 1NYQA 5FU6B 4RTTA 4L59A 2EBPA 1AD5A 4OMNA 3M59A 1UJYA 5EC7A 1PSEA 1WFWA 4TVYA 5ELNA 4OLFA 2H3EB 3RR6A 2W0ZA 1WYXA 5KE2A 5GJVB 2JNGA 1OU9A 4GBQA 1KSWA 1VYVA 2A7YA 3T9NA 2K9GA 4BD3A 4O5VA 1S1NA 3OYAA 5GAN6 3JCMd 4BWAA 3X24B 4BI4A 1M2OA 4H2WA 1VQZA 1SSFA 5CAIA 3JCMP 2VYTA 4HVUA 1M1KC 3HTRA 2RI2A 3OYEA 1Z7MA 1YIJT 1VIFA 5IHKA 1AWWA 2ZZGA 2CUDA 2YUPA 1VQOT 1AWOA 4LE9A 3JAME 2QEXA 3JCMf 4E47A 3QUIA 4B6MA 4KULA 5GAN8 4C8QE 4AG1C 3CCEQ 2Q7HA 1G3SA 2P0QA 4J9BA 2OTJA 1X54A 2IIMA 4LDWA 1VQ9A 2K79A 1K73C 2DZCA 4RMOA 2HSPA 1PD0A 4LN2A 2VVKA 3A1PA 1TUGB 2X9HA 1Q82C 5CO7A 5J3BA 2M0YA 4NL2A 4V2SA 1M27C 2KGTA 4C0DB 4FYWB 3KBGA 3HHTB 4P72C 4PFOA 3A5YA 1MMAA 3DKMA 4KT0E 3H41A 2ZZEA 5FU7C 1QWFA 4FYYB 4J6WA 3OYBA 5FU6C 2DMOA 4J7FA 4A4FA 4E51A 3LX7A 2C0IA 2XTIA 2KEAA 1OULA 4YROA 2VGNA 4XTZA 4E2FB 1X6OA 3NEMA 1E6GA 3KFUA 2DFUA 1X56A 4IUQA 2JS0A 3CD6T 3TVTA 2DJZA 4M7AF 3DB4A 2X35A 5CVIA 2KAFA 1X27A 4M75F 4TQDA 2XI9A 2ZT7A 4FW2A 1JRIA 2DM1A 4WJ3M 4P73A 4HCCA 1QVFA 5CK9A 4DQ2A 2LNVA 5LJ3g 1VQMT 2BUDA 5GANh 2PU9B 4HT4A 2CP7A 2CS7A 4F7UA 3J81E 2BZXA 2QHTA 2E64A 1KD1C 3EG1A 3CC4Q 1ADYA 3EAEA 1NZ9A 3OY9A 1YJ9T 1KOGA 4FU6A 3P8BB 3QYHB 4HCBA 1K0SA 1KC8R 1ABQA 1HSQA 1WHJA 1GBQA 3CD6Q 3S3NA 1U06A 2GQVA 5FW9A 4QQGA 2PUOB 1MNEA 4JLIA 4Z8AA 3JCMc 3JCMX 1ZUYA 2CH4W 4LDYA 4RTUA 1GCQA 3RBBB 3MQZA 4HWOA 2JOYA 4M77B 1VQ7A 1H4VB 3M9QA 2RQVA 4F17A 2A36A 3JB9H 1RAHB 2OTLT 4TVWA 4PJOG 3MP6A 1Q82R 3G1JA 2K7AA 4J9GA 1UGSB 5ECAA 1W66A 1JJCA 2E5AA 1TUDA 2PVOB 4Z88A 4K87A 4MMLA 1YJ9Q 3JB9G 3NTIA 1RAGB 1NJIC 3QJ6A 5GAN4 1SESA 3H0HA 1I5LA 2E65A 5LJ3f 2FRYA 4JLGA 2B8AA 1MUZA 1O75A 4CH5A 4DBRA 2RD1A 1BI0A 3GIBA 1YFTA 4CS3A 3EFOB 2CT3A 1VQLT 2J05A 2XG8D 3E9FA 4LDUA 4C0DC 1VQ6Q 1UGPB 2DIGA 1IGQA 2AKWA 4PLLA 1NG2A 2EQKA 3CD6A 1K8AC 2YRDA 3ER0A 3QO7A 2D6FA 2DXBA 4QVCA 2DRMA 4UP7A 4EIKA 3ERRA 3QG1A 2X4XA 4BACA 2C8MA 1OPLA 2COZA 2COYA 1TS9A 4B9WA 5GAMd 4PJNA 3ZL7C 2NYSA 1BI2A 3OYJA 1X2KA 4EMKC 1JJCB 4H2XB 3H6ZA 5KYUB 1U8RA 5C0MA 4B9XA 1YITT 3R6OA 2DTOA 2R57A 2FZKB 2RF0A 1FMWA 4PJOB 2DILA 4KRTA 1ZA2B 3CCMT 1VQ5A 1FXXA 3OS5A 4HT9A 2CJAA 1M3CA 1TTHB 1UHCA 3RKWA 1LVKA 4D8DA 5CR2A 4JDSA 2D8JA 3CCLQ 1MMGA 2CGHA 2RB6A 3EG9B 3BFMA 1VQ5Q 2CIMA 2CUBA 2COWA 3MEVA 4EO4A 1GBRA 4IURA 1JB0E 1XQHA 2DPPB 3A74A 3HTZA 2EQIA 2ED1A 4E6RA 3TEEA 3CXCP 1LOJA 4X1VA 2HCKA 5HCKA 4DBQA 2M16A 2DIQA 3OD1A 3A8MB 3PE0A 2DL3A 1E7OA 4C0ZA 2JM9A 4KQEA 4FSXA 1KJWA 1K9MR 3NETA 3CCLT 4M7AG 1ZSZC 2CKKA 1NJ2A 1G3TA 3EGXB 3CCMA 1VQ5T 3PMIA 3A8OB 2W10A 1OI1A 3MHXA 4YRSA 2SRCA 1A0NB 4PFPA 1KHCA 2E10A 2L3PA 2EQUA 2NUPB 2ZINA 5J26A 1SG5A 3HPWA 4M7DG 2BZ8A 3OQ5A 2JW4A 4LVIA 5KYXB 4FYXB 3IG2A 3RESA 1WJSA 4XU1A 3VJPA 2KQWA 1WGSA 1SF9A 2DRKA 3CMEQ 1M5Q1 2QYZA 5CCAA 3GP8A 4BE1A 1HC7A 2VB6A 1IO6A 2LX9A 3OW2P 3CMEA 2GBQA 2LCSA 2DK3A 1M1GA 2QEXQ 4II1A 2RPNA 1Q86C 1VQOQ 2G4CA 3LH0A 3CCRT 3OYCA 3R6NA 2M9UA 3TREA 1AZGB 5IH2A 5KYNA 2E6ZA 1YFNA 3TSZA 3CCQA 2O88A 1D1BA 1IGUA 1NBEB 4MZMA 1X75C 2ARSA 4IKFA 1YB3A 3IKLA 4DPGA 3OBWA 1EFNA 5GANj 2DVEA 2EVRA 3REAB 5C52B 3DLLA 1H641 3L1AA 2AMCA 4F16A 5D6WA 1I8FA 2RJEA 3RUXA 1SSHA 1WI7A 3OYLA 2ZIOA 4M78A 4E7LA 4C8QB 2NUTB 2E70A 3L2ZA 4LXCA 4M78D 2FVUA 1RLQC 2CZ0B 4XTVA 2DD5A 2JT4A 4LDXA 2J6OA 4C5EA 1IL2A 2QXFA 1X6GA 4UC4A 1Z9QA 2GNCA 4YRJA 4FYVB 4EPCA 4JJCA 3OS0A 1PM3A 5LJ5h 2LX7A 3CCJT 2YXYA 1W2BS 4HVWA 3JCMW 4A4HA 5GMKl 3HXWA 2H3JA 5DY9A 4P3PA 1JU5C 1J3TA 3RIRA 4XTXA 1ZSZB 1VQNA 3A5ZA 1PHTA 3UDCA 2AKWB 3QXEB 1G3WA 2DO3A 2DXCA 1I07A 2KSSA 1ABOA 2G3RA 4WI1A 1UB4A 2JMAA 4PK4A 2O9SA 1ARKA 1UGRB 2MWOA 3CBOA 5FWCA 3TSWA 3G1ZA 1RUWA 3M0RA 4Q15A 1BI1A 1NPRA 3REBB 2P84A 1BI3A 4D6WA 1EQRA 2L3QA 1VQ8A 5KNNA 4R0KA 1M3AA 4HWRA 1WX6A 4BB7A 4BE2A 2E3CA 1X2QA 3J7AF 2DQ0A 2GFAA 1MHNA 1D3BA 1E6HA 1N8RU 3FEOA 2DXUA 2ALYA 3VYHB 2Q5HA 1W1FA 2A37A 2FZGB 3VS1A 5GAOl 1B70B 4H2YA 2ODRD 1RABB 2RHYA 1Y7XA 4XK8E 3V7CA 4YRMA 4NCXA 2MF2A 1IXDA 3VS0A 2RJFA 4QVDA 2HDAA 3NPFA 3S6WA 3GF5A 1QLYA 1V76A 1D09B 2ZCFB 3KXTA 2D1XA 1G5HA 4EDUA 1BBWA 5C6SA 1YWOA 4GLMA 2ZT5A 2LQNA 1VQ7Q 3MP8A 3MEAA 1I1JA 2EYWA 2EIFA 1NPPA 1PWTA 2DZ9A 1YFSA 2G6FX 3VS5A 3L4GB 1X55A 1KMMA 1X43A 1KMNA 2ZR3A 3VS3A 3MO8A 3UA7A 4F04B 1HD3A 2ZAEA 4K88A 2KE9A 2FYKA 4BY6C 4OGCA 2ROLA 5GANe 1D0ZA 3JV3A 1PC0A 3TEHA 1N27A 4YRNA 5GAN2 4IUVA 3HRUA 1IREB 2EGEA 4RTWA 5GJWB 1VQPT 2AMCB 2HD0A 1IHWA 1QWEA 3HSBA 3JCMh 3PTAA 4M75B 4J9CA 2HL3A 1ZLMA 1X2HA 2RHUA 5GAN5 2I4LA 3PIOA 4BE0A 5GMKi 2LQ8A 3EFOA 2DEUA 1D0XA 5IHIA 1DJ7B 4L5GA 3LH5A 4DEYA 2XD0A 4YRGA 3GOXA 2YUOA 1Q95G 4ZTZB 2QAZA 4RCBA 1OYXA 2LDMA 3SWNC 3JSCA 1LPLA 2L5QA 3VBBA 1QVFP 3PGGA 3FB9A 3NHNA 3QZ9B 2E3IA 4RQFA 2DA9A 2A28A 2RHQB 5KCOA 1EZZB 5GAMg 4HWSA 4PJOD 3P8HA 2ROTA 2X4YA 3QDRB 5GANf 4N4IA 3M5AA 4DEXA 1NNHA 3QYGB 2FEIA 3A7UA 3OB9A 5FLXE 2VUBA 2R58A 1B7YA 3UPUA 2Y4XA 3CC7A 2L0AA 3OYMA 5KYWA 2YSQA 2NS6A 3PMTA 4R55A 5A2QE 1H8KA 4KBMB 4HVVA 1NEGA 4J7IA 4N4GA 1YI2A 2KYMA 1RAFB 2O31A 1TUCA 3LGFA 1UHFA 2EYXA 3E9GA 3IKMB 1N9WA 3BDUA 2J06A 5L23A 1YJWQ 1WJQA 2F69A 4A53A 2DU7A 3OYYA 1ASZA 1WQWA 1D1AA 3SD4A 2QTXA 1N8RC 1BIBA 1XJWB 1YCSB 2ALYB 1Z7NA 4CH6A 2CJ9A 2ZT6A 5C53B 1WHMA 3LLRA 3PVQA 1G2BA 2JUFA 1WPYA 4J15A 1VQPA 3QWYA 1JJ2P 2XKOC 4JJDA 4M7AB 5GANd 4N0AC 2DF6A 1FWZA 3QBYA 4HVCA 4BUGA 3QHSA 2LCCA 2GF7A 3X25B 1NJ6A 3CC2Q 3NMZC 2CP5A 4M77D 3ZEHA 2NUPA 4A4KA 4ELZC 2NUZA 1SETA 3I5RA 1M30A 1KG1A 3G4SQ 3CC2A 3CCVQ 2IG0A 1X01A 3ME9A 4JRQA 4L6V5 4LDVA 1R77A 1PKTA 1PRLC 3UF4A 1Q7YC 4A4EA 2PMFA 3G7ZA 4XEMA 3UGTA 1X6BA 4BDYA 1JXOA 3VQVA 5K1XA 3M4PA 4A54A 4ESRA 4AFZC 2L2PA 3QO3A 1JBMA 2LT1A 2YUNA 1VUBA 1K76A 1GCPA 3C95A 1WXBA 3A8HB 4RTXA 5HK0A 2VXFA 11ASA 2DQ3A 1Y71A 5IN1A 3JCMe 2QA4A 4J9IA 2LRQA 2RMOA 3E9HA 2PVDB 4RTYA 1TU0B 4J9FA 4FW1A 5GAMf 1R0CB 2WACA 3EG9A 1H4QA 2CH4A 2MPXC 1V29B 4PJLA 2LQWA 2LP5A 4M78B 1OV3A 2JTMA 3VRZA 4FSSA 4JZ3A 3CEYA 1CSKA 1X2GA 1N5ZA 2JTFA 3CCSA 4M77C 1IB8A 4P74A 2ZPIB 1YI2Q 2L3SA 2KMTA 3LYIA 4Y91A 3OYGA 1LYLA 1SRLA 3IQLA 1E1TA 1I0CA 2FRWA 1LJOA 5GAOm 1EIYB 3CXCA 2P0LA 2ZPEB 3VKIA 2LVMA 4FCYA 3EFRA 4ANJA 4J6YA 1JJ2S 3CPWP 3ZBDA 1NYGA 2GCXA 4H2XA 2DEQA 2HKQB 1T0HA 2E1HA 3A98A 4G85A 1LNXA 1KD1R 3HXYA 3CPWA 2RO0A 3A7AA 4C92A 5DLQE 4M77G 2JZ2A 3OBYA 2IY5A 1K9AA 3VRYA 1QVPA 4P75A 4YRCA 1D1CA 4BI3A 1M1FA 1C0MA 2F1LA 5I22A 5GAOp 3JRZA 5GAOr 3RNJA 3EHRA 4C5GA 1L0WA 3NENA 1B34B 1SRMA 4AFSC 1C1AA 3FRNA 5FRNA 5KYUA 2KK4A 3EG0A 3HRSA 4P71A 1OX8A 3OYKA 2F2VA 4J8OA 3I56Q 2V1QA 4C8QF 2DL4A 2F2WA 2JN0A 1UGQB 2L89A 4CC3A 2XICA 2AT1B 4KGVB 3G4ST 2QDLA 5AYFA 1ZBJA 1NYFA 4C92F 1HTTA 4EX5A 1M8VA 1M2VA 4FIBA 4RKUE 4FM4B 4XAXB 1FX7A 3CCRQ 4R56A 2CJBA 3CCQT 1GCQC 2NLUA 1UJ0A 4M75C 1Y07A 5IT9E 3CC4T 2E12A 4HXJA 3A32A 2EKOA 1G83A 5GMKh 3MEYA 2OJ2A 2MCNA 2V8IA 4MDWA 4X9DA 1PNJA 2VC8A 3CMAQ 1MNDA 1SHFA 4ZGDB 3EGUA 3LC0A 1ZBXA 1RI0A 5DM7R 3V8LA 4F14A 5CKBA 1ACMB 2ARTA 1K73R 1KC8U 3MKDA 4IUPA 2OAWA 3WVEB 1Q86R 3UA6A 2P0PA 3CCQQ 3G6EA 4P73C 2CSQA 1KK7A 1PKSA 5GAOq 3ULRB 2K6DA 4X34A 2LJ3A 4PJOC 4N0AA 4KH0B 2HBWA 2AZSA 5LJ5d 4OMFB 2A0FB 1VYTA 1WZOA 2PZ1A 1Q82U 2Z0WA 5LL6S 2MMPA 2OTJQ 2XMFA 4Y92A 2RHZA 4FT4A 1G8XA 2MK5A 4JZ4A 1UG1A 4J6XA 4AG2C 4AFUC 1OZ2A 2CP2A 3OW2A 1Y96A 4IIMA 2CP3A 1OX9A 3QWXX 2D9TA 1VQLQ 3SEMA 3L4GA 2BE9B 2DL7A 1M1KR 2CREA 4HKEA 4M75G 4RG2A 1IRXA 2KRSA 4OF1A 3CC7Q 2XIDA 3VQXA 3QPHA 2GTJA 2PVGB 2ZZDA 3RMQA 1YJNA 1PSFA 3PIPA 2RK2A 4XTWA 3VQWA 4HWTA 5L8RE 3QZ5B 1Y0MA 2B86A 1YCYA 3M4GA 1HK9A 5CKEA 4WF2A 1QVGS 3HXVA 2I2LA 3M55A 2K2VA 1M2VB 1U1TA 4DA4A 4X9CA 4ELYC 4KR3A 1T3SA 3ZFJA 2DD4A 3HRIA 1SHGA 1W6XA 1WXTA 2LZ6B 4Q6GA 1VQ4T 4F7UG 2QDYB 2ZR2A 1BU1A 3O5ZA 4YPFA 1MMDA 3M54A 3H0IA 1E1OA 1WHKA 3A8LB 2L3RA 4MZTA 2RA2A 1KQ1A 3NTHA 1XTDA 1FMKA 2IPOB 1RL2A 4TVRA 3QSUA 4LD6A 2I4NA 3SFMA 2ZPHB 1QW1A 4E7HA 2QI2A 2SEMA 2R5MA 1WLEA 4UPAA 4CH4A 3QO8A 2KT8A 3QNEA 3R07A 4NOYA 4YP0A 1HJDA 1H92A 1VYUA 1KHIA 5I2SA 3KUFA 3WXMB 2LCLA 2BKDN 3L2UA 4C92D 1JO8A 2HZYA 1YWPA 1VQMQ 4CS4A 1WHLA 5A0DA 3GLXA 2E41A 4WTOB 1YJWA 1X69A 5AT1B 2KYBA 2VGMA 1GL5A 4YYEA 2OX7A 1NYRA 4M78C 4EMKB 3HFOA 5IXBA 3OS1A 4PHCA 1TXQA 1VQKA 3UH0A 3CPFA 4ZTUB 4M7DA 3MP1A 1NE8A 1P92A 4M77F 1V1CA 2DU5A 1BK2A 2HSEB 4M7DD 4PL6A 1N9SA 3QJYA 1H3ZA 3EGDA 2ARUA 3LGLA 1KQ2A 2YUQA 3Q1JA 1KQSP 2RHQA 2NWMA 2ZIMA 4M7AE 3TU4K 4FT2A 2VASA 5M9OA 1Q7YU 1YJ9A 2RN8A 2VWFA 3NELA 3BJUA 5IAYA 3M56A 3I7FA 1QVGA 3PT9A 1I81A 3HY1A 2DNUA 1GGMA 4OMOA 5KYYA 5GMKm 4ZN3A 3JCMb 4AMCA 2KY9A 3RACA 1RAAB 3CMAA 1TOVA 4IUTA 5J39A 3QO5A 2DX1A 3AT1B 5KE3A 1YIJQ 1EVKA 3EG2A 1TG0A 3AHUA 4LVKA 2AK5A 2RQTA 1R8OB 4J9DA 1N9RA 4C8QA 1YHQT 1KIKA 5E3IA 1VQ4Q 3CCST 1YN8A 2QHSA 5C51B 4IUUA 3QKJA 4RQEA 4LVLA 1UUEA 2ZPFB 1BBZA 2ZZFA 2O01E 3SWNB 3DB3A 1AWJA 1PYSB 4BI8B 4L87A 2EPDA 3CCET 5CKDA 1K9MC 3TEHB 4Y28E 2D8HA 5I11A 2EYYA 4KGZB 3OSSC 2WSEE 4UP9A 1M90C 3URGA 1JJ2A 5FU7B 3EH2A 3HRKA 2O2OA 2HNIA 3I56T 2PTKA 1AZEA 2H8HA 3NFCA 4ZGEB 4PJOF 4GLKA 2RQRA 1WYDA 4YREA 1Q86U 2FZCB 1GXIE 4QVZA 1PCXA 4DOVA 3CBMA 2F5KA 1UTIA 1E24A 3LSQA 1GFCA 2YLCA 4M7DF 4C5IA 1VQ9T 2QGGA 2CZ7B 1PD1A 2DAQA 2RJDA 3BDLA 4J83A 3CXCS 1OEBA 4EMHA 4M7DE 2GTOA 2E5KA 2AKKA 2LJ0A 4OB1B 4DOWA 3V7RA 3CQTA 1MV3A 5F5WA 1BCMA 5D6XA 2XDPA 1B70A 3EG3A 1M4ZA 2CP0A 2DE0X 1Q81C 1WHHA 5LJ5e 2F2XA 3JB9J 1BKBA 3OYDA 3M0UA 4QKUA 1YIJA 3I9QA 3P8TA 2QA4T 4DBHA 1WXUA 1QVFS 4HWPA 1VQ9Q 3THKA 4J5YA 1T0JA 4IIOA 2A3LA 4MDXA 4P72A 4M7AD 3RKXA 1USYC 1GRIA 2E4HA 4YCVA 4XTYA 3RERA 3FC3A 2PUKB 1QCOA 2RJCA 3D7SB 2P0KA 1QCFA 1N8RR 1C6VX 4F7UF 1B07A 4OMPA 2FB7A 4QQDA 3ICAA 3M4QA 4CC2A 1OQKA 2KVQG 4JS5A 1VQ7T 1KD1U 1FYFA 2RM4A 5LJ5f 3ASKA 8ATCB 2ZXFA 2JJ9A 2XHCA 4O2DA 2JXBA 3TCJA 1YITQ 3QTCA 1AWXA 2VKNA 4KR2A 2XK0A 3CC7T 2QQAA 3PNWC 2Q7GA 1EIFA 4WJ4A 2JS2A 3EFSA 4ORZA 1KC8C 5LJ3d 2KT1A 4H2TA 4J9EA 3MJXA 2DTHA 2RK1A 4ZN1A 12ASA 2EKHA 4PLIA 4OMQA 1SPKA 1AT1B 1K8AU 3PCOB 4Z89A 3CCJA 1BYMA 3G4SA 4QT7A 3OMGA 3L2QA 1YGBA 2BZYA 4TVAA 1W70A 1OZ3A 2LT4A 4YTLA 1JXMA 2A08A 2HQEA 4KUIA 1I4K1 2DERA 3WVDB 1JEGA 2C06A 2V1RA 1VA7A 1YHQA 2FL7A 1J5WA 2V8KA 1WIEA 3GPLA 1K8AR 3E9IA 4M77E 1EOVA 2X3XD 4WCIA 3VQYA 3NTKA 4XU0A 5GAOn 3MCAB 4TQFA 3TQ7P 1H3HA 2ODRC
chains in the Genus database with same CATH topology
5CQYA 2Q5IA 1VQ4A 1M90U 2RHXA 4YCUA 3RMSA 2ZPBB 3GNGA 3JB9I 5D6YA 3PCOA 3G6ET 4KUDK 5CQXA 2A8EA 3HXUA 2RI3A 5HY6A 1G3YA 1C0AA 1K73U 3I55A 3CCEA 3V7SA 1NJ8A 3RKYA 3X28B 4JRIA 3CPWS 3L2RA 4ATOA 1VQKT 3MEWA 1E22A 5GMKj 2CZ6B 3FJPA 4HCZA 3MF2A 2QEXT 2LTOA 4XU3A 4RMFA 3W3SA 4PJOE 4F7UE 1VQOA 1YBYA 5I2MA 1YJWT 1VIEA 5HKCA 3CMAT 1VQLA 3A8GB 4C92B 3L42A 3A5ZB 4O6JA 3REXA 2O4XB 3INZA 1NJ1A 2K5FA 2J3MA 3OYNA 1ADJA 3P8YA 3S3MA 4LNSA 4XU2A 5I21A 5GAMh 3V8KA 4YRPA 1AHJB 5GMKe 4G84A 3TEGA 2HQXA 4RCCA 3HXXA 1B76A 4M77A 4P74C 1EIYA 4VUBA 3M58A 4M7DB 4CH3A 4PNOA 5LJ5j 3A7RA 4HA8A 3V8JA 2DTIA 4E7KA 3I56A 2WSFE 2VXEA 3TUPA 1MGQA 2QQBA 2ZPGB 3DLMA 2I4MA 3RGLA 1UEBA 2M1HA 3E19A 1SRYA 4C92C 4YRKA 4PKCC 2EJFA 4C0GA 2GFUA 2XGTA 4ZTFA 2QHUA 4C92G 2X4JA 3HFZA 1YJNT 2EAYA 1S72T 2FHDA 3P8VA 4YRIA 4C8QD 2IVWA 3X26B 3UGQA 3MEUA 4RG8A 3P8DA 4P71C 4EMKA 4C8QG 4EMGA 4CS2A 5A0LA 2F5TX 4OP0A 1Q81U 2K3YA 2EJ9A 3VV0A 3JCMg 4LVMA 2PQWA 1U1SA 5CKHA 4Z02A 3JCMJ 2J3LA 1B8AA 4UP8A 4JJNK 4P75C 3HFZB 3PZCA 3LWHA 4H2UA 3OW2S 2M0OA 1VQ6A 4QW2A 3HY0A 2MAMA 2P4TA 3H8ZA 5CKFA 3FLGA 2Y90A 2O4XA 1BBUA 2LQKA 3CCVT 3JCMQ 4NS5A 2YRVA 2C7IA 4P3NA 4MZPA 3SB2A 5FRMA 1O9SA 3HP9A 1PYSA 3CC4A 4M78E 2R5AA 4CI0C 3PFSA 1NJ5A 5GAN7 4M75A 4NL3A 3WQZA 2K57A 4PJOA 2QQRA 3A31A 3C4SA 4Q5WA 1VQMA 1WU7A 2LC4A 4M75D 5LJ5g 2QQSA 5HK3A 4M7AC 4C5HA 2P5IA 2VV5A 2RHSA 4K86A 4FL6A 2EJGA 1H4SA 2OTLA 3OYIA 1N6AA 4XTUA 4ZIBA 4C92E 1B34A 3C94A 4GY5A 3G71A 4JS4A 3VYGA 1XOVA 4H2SA 2EQMA 5GAMj 2ZCEA 3CCVA 2YHTA 2EL9A 3SDZA 4F7UB 4C0FA 3S3OA 3OMCA 2ZNIA 2OAUA 3OSVA 3HL8A 1VQ6T 3LW5E 3L2VA 4BY6B 1XNIA 5DLOA 2EWNA 5A0GA 3OYHA 1D3BB 3O8VA 1YITA 1TH7A 3LSSA 4JRKA 1KQSS 3BY7A 3QIIA 4BW9A 2RHSB 4YCWA 3DSQA 3L2WA 4OB0B 3IALA 4ZGJB 3VU3C 3JCMV 3FDRA 4YRLA 1KQSA 1VQ8T 2E5QA 2QQ9A 1G5VA 4ME7A 5GAMe 4PG3A 5LJ3h 1YI2T 2EQJA 3RF1A 2K5LA 2KDSA 3C12A 4QQ6A 4M75E 4YRQA 1M1KU 1QE0A 1QP2A 3LWIA 1W2BA 4TTVA 2Y4YA 4P3OA 4X5OA 1QF6A 5GANg 3E1SA 2JVVA 2D0QB 1BIAA 4RDXA 3OYFA 1RIQA 2XDBA 2ZT8A 1Y96B 3VUBA 2EYQA 2EFIA 2X4WA 4TVAB 1ASYA 3CMET 1EFWA 5EG2A 1G51A 2WSCE 2ZGWA 4OVAA 3GNFB 3M4YA 2XDDA 1EVLA 1SERA 2MI6A 1WNLA 2K5IA 4M7DC 3SWNA 4AH6A 1NJIU 3HFVA 4E7IA 1IZ6A 2RH2A 2PMEA 4H02A 1M9SA 5KH6A 4JUVA 4OB3B 4XQ3A 3X20B 1ATIA 3CCLA 3N5BB 4OGEA 3META 5GAN3 4YRTA 5CIUA 4A4GA 3FIFA 4YDQA 5ELOA 4XEOA 4YRRA 1K9MU 1QP3A 4LD9K 1W4SA 2RI5A 2HBPA 4OB2B 4JRPA 3CC2T 4TWAA 2E6NA 4BDZA 1ZQ1A 2Q7EA 2K3XA 3CBPA 3HRTA 3UFGA 3JB9F 1WJRA 3I55T 1HXDA 2QHVA 1B7YB 5KCHA 3BW1A 3M53A 4M7AA 3VUZA 1VQNT 3RL6A 4HT8A 3JB9D 3OA6A 3CCUA 1G5IA 4YRFA 2HAXA 3HXZA 1H4TA 4MMKA 2DDZA 3HFNA 3UT1A 4C8QC 3REUA 3UWNA 2IY5B 2OTJT 5LJ3j 2YLBA 5FROA 2BIVA 3G71T 4P5NA 3HKSA 2L8DA 2CYZB 4M78F 2DXTA 2RHIA 1YFRA 2ZNJA 4H2VA 2K4YA 1WQ7A 1ZHIA 5LJ3e 1S72A 2DKGA 2I4OA 3CMQA 2XU8A 3J80E 3F70A 5K1PA 4ZTJA 2ZTGA 4M78G 3OS2A 2V8JA 3CCUT 4E7JA 4N4HA 5HGQA 2MWPA 1USYA 3M57A 4CRIA 3MF1A 2CZ1B 2AHJB 3CCRA 4LVJA 1NYQA 5FU6B 4L59A 3M59A 1PSEA 4TVYA 5ELNA 4OLFA 5KE2A 2JNGA 2A7YA 3T9NA 4BD3A 4O5VA 3OYAA 5GAN6 3JCMd 4BWAA 3X24B 4BI4A 4H2WA 1VQZA 1SSFA 5CAIA 3JCMP 2VYTA 1M1KC 2RI2A 3OYEA 1Z7MA 1YIJT 1VIFA 2ZZGA 1VQOT 3JAME 2QEXA 3JCMf 4E47A 3QUIA 5GAN8 4KULA 4C8QE 2Q7HA 1G3SA 2P0QA 2OTJA 1X54A 4LDWA 1VQ9A 1K73C 2DZCA 4RMOA 1Q82C 5CO7A 5J3BA 4V2SA 4NL2A 4C0DB 3KBGA 3HHTB 4P72C 3A5YA 3DKMA 4KT0E 2ZZEA 5FU7C 4J6WA 3OYBA 5FU6C 4J7FA 4A4FA 4E51A 3LX7A 2XTIA 4YROA 2VGNA 4XTZA 1X6OA 3NEMA 3KFUA 1X56A 4IUQA 3CD6T 2DJZA 4M7AF 3DB4A 2X35A 2KAFA 4M75F 5CVIA 4TQDA 2XI9A 2ZT7A 1JRIA 4WJ3M 4P73A 4HCCA 1QVFA 5CK9A 4DQ2A 2LNVA 5LJ3g 1VQMT 2BUDA 5GANh 2PU9B 4HT4A 3J81E 2CS7A 4F7UA 2QHTA 2E64A 1KD1C 1ADYA 3EAEA 1NZ9A 3OY9A 1YJ9T 1KOGA 4FU6A 3P8BB 3QYHB 4HCBA 3S3NA 2GQVA 4QQGA 2PUOB 4JLIA 3JCMc 3JCMX 4LDYA 3MQZA 4HWOA 2JOYA 4M77B 1VQ7A 1H4VB 3M9QA 3JB9H 2OTLT 4TVWA 4PJOG 3MP6A 1UGSB 1W66A 1JJCA 2E5AA 2PVOB 4K87A 4MMLA 3JB9G 3NTIA 1NJIC 3QJ6A 5GAN4 1SESA 1I5LA 2E65A 5LJ3f 4JLGA 2B8AA 1O75A 4CH5A 2RD1A 1BI0A 3GIBA 1YFTA 4CS3A 1VQLT 2XG8D 3E9FA 4LDUA 4C0DC 1UGPB 2DIGA 2AKWA 4PLLA 2EQKA 3CD6A 1K8AC 3ER0A 3QO7A 2D6FA 2DXBA 4QVCA 4UP7A 3ERRA 3QG1A 2X4XA 4BACA 2C8MA 4B9WA 5GAMd 1BI2A 3OYJA 4EMKC 1JJCB 4H2XB 3H6ZA 1U8RA 5C0MA 4B9XA 1YITT 3R6OA 2DTOA 2R57A 4PJOB 3CCMT 1VQ5A 1FXXA 3OS5A 4HT9A 2CJAA 3RKWA 5CR2A 4JDSA 2CGHA 2RB6A 3BFMA 2CIMA 3MEVA 4EO4A 4IURA 1JB0E 1XQHA 2DPPB 3A74A 3HTZA 3TEEA 1LOJA 2M16A 2DIQA 3OD1A 3A8MB 4C0ZA 4KQEA 4FSXA 3NETA 3CCLT 4M7AG 2CKKA 1NJ2A 1G3TA 3CCMA 1VQ5T 3PMIA 3A8OB 1OI1A 3MHXA 4YRSA 1KHCA 2E10A 2EQUA 2ZINA 5J26A 3HPWA 4M7DG 3OQ5A 4LVIA 3IG2A 3RESA 1WJSA 4XU1A 3VJPA 2KQWA 1WGSA 1M5Q1 1HC7A 5CCAA 3GP8A 4BE1A 2LX9A 3CMEA 2DK3A 1M1GA 4II1A 1Q86C 2G4CA 3LH0A 3CCRT 3OYCA 2M9UA 3TREA 2E6ZA 3CCQA 4MZMA 1X75C 2ARSA 4IKFA 1YB3A 3IKLA 4DPGA 3OBWA 5GANj 2DVEA 5C52B 3DLLA 1H641 3L1AA 2AMCA 5D6WA 1I8FA 2RJEA 3RUXA 3OYLA 2ZIOA 4M78A 4E7LA 4C8QB 2E70A 3L2ZA 4M78D 2FVUA 2CZ0B 4XTVA 2DD5A 4LDXA 4C5EA 1IL2A 2QXFA 4UC4A 4YRJA 4EPCA 3OS0A 5LJ5h 3CCJT 1W2BS 3JCMW 4A4HA 5GMKl 3HXWA 2H3JA 5DY9A 4P3PA 3RIRA 4XTXA 1VQNA 3A5ZA 3UDCA 2AKWB 3QXEB 1G3WA 2DO3A 2DXCA 2KSSA 2G3RA 4WI1A 1UB4A 1UGRB 2MWOA 3CBOA 3G1ZA 4Q15A 1BI1A 1NPRA 1BI3A 4D6WA 1EQRA 1VQ8A 5KNNA 4HWRA 4BB7A 4BE2A 2E3CA 3J7AF 2DQ0A 2GFAA 1MHNA 1D3BA 1N8RU 3FEOA 2DXUA 2ALYA 3VYHB 2Q5HA 1B70B 4H2YA 5GAOl 2ODRD 2RHYA 1Y7XA 4XK8E 3V7CA 4YRMA 4NCXA 2MF2A 2RJFA 4QVDA 3S6WA 3GF5A 2ZCFB 3KXTA 1G5HA 4EDUA 1BBWA 5C6SA 2ZT5A 3MP8A 3MEAA 2EIFA 1NPPA 2DZ9A 1YFSA 3L4GB 1X55A 1KMMA 1KMNA 2ZR3A 3MO8A 4K88A 2FYKA 4BY6C 4OGCA 5GANe 3TEHA 1N27A 4YRNA 5GAN2 4IUVA 3HRUA 1IREB 1VQPT 2AMCB 2HD0A 3HSBA 3JCMh 3PTAA 4M75B 1X2HA 2RHUA 5GAN5 2I4LA 3PIOA 4BE0A 5GMKi 2LQ8A 1DJ7B 4L5GA 4YRGA 2XD0A 3GOXA 4ZTZB 4RCBA 1OYXA 2LDMA 3SWNC 3JSCA 2L5QA 3VBBA 3PGGA 3FB9A 3QZ9B 4RQFA 2RHQB 5KCOA 5GAMg 4HWSA 4PJOD 3P8HA 2X4YA 3QDRB 5GANf 4N4IA 1NNHA 3M5AA 3QYGB 3A7UA 3OB9A 5FLXE 2VUBA 2R58A 1B7YA 3UPUA 2Y4XA 3CC7A 3OYMA 2NS6A 3PMTA 4R55A 5A2QE 4KBMB 4J7IA 4N4GA 1YI2A 3LGFA 3E9GA 3IKMB 1N9WA 3BDUA 1WJQA 2F69A 4A53A 2DU7A 3OYYA 1ASZA 1WQWA 3SD4A 2QTXA 1N8RC 1BIBA 2ALYB 1Z7NA 4CH6A 2CJ9A 2ZT6A 5C53B 3LLRA 2JUFA 1WPYA 4J15A 1VQPA 2XKOC 4M7AB 5GANd 4N0AC 4HVCA 1FWZA 3QBYA 4BUGA 3QHSA 2LCCA 2GF7A 3X25B 1NJ6A 4M77D 3ZEHA 4A4KA 4ELZC 1SETA 1KG1A 3CC2A 2IG0A 1X01A 3ME9A 4JRQA 4L6V5 4LDVA 1Q7YC 4A4EA 2PMFA 3G7ZA 4XEMA 3UGTA 4BDYA 3VQVA 5K1XA 3M4PA 4A54A 3QO3A 1JBMA 2LT1A 1VUBA 3C95A 3A8HB 5HK0A 2VXFA 11ASA 2DQ3A 1Y71A 5IN1A 3JCMe 2QA4A 2LRQA 3E9HA 2PVDB 5GAMf 2WACA 1H4QA 1V29B 4M78B 2JTMA 3CEYA 1X2GA 2JTFA 3CCSA 4M77C 4P74A 2ZPIB 2KMTA 3LYIA 4Y91A 3OYGA 1LYLA 1E1TA 1LJOA 5GAOm 1EIYB 3CXCA 2P0LA 2ZPEB 3VKIA 2LVMA 3EFRA 4J6YA 1JJ2S 3ZBDA 2GCXA 4H2XA 2DEQA 2E1HA 4G85A 1LNXA 3HXYA 3CPWA 2RO0A 3A7AA 4C92A 5DLQE 4M77G 2JZ2A 3OBYA 2IY5A 4P75A 1QVPA 4YRCA 4BI3A 1M1FA 5GAOp 3JRZA 5GAOr 4C5GA 1L0WA 3NENA 1B34B 3FRNA 5FRNA 2KK4A 4P71A 3HRSA 3OYKA 4J8OA 4C8QF 2JN0A 1UGQB 2L89A 2XICA 3G4ST 5AYFA 4C92F 1HTTA 4EX5A 1M8VA 4FIBA 4RKUE 4FM4B 4XAXB 1FX7A 4R56A 2CJBA 3CCQT 2NLUA 4M75C 1Y07A 5IT9E 3CC4T 2E12A 3A32A 2EKOA 5GMKh 3MEYA 2V8IA 4MDWA 4X9DA 2VC8A 4ZGDB 3LC0A 1ZBXA 1RI0A 5DM7R 3V8LA 5CKBA 2ARTA 1KC8U 4IUPA 3WVEB 2P0PA 3G6EA 4P73C 5GAOq 4X34A 4PJOC 4N0AA 5LJ5d 4OMFB 1Q82U 5LL6S 2MMPA 2RHZA 4FT4A 4J6XA 1OZ2A 3OW2A 1Y96A 2D9TA 3L4GA 4HKEA 4M75G 4RG2A 4OF1A 2XIDA 3VQXA 3QPHA 2PVGB 2ZZDA 3RMQA 1YJNA 1PSFA 3PIPA 2RK2A 4XTWA 3VQWA 4HWTA 5L8RE 3QZ5B 1YCYA 3M4GA 1HK9A 5CKEA 4WF2A 1QVGS 3HXVA 2I2LA 3M55A 2K2VA 1U1TA 4DA4A 4X9CA 4ELYC 4KR3A 3ZFJA 2DD4A 3HRIA 4Q6GA 1VQ4T 4F7UG 2QDYB 2ZR2A 4YPFA 3M54A 1E1OA 3A8LB 2L3RA 4MZTA 2RA2A 1KQ1A 3NTHA 1XTDA 1RL2A 4TVRA 3QSUA 4LD6A 2I4NA 3SFMA 2ZPHB 1QW1A 4E7HA 2QI2A 2R5MA 1WLEA 4UPAA 4CH4A 3QO8A 3QNEA 3R07A 4NOYA 4YP0A 5I2SA 1KHIA 3KUFA 3WXMB 2LCLA 2BKDN 3L2UA 4C92D 4CS4A 5A0DA 3GLXA 2E41A 1YJWA 2VGMA 4YYEA 1NYRA 4M78C 4EMKB 3HFOA 3OS1A 4PHCA 1VQKA 3UH0A 3CPFA 4ZTUB 4M7DA 3MP1A 1NE8A 1P92A 4M77F 2DU5A 4M7DD 4PL6A 1N9SA 3QJYA 1H3ZA 2ARUA 3LGLA 1KQ2A 3Q1JA 2RHQA 2ZIMA 4M7AE 3TU4K 4FT2A 5M9OA 1Q7YU 1YJ9A 3NELA 3BJUA 5IAYA 3I7FA 3M56A 1QVGA 3PT9A 1I81A 3HY1A 1GGMA 5GMKm 4ZN3A 3JCMb 2KY9A 3RACA 3CMAA 4IUTA 5J39A 3QO5A 5KE3A 1EVKA 3AHUA 4LVKA 1YHQT 1R8OB 1N9RA 4C8QA 5E3IA 3CCST 2QHSA 5C51B 4IUUA 3QKJA 4RQEA 4LVLA 2ZPFB 2ZZFA 2O01E 3SWNB 3DB3A 1PYSB 4BI8B 4L87A 3CCET 5CKDA 1K9MC 3TEHB 4Y28E 3OSSC 2WSEE 4UP9A 1M90C 3URGA 1JJ2A 5FU7B 3HRKA 2HNIA 3I56T 3NFCA 4ZGEB 4PJOF 4GLKA 1WYDA 4YREA 1Q86U 1GXIE 4QVZA 4DOVA 3CBMA 2F5KA 3LSQA 1E24A 2YLCA 4M7DF 4C5IA 1VQ9T 2CZ7B 2RJDA 2DAQA 3BDLA 4J83A 3CXCS 4EMHA 4M7DE 4OB1B 4DOWA 3V7RA 5F5WA 5D6XA 2XDPA 1B70A 1M4ZA 1Q81C 5LJ5e 3JB9J 1BKBA 3OYDA 1YIJA 3P8TA 2QA4T 1QVFS 4HWPA 4J5YA 2A3LA 4MDXA 4P72A 4M7AD 3RKXA 1USYC 4YCVA 4XTYA 3RERA 3FC3A 2PUKB 2RJCA 2P0KA 4F7UF 2FB7A 4QQDA 3ICAA 3M4QA 2KVQG 4JS5A 1VQ7T 1KD1U 1FYFA 2RM4A 5LJ5f 3ASKA 2ZXFA 2XHCA 4O2DA 3TCJA 3QTCA 4KR2A 2XK0A 3CC7T 2QQAA 3PNWC 2Q7GA 1EIFA 4WJ4A 3EFSA 1KC8C 5LJ3d 4H2TA 2DTHA 2RK1A 4ZN1A 12ASA 4PLIA 1K8AU 3PCOB 3CCJA 1BYMA 3G4SA 3OMGA 3L2QA 1YGBA 4TVAA 1OZ3A 2LT4A 4YTLA 2HQEA 4KUIA 1I4K1 3WVDB 2C06A 1YHQA 2FL7A 1J5WA 2V8KA 3GPLA 3E9IA 4M77E 1EOVA 3VQYA 3NTKA 4XU0A 5GAOn 3MCAB 4TQFA 2ODRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXD A;  2Q5I A;  2QHV A;  1B7Y B;  3BW1 A;  4C92 F;  1HTT A;  4YCU A;  4EX5 A;  4M7A A;  1M8V A;  3RL6 A;  2ARS A;  1YB3 A;  4HT8 A;  3JB9 D;  1G5I A;  4YRF A;  3IKL A;  4DPG A;  3HXZ A;  1H4T A;  4MMK A;  3JB9 I;  5GAN j;  2DDZ A;  2DVE A;  2CJB A;  3PCO A;  3HFN A;  5C52 B;  4M75 C;  3HXU A;  4C8Q C;  1H64 1;  3L1A A;  2AMC A;  1C0A A;  3REU A;  3A32 A;  5GMK h;  2IY5 B;  3MEY A;  1I8F A;  3V7S A;  1NJ8 A;  3RKY A;  3RUX A;  5LJ3 j;  2YLB A;  4JRI A;  2ZIO A;  4M78 A;  4X9D A;  4C8Q B;  2VC8 A;  1E22 A;  3L2Z A;  4M78 D;  5GMK j;  3FJP A;  4M78 F;  3MF2 A;  2DXT A;  1YFR A;  2ZNJ A;  4H2V A;  4XTV A;  4XU3 A;  3LC0 A;  4RMF A;  3W3S A;  4PJO E;  1IL2 A;  3V8L A;  1WQ7 A;  4F7U E;  5LJ3 e;  2DKG A;  2ART A;  2I4O A;  4YRJ A;  3CMQ A;  5LJ5 h;  3JCM W;  4P73 C;  5GMK l;  3HXW A;  5DY9 A;  4P3P A;  5GAO q;  3RIR A;  4C92 B;  5K1P A;  4PJO C;  4N0A A;  4XTX A;  3A5Z A;  2ZTG A;  4M78 G;  5LJ5 d;  5HGQ A;  2AKW B;  3REX A;  3INZ A;  1USY A;  1NJ1 A;  3MF1 A;  2J3M A;  1NYQ A;  4J6X A;  4WI1 A;  1ADJ A;  3P8Y A;  4LNS A;  1Y96 A;  4XU2 A;  5I21 A;  3L4G A;  5GAM h;  3V8K A;  3G1Z A;  4TVY A;  5ELN A;  4YRP A;  4M75 G;  4Q15 A;  5GMK e;  4OLF A;  4G84 A;  3TEG A;  4RCC A;  3HXX A;  1B76 A;  4M77 A;  3VQX A;  4P74 C;  1EIY A;  1EQR A;  4M7D B;  5KNN A;  4HWR A;  4CH3 A;  4PNO A;  5LJ5 j;  3A7R A;  4XTW A;  2E3C A;  3VQW A;  4HWT A;  4HA8 A;  3V8J A;  2DTI A;  2DQ0 A;  1D3B A;  5GAN 6;  2DXU A;  3JCM d;  2ALY A;  1YCY A;  3M4G A;  1HK9 A;  4WF2 A;  4H2Y A;  2Q5H A;  1B70 B;  3HXV A;  4BWA A;  5GAO l;  2I2L A;  2VXE A;  2ODR D;  3TUP A;  1MGQ A;  1U1T A;  4X9C A;  4KR3 A;  4H2W A;  3V7C A;  4YRM A;  1VQZ A;  5CAI A;  3JCM P;  2I4M A;  4NCX A;  3HRI A;  3RGL A;  4Q6G A;  1SRY A;  4C92 C;  4YRK A;  4QVD A;  4F7U G;  1Z7M A;  2ZR2 A;  2EJF A;  2XGT A;  4YPF A;  1G5H A;  2ZZG A;  2QHU A;  4C92 G;  1BBW A;  3HFZ A;  1E1O A;  2ZT5 A;  2EAY A;  2RA2 A;  1KQ1 A;  2DZ9 A;  1YFS A;  3P8V A;  4YRI A;  4C8Q D;  3JCM f;  5GAN 8;  3QUI A;  3QSU A;  3L4G B;  4C8Q E;  1X55 A;  2I4N A;  3UGQ A;  1KMM A;  2Q7H A;  1KMN A;  2ZR3 A;  1X54 A;  4P71 C;  4K88 A;  4EMK A;  4C8Q G;  4EMG A;  4CS2 A;  2FYK A;  1WLE A;  4OP0 A;  4UPA A;  5GAN e;  2DZC A;  4CH4 A;  3TEH A;  3QO8 A;  2EJ9 A;  3QNE A;  3JCM g;  3R07 A;  4NOY A;  1U1S A;  4YP0 A;  4YRN A;  5GAN 2;  4V2S A;  4NL2 A;  3JCM J;  2J3L A;  2AMC B;  1B8A A;  4UP8 A;  4C92 D;  4P75 C;  4P72 C;  3HFZ B;  3A5Y A;  4CS4 A;  3PZC A;  3HSB A;  4H2U A;  3JCM h;  2E41 A;  4M75 B;  2ZZE A;  1X2H A;  5GAN 5;  2I4L A;  3HY0 A;  4J6W A;  4E51 A;  2Y90 A;  2XTI A;  5GMK i;  1BBU A;  4YRO A;  4YYE A;  3JCM Q;  1NYR A;  4M78 C;  4XTZ A;  2C7I A;  4EMK B;  4YRG A;  3HFO A;  4P3N A;  3NEM A;  4ZTZ B;  4PHC A;  4RCB A;  3KFU A;  3SB2 A;  3UH0 A;  4ZTU B;  1X56 A;  4M7D A;  3SWN C;  4M77 F;  2DU5 A;  2DJZ A;  4M7D D;  4M7A F;  3VBB A;  1N9S A;  3PGG A;  3FB9 A;  4M75 F;  1PYS A;  4TQD A;  2ARU A;  2ZT7 A;  4M78 E;  1JRI A;  1KQ2 A;  2RHQ A;  4RQF A;  4WJ3 M;  2RHQ B;  4P73 A;  2ZIM A;  4M7A E;  5GAM g;  4HWS A;  4PJO D;  4DQ2 A;  1NJ5 A;  5LJ3 g;  5GAN 7;  4M75 A;  4NL3 A;  5GAN h;  5GAN f;  2K57 A;  3BJU A;  3NEL A;  3WQZ A;  4PJO A;  3A31 A;  3I7F A;  1NNH A;  4F7U A;  2QHT A;  3A7U A;  2E64 A;  1WU7 A;  4M75 D;  5LJ5 g;  1I81 A;  1ADY A;  3HY1 A;  1B7Y A;  1GGM A;  1KOG A;  5GMK m;  3JCM b;  3RAC A;  4M7A C;  2P5I A;  2RHS A;  3QO5 A;  4K86 A;  4JLI A;  2EJG A;  1EVK A;  3JCM c;  3JCM X;  3AHU A;  1H4S A;  1N9R A;  4C8Q A;  5E3I A;  4ZIB A;  4XTU A;  2QHS A;  4C92 E;  4HWO A;  1B34 A;  5C51 B;  4M77 B;  1H4V B;  3IKM B;  1N9W A;  3BDU A;  4RQE A;  3JB9 H;  2ZZF A;  4TVW A;  4PJO G;  3SWN B;  4H2S A;  4A53 A;  5GAM j;  2DU7 A;  2ZCE A;  1W66 A;  1ASZ A;  1JJC A;  2E5A A;  2YHT A;  1PYS B;  4L87 A;  2EL9 A;  4K87 A;  4MML A;  1WQW A;  3JB9 G;  4F7U B;  3TEH B;  2QTX A;  2ZNI A;  1BIB A;  5GAN 4;  1SES A;  2ALY B;  1Z7N A;  4CH6 A;  4UP9 A;  2CJ9 A;  2ZT6 A;  5C53 B;  1I5L A;  2EWN A;  2E65 A;  5LJ3 f;  3HRK A;  1WPY A;  2HNI A;  1D3B B;  4J15 A;  4CH5 A;  1TH7 A;  2RD1 A;  3GIB A;  3LSS A;  1YFT A;  4JRK A;  4CS3 A;  4PJO F;  1WYD A;  4M7A B;  4YRE A;  3BY7 A;  4N0A C;  5GAN d;  4HVC A;  4BW9 A;  3QHS A;  2RHS B;  1E24 A;  2AKW A;  3LSQ A;  3DSQ A;  4YCW A;  2YLC A;  4M7D F;  3IAL A;  3VU3 C;  3JCM V;  1NJ6 A;  4YRL A;  4M77 D;  3QO7 A;  4QVC A;  1SET A;  4UP7 A;  4EMH A;  4M7D E;  3ERR A;  2C8M A;  1X01 A;  3V7R A;  5GAM d;  5GAM e;  4PG3 A;  5LJ3 h;  4EMK C;  5F5W A;  1JJC B;  3RF1 A;  1B70 A;  2PMF A;  4H2X B;  4XEM A;  3UGT A;  3VQV A;  5LJ5 e;  5K1X A;  3M4P A;  4A54 A;  4M75 E;  4YRQ A;  3JB9 J;  3QO3 A;  1JBM A;  1QE0 A;  2DTO A;  3P8T A;  4TTV A;  4P3O A;  4HWP A;  4PJO B;  4J5Y A;  4X5O A;  1QF6 A;  5GAN g;  2VXF A;  11AS A;  4P72 A;  2DQ3 A;  4M7A D;  3RKX A;  1USY C;  3JCM e;  4HT9 A;  4YCV A;  2CJA A;  3RKW A;  1BIA A;  4RDX A;  4XTY A;  1RIQ A;  3RER A;  2ZT8 A;  3E9H A;  1Y96 B;  2CGH A;  2RB6 A;  4TVA B;  5GAM f;  1ASY A;  1H4Q A;  4F7U F;  3BFM A;  1EFW A;  2CIM A;  4M78 B;  4EO4 A;  2FB7 A;  3ICA A;  3M4Q A;  1G51 A;  2ZGW A;  1X2G A;  3A74 A;  3HTZ A;  4M77 C;  4P74 A;  1EVL A;  1SER A;  1FYF A;  2RM4 A;  5LJ5 f;  4Y91 A;  1WNL A;  2ZXF A;  4M7D C;  1LOJ A;  3SWN A;  4AH6 A;  1LYL A;  3HFV A;  1E1T A;  4O2D A;  1LJO A;  3OD1 A;  5GAO m;  1EIY B;  3QTC A;  2PME A;  2P0L A;  4KR2 A;  3EFR A;  4KQE A;  4H02 A;  2Q7G A;  4J6Y A;  4WJ4 A;  3NET A;  3EFS A;  5LJ3 d;  4M7A G;  4H2X A;  2DEQ A;  4JUV A;  4H2T A;  2E1H A;  1NJ2 A;  4G85 A;  2DTH A;  1LNX A;  3HXY A;  4XQ3 A;  12AS A;  1ATI A;  3A7A A;  4YRS A;  4C92 A;  4M77 G;  3PCO B;  5GAN 3;  4YRT A;  2E10 A;  3FIF A;  4YDQ A;  2ZIN A;  5ELO A;  1YGB A;  2IY5 A;  4TVA A;  4P75 A;  4XEO A;  4M7D G;  4YRC A;  4YRR A;  5GAO p;  3IG2 A;  3RES A;  4XU1 A;  5GAO r;  1L0W A;  3NEN A;  1B34 B;  1I4K 1;  1M5Q 1;  4TWA A;  1HC7 A;  1J5W A;  2Q7E A;  3E9I A;  4M77 E;  4P71 A;  1EOV A;  3VQY A;  4XU0 A;  5GAO n;  3UFG A;  4C8Q F;  3JB9 F;  2G4C A;  2JN0 A;  4TQF A;  2ODR C; 
#chains in the Genus database with same CATH topology
 5CQY A;  1RI9 A;  2Q5I A;  2CP6 A;  1VQ4 A;  1QCN A;  3CCJ Q;  1M90 U;  2RHX A;  1YJN Q;  4YCU A;  3RMS A;  1WA7 A;  2KR3 A;  2ZPB B;  3GNG A;  3RDV A;  2DL8 A;  3EH1 A;  3JB9 I;  5D6Y A;  2HKN A;  3PCO A;  3G6E T;  4KUD K;  4KGX B;  5CQX A;  2A8E A;  3HXU A;  2RI3 A;  5HY6 A;  1G3Y A;  1C0A A;  1K73 U;  3I55 A;  3CCE A;  5FWB A;  3V7S A;  1NJ8 A;  1CKB A;  3RKY A;  3X28 B;  4JRI A;  3CPW S;  3L2R A;  4ATO A;  1QQJ A;  1VQK T;  3C0C A;  3MEW A;  3KFV A;  1E22 A;  2HMA A;  5GMK j;  2CZ6 B;  3FJP A;  4HCZ A;  3MF2 A;  2QEX T;  1WLP B;  1TSF A;  2LTO A;  4XU3 A;  4RMF A;  2P4R A;  3W3S A;  4PJO E;  2DVJ A;  2ED0 A;  4F7U E;  2MIO A;  1UGV A;  1VQO A;  1YBY A;  5I2M A;  1QKX A;  6AT1 B;  1YJW T;  1VIE A;  5HKC A;  3CMA T;  1I5O B;  1VQL A;  3A8G B;  1NLP C;  4C92 B;  3L42 A;  1MV0 B;  2DYI A;  2ENM A;  3A5Z B;  2AKL A;  2RQW A;  4O6J A;  3REX A;  2EGC A;  2O4X B;  3INZ A;  1NJ1 A;  2KRO A;  1OOT A;  2K5F A;  2J3M A;  2DL5 A;  3OYN A;  1ADJ A;  3P8Y A;  3S3M A;  4LNS A;  4J9H A;  4XU2 A;  5I21 A;  2V26 A;  5GAM h;  3V8K A;  2GGR A;  2X51 A;  2FG0 A;  1K1Z A;  4YRP A;  1AHJ B;  5GMK e;  4G84 A;  3TEG A;  2HQX A;  3BE3 A;  4RCC A;  1B76 A;  3HXX A;  4M77 A;  1AVZ C;  4P74 C;  1EIY A;  4VUB A;  3M58 A;  4M7D B;  4CH3 A;  4PNO A;  5LJ5 j;  3A7R A;  1YHQ Q;  4HA8 A;  3V8J A;  2DTI A;  4E7K A;  1NM7 A;  2FO0 A;  3E2U A;  3I56 A;  2WSF E;  2VXE A;  1ZSZ A;  3TUP A;  1OPK A;  1MGQ A;  1Z9Z A;  2HL5 C;  2QQB A;  2J6F A;  1M8M A;  2ZPG B;  3DLM A;  2I4M A;  3RGL A;  1UEB A;  2M1H A;  3E19 A;  1SRY A;  4C92 C;  4YRK A;  3M0T A;  4PKC C;  1VOM A;  2EJF A;  4C0G A;  2GFU A;  2XGT A;  2D0N A;  4ZTF A;  4JPB W;  4LNP A;  2QHU A;  4C92 G;  2X4J A;  4K11 A;  3HFZ A;  1YJN T;  2GQI A;  2EAY A;  2M51 A;  2YRC A;  4RTZ A;  5KYX A;  1S72 T;  2QK0 A;  2FHD A;  2CT4 A;  2FPE A;  1YP5 A;  2J6K A;  3P8V A;  4YRI A;  4C8Q D;  2IVW A;  3X26 B;  3UGQ A;  3MEU A;  4RG8 A;  3P8D A;  4P71 C;  4EMK A;  4C8Q G;  4EMG A;  4CS2 A;  5A0L A;  1B3Q A;  2F5T X;  8AT1 B;  4OP0 A;  1Q81 U;  2KXC A;  2M02 A;  3VS6 A;  2K3Y A;  2EJ9 A;  3VV0 A;  3JCM g;  4LVM A;  2PQW A;  4RTV A;  1U1S A;  5CKH A;  4Z02 A;  1PG5 B;  1T3L A;  3JCM J;  3EGX A;  1TWB A;  2J3L A;  2QTV A;  1B8A A;  2LNH B;  4UP8 A;  4JJN K;  4P75 C;  3HFZ B;  1UFF A;  2LMJ A;  2LJ1 A;  3LWH A;  1VQ8 Q;  3PZC A;  4H2U A;  3OW2 S;  2HEQ A;  2M0O A;  1VQ6 A;  4QW2 A;  3HY0 A;  2MAM A;  2P4T A;  3H8Z A;  5CKF A;  3FLG A;  4DBF A;  2Y90 A;  2O4X A;  1BBU A;  2LQK A;  3CCV T;  3JCM Q;  4NS5 A;  2YRV A;  2C7I A;  1NEB A;  4P3N A;  4MZP A;  3SB2 A;  5FRM A;  5D7U A;  2JM8 A;  2MYS A;  1O9S A;  3H9N A;  4HCK A;  3HP9 A;  1PYS A;  3CC4 A;  4ZNX A;  3EGD B;  4M78 E;  2R5A A;  4CI0 C;  2AZV A;  3PFS A;  1NJ5 A;  3M0S A;  5GAN 7;  4CC7 A;  1R0B G;  2ECZ A;  4M75 A;  4NL3 A;  2K57 A;  3WQZ A;  4PJO A;  2QQR A;  3A31 A;  3C4S A;  4Q5W A;  1VQM A;  1WU7 A;  2LC4 A;  4M75 D;  5LJ5 g;  2MOX A;  1JQQ A;  2QQS A;  1QVG P;  2ATC B;  5HK3 A;  4M7A C;  4C5H A;  2P5I A;  2VV5 A;  4LUE A;  4LUD A;  2OTL Q;  2RHS A;  2I0N A;  2QAS A;  4K86 A;  4FL6 A;  2C0T A;  2EJG A;  1H4S A;  1M90 R;  2OTL A;  3U23 A;  3OYI A;  1N6A A;  4XTU A;  4ZIB A;  4C92 E;  1B34 A;  3C94 A;  4GY5 A;  3G71 A;  1ZUK A;  4JS4 A;  1NLO C;  3VYG A;  1XOV A;  4H2S A;  1RAI B;  2EQM A;  2KNB B;  2YT6 A;  5GAM j;  3CCV A;  2ZCE A;  1U5S A;  2YHT A;  2EL9 A;  1LCK A;  2EYZ A;  4JJB A;  3SDZ A;  4F7U B;  1SEM A;  4C0F A;  3S3O A;  3OMC A;  3VS7 A;  2KRN A;  2ZNI A;  1F1B B;  2OAU A;  3OSV A;  2O9V A;  3HL8 A;  1RAE B;  3LW5 E;  1VQ6 T;  2FPF A;  3M0P A;  3L2V A;  5IHN A;  4BY6 B;  1XNI A;  2JMC A;  5DLO A;  2EWN A;  1WDX A;  5A0G A;  3OYH A;  4PJJ A;  1D3B B;  1D0Y A;  1UDL A;  3O8V A;  1YIT A;  1TH7 A;  3LSS A;  3VS4 A;  4JRK A;  1KQS S;  1M3B A;  2QGF B;  1BB9 A;  1VQP Q;  3FJ5 A;  3BY7 A;  3QII A;  2CDT A;  2J7I A;  4BW9 A;  2RHS B;  4YCW A;  3L2W A;  3DSQ A;  2JTE A;  4OB0 B;  3IAL A;  4ZGJ B;  3VU3 C;  2EGA A;  3JCM V;  3VS2 A;  3FDR A;  4YRL A;  3I5S A;  1KQS A;  1VQ8 T;  2E5Q A;  2QQ9 A;  1RAD B;  1G5V A;  1CKA A;  2EW3 A;  2YWW A;  5IXF A;  4ME7 A;  4PJM A;  5GAM e;  4PG3 A;  5LJ3 h;  1YI2 T;  1QKW A;  2EQJ A;  3NGP A;  3CCM Q;  3RF1 A;  2K5L A;  2KDS A;  1ZX6 A;  1FYN A;  1VQK Q;  2X3W D;  3C12 A;  2OI3 A;  4QQ6 A;  2YDL A;  4M75 E;  4YRQ A;  1M1K U;  1QE0 A;  1QP2 A;  3LWI A;  1W2B A;  4TTV A;  2Y4Y A;  4P3O A;  4X5O A;  1QF6 A;  5GAN g;  1B7T A;  3GBQ A;  3E1S A;  4KH1 B;  2HQH A;  2JVV A;  1QMC A;  2D0Q B;  2DET A;  1BIA A;  4RDX A;  3OYF A;  1NJI R;  2XDB A;  1RIQ A;  4RUG A;  1SKU B;  2ZT8 A;  1Y96 B;  3VUB A;  2EYQ A;  2EFI A;  2KBT A;  2X4W A;  2QA4 Q;  1MMN A;  1ZUU A;  4TVA B;  1ASY A;  4AT1 B;  3CME T;  1EFW A;  1KFZ A;  5EG2 A;  2DYB A;  2DBK A;  2NUT A;  1G51 A;  2WSC E;  2ZGW A;  2BTT A;  4OVA A;  2DLP A;  1UEC A;  3GNF B;  3M4Y A;  1RAC B;  2XDD A;  1EVL A;  2ESW A;  1SER A;  2MI6 A;  1WNL A;  2K5I A;  4M7D C;  3SWN A;  4AH6 A;  3QDF A;  1NJI U;  3HFV A;  4E7I A;  1IZ6 A;  2RH2 A;  2PME A;  3H0F A;  9ATC B;  1FMV A;  4A63 B;  4H02 A;  1M9S A;  4AFQ C;  1IHV A;  1GFD A;  5KH6 A;  4JUV A;  3I35 A;  4OB3 B;  4XQ3 A;  3X20 B;  1ATI A;  3MPU B;  3CCL A;  3N5B B;  1K0X A;  5KYY B;  4OGE A;  3MET A;  2AIR B;  5GAN 3;  4YRT A;  5CIU A;  4A4G A;  1Q81 R;  1EX4 A;  3FIF A;  4YDQ A;  5ELO A;  2QG9 B;  1Y57 A;  2KRM A;  4XEO A;  4YRR A;  2E3H A;  1K9M U;  1QP3 A;  4LD9 K;  4CC4 B;  4M4Z A;  1PRM C;  1W4S A;  2RI5 A;  2HBP A;  2K3B A;  4OB2 B;  1U3O A;  4E7S A;  4PFZ A;  4JRP A;  3CC2 T;  4TWA A;  1RLP C;  2E6N A;  1W2B P;  3SHW A;  4BDZ A;  1HYO A;  1ZQ1 A;  2Q7E A;  2K3X A;  3CBP A;  3HRT A;  2KI7 A;  1BCO A;  3UFG A;  1S72 Q;  3JB9 F;  1WJR A;  1ZSG A;  3I55 T;  3EHQ A;  1HXD A;  2QHV A;  1B7Y B;  5KCH A;  3BW1 A;  3M53 A;  2BE7 D;  4M7A A;  3VUZ A;  1VQN T;  4D8K A;  3RL6 A;  1YNZ A;  4HT8 A;  3JB9 D;  3OA6 A;  3CCU A;  1G5I A;  4YRF A;  2HAX A;  3HXZ A;  2RNA A;  4MMK A;  1H4T A;  2DDZ A;  3HFN A;  2DBM A;  3UT1 A;  4C8Q C;  3REU A;  3UWN A;  2IY5 B;  3UAT A;  4E7Z A;  3M0Q A;  2OTJ T;  1ZA1 B;  5LJ3 j;  1Q7Y R;  2YLB A;  3CCU Q;  7AT1 B;  2RQU A;  5FRO A;  2BIV A;  3G71 T;  3I55 Q;  4P5N A;  3HKS A;  2L8D A;  2K2M A;  3PVL A;  3G6E Q;  4OML A;  4OMM A;  2CYZ B;  4M78 F;  2DXT A;  1UE9 A;  2RHI A;  1AOJ A;  1YFR A;  2ZNJ A;  4H2V A;  2K4Y A;  1WQ7 A;  3CCS Q;  1ZHI A;  1VQN Q;  5LJ3 e;  1S72 A;  2C0O A;  2CSI A;  2PNI A;  2FPD A;  2DKG A;  2I4O A;  2ABL A;  2KXD A;  3CMQ A;  2XU8 A;  2DJQ A;  3J80 E;  3F70 A;  5K1P A;  4ZTJ A;  5KYW B;  2ZTG A;  4M78 G;  3OS2 A;  1WHG A;  2V8J A;  3CCU T;  4E7J A;  4N4H A;  5HGQ A;  2MWP A;  3G71 Q;  1USY A;  3M57 A;  4CRI A;  1K4U S;  3MF1 A;  1AEY A;  2CZ1 B;  2AHJ B;  3CCR A;  4LVJ A;  1OU8 A;  1NYQ A;  5FU6 B;  4RTT A;  4L59 A;  2EBP A;  1AD5 A;  4OMN A;  3M59 A;  1UJY A;  5EC7 A;  1PSE A;  1WFW A;  4TVY A;  5ELN A;  4OLF A;  2H3E B;  3RR6 A;  2W0Z A;  1WYX A;  5KE2 A;  5GJV B;  2JNG A;  1OU9 A;  4GBQ A;  1KSW A;  1VYV A;  2A7Y A;  3T9N A;  2K9G A;  4BD3 A;  4O5V A;  1S1N A;  3OYA A;  5GAN 6;  3JCM d;  4BWA A;  3X24 B;  4BI4 A;  1M2O A;  4H2W A;  1VQZ A;  1SSF A;  5CAI A;  3JCM P;  2VYT A;  4HVU A;  1M1K C;  3HTR A;  2RI2 A;  3OYE A;  1Z7M A;  1YIJ T;  1VIF A;  5IHK A;  1AWW A;  2ZZG A;  2CUD A;  2YUP A;  1VQO T;  1AWO A;  4LE9 A;  3JAM E;  2QEX A;  3JCM f;  4E47 A;  3QUI A;  4B6M A;  4KUL A;  5GAN 8;  4C8Q E;  4AG1 C;  3CCE Q;  2Q7H A;  1G3S A;  2P0Q A;  4J9B A;  2OTJ A;  1X54 A;  2IIM A;  4LDW A;  1VQ9 A;  2K79 A;  1K73 C;  2DZC A;  4RMO A;  2HSP A;  1PD0 A;  4LN2 A;  2VVK A;  3A1P A;  1TUG B;  2X9H A;  1Q82 C;  5CO7 A;  5J3B A;  2M0Y A;  4NL2 A;  4V2S A;  1M27 C;  2KGT A;  4C0D B;  4FYW B;  3KBG A;  3HHT B;  4P72 C;  4PFO A;  3A5Y A;  1MMA A;  3DKM A;  4KT0 E;  3H41 A;  2ZZE A;  5FU7 C;  1QWF A;  4FYY B;  4J6W A;  3OYB A;  5FU6 C;  2DMO A;  4J7F A;  4A4F A;  4E51 A;  3LX7 A;  2C0I A;  2XTI A;  2KEA A;  1OUL A;  4YRO A;  2VGN A;  4XTZ A;  4E2F B;  1X6O A;  3NEM A;  1E6G A;  3KFU A;  2DFU A;  1X56 A;  4IUQ A;  2JS0 A;  3CD6 T;  3TVT A;  2DJZ A;  4M7A F;  3DB4 A;  2X35 A;  5CVI A;  2KAF A;  1X27 A;  4M75 F;  4TQD A;  2XI9 A;  2ZT7 A;  4FW2 A;  1JRI A;  2DM1 A;  4WJ3 M;  4P73 A;  4HCC A;  1QVF A;  5CK9 A;  4DQ2 A;  2LNV A;  5LJ3 g;  1VQM T;  2BUD A;  5GAN h;  2PU9 B;  4HT4 A;  2CP7 A;  2CS7 A;  4F7U A;  3J81 E;  2BZX A;  2QHT A;  2E64 A;  1KD1 C;  3EG1 A;  3CC4 Q;  1ADY A;  3EAE A;  1NZ9 A;  3OY9 A;  1YJ9 T;  1KOG A;  4FU6 A;  3P8B B;  3QYH B;  4HCB A;  1K0S A;  1KC8 R;  1ABQ A;  1HSQ A;  1WHJ A;  1GBQ A;  3CD6 Q;  3S3N A;  1U06 A;  2GQV A;  5FW9 A;  4QQG A;  2PUO B;  1MNE A;  4JLI A;  4Z8A A;  3JCM c;  3JCM X;  1ZUY A;  2CH4 W;  4LDY A;  4RTU A;  1GCQ A;  3RBB B;  3MQZ A;  4HWO A;  2JOY A;  4M77 B;  1VQ7 A;  1H4V B;  3M9Q A;  2RQV A;  4F17 A;  2A36 A;  3JB9 H;  1RAH B;  2OTL T;  4TVW A;  4PJO G;  3MP6 A;  1Q82 R;  3G1J A;  2K7A A;  4J9G A;  1UGS B;  5ECA A;  1W66 A;  1JJC A;  2E5A A;  1TUD A;  2PVO B;  4Z88 A;  4K87 A;  4MML A;  1YJ9 Q;  3JB9 G;  3NTI A;  1RAG B;  1NJI C;  3QJ6 A;  5GAN 4;  1SES A;  3H0H A;  1I5L A;  2E65 A;  5LJ3 f;  2FRY A;  4JLG A;  2B8A A;  1MUZ A;  1O75 A;  4CH5 A;  4DBR A;  2RD1 A;  1BI0 A;  3GIB A;  1YFT A;  4CS3 A;  3EFO B;  2CT3 A;  1VQL T;  2J05 A;  2XG8 D;  3E9F A;  4LDU A;  4C0D C;  1VQ6 Q;  1UGP B;  2DIG A;  1IGQ A;  2AKW A;  4PLL A;  1NG2 A;  2EQK A;  3CD6 A;  1K8A C;  2YRD A;  3ER0 A;  3QO7 A;  2D6F A;  2DXB A;  4QVC A;  2DRM A;  4UP7 A;  4EIK A;  3ERR A;  3QG1 A;  2X4X A;  4BAC A;  2C8M A;  1OPL A;  2COZ A;  2COY A;  1TS9 A;  4B9W A;  5GAM d;  4PJN A;  3ZL7 C;  2NYS A;  1BI2 A;  3OYJ A;  1X2K A;  4EMK C;  1JJC B;  4H2X B;  3H6Z A;  5KYU B;  1U8R A;  5C0M A;  4B9X A;  1YIT T;  3R6O A;  2DTO A;  2R57 A;  2FZK B;  2RF0 A;  1FMW A;  4PJO B;  2DIL A;  4KRT A;  1ZA2 B;  3CCM T;  1VQ5 A;  1FXX A;  3OS5 A;  4HT9 A;  2CJA A;  1M3C A;  1TTH B;  1UHC A;  3RKW A;  1LVK A;  4D8D A;  5CR2 A;  4JDS A;  2D8J A;  3CCL Q;  1MMG A;  2CGH A;  2RB6 A;  3EG9 B;  3BFM A;  1VQ5 Q;  2CIM A;  2CUB A;  2COW A;  3MEV A;  4EO4 A;  1GBR A;  4IUR A;  1JB0 E;  1XQH A;  2DPP B;  3A74 A;  3HTZ A;  2EQI A;  2ED1 A;  4E6R A;  3TEE A;  3CXC P;  1LOJ A;  4X1V A;  2HCK A;  5HCK A;  4DBQ A;  2M16 A;  2DIQ A;  3OD1 A;  3A8M B;  3PE0 A;  2DL3 A;  1E7O A;  4C0Z A;  2JM9 A;  4KQE A;  4FSX A;  1KJW A;  1K9M R;  3NET A;  3CCL T;  4M7A G;  1ZSZ C;  2CKK A;  1NJ2 A;  1G3T A;  3EGX B;  3CCM A;  1VQ5 T;  3PMI A;  3A8O B;  2W10 A;  1OI1 A;  3MHX A;  4YRS A;  2SRC A;  1A0N B;  4PFP A;  1KHC A;  2E10 A;  2L3P A;  2EQU A;  2NUP B;  2ZIN A;  5J26 A;  1SG5 A;  3HPW A;  4M7D G;  2BZ8 A;  3OQ5 A;  2JW4 A;  4LVI A;  5KYX B;  4FYX B;  3IG2 A;  3RES A;  1WJS A;  4XU1 A;  3VJP A;  2KQW A;  1WGS A;  1SF9 A;  2DRK A;  3CME Q;  1M5Q 1;  2QYZ A;  5CCA A;  3GP8 A;  4BE1 A;  1HC7 A;  2VB6 A;  1IO6 A;  2LX9 A;  3OW2 P;  3CME A;  2GBQ A;  2LCS A;  2DK3 A;  1M1G A;  2QEX Q;  4II1 A;  2RPN A;  1Q86 C;  1VQO Q;  2G4C A;  3LH0 A;  3CCR T;  3OYC A;  3R6N A;  2M9U A;  3TRE A;  1AZG B;  5IH2 A;  5KYN A;  2E6Z A;  1YFN A;  3TSZ A;  3CCQ A;  2O88 A;  1D1B A;  1IGU A;  1NBE B;  4MZM A;  1X75 C;  2ARS A;  4IKF A;  1YB3 A;  3IKL A;  4DPG A;  3OBW A;  1EFN A;  5GAN j;  2DVE A;  2EVR A;  3REA B;  5C52 B;  3DLL A;  1H64 1;  3L1A A;  2AMC A;  4F16 A;  5D6W A;  1I8F A;  2RJE A;  3RUX A;  1SSH A;  1WI7 A;  3OYL A;  2ZIO A;  4M78 A;  4E7L A;  4C8Q B;  2NUT B;  2E70 A;  3L2Z A;  4LXC A;  4M78 D;  2FVU A;  1RLQ C;  2CZ0 B;  4XTV A;  2DD5 A;  2JT4 A;  4LDX A;  2J6O A;  4C5E A;  1IL2 A;  2QXF A;  1X6G A;  4UC4 A;  1Z9Q A;  2GNC A;  4YRJ A;  4FYV B;  4EPC A;  4JJC A;  3OS0 A;  1PM3 A;  5LJ5 h;  2LX7 A;  3CCJ T;  2YXY A;  1W2B S;  4HVW A;  3JCM W;  4A4H A;  5GMK l;  3HXW A;  2H3J A;  5DY9 A;  4P3P A;  1JU5 C;  1J3T A;  3RIR A;  4XTX A;  1ZSZ B;  1VQN A;  3A5Z A;  1PHT A;  3UDC A;  2AKW B;  3QXE B;  1G3W A;  2DO3 A;  2DXC A;  1I07 A;  2KSS A;  1ABO A;  2G3R A;  4WI1 A;  1UB4 A;  2JMA A;  4PK4 A;  2O9S A;  1ARK A;  1UGR B;  2MWO A;  3CBO A;  5FWC A;  3TSW A;  3G1Z A;  1RUW A;  3M0R A;  4Q15 A;  1BI1 A;  1NPR A;  3REB B;  2P84 A;  1BI3 A;  4D6W A;  1EQR A;  2L3Q A;  1VQ8 A;  5KNN A;  4R0K A;  1M3A A;  4HWR A;  1WX6 A;  4BB7 A;  4BE2 A;  2E3C A;  1X2Q A;  3J7A F;  2DQ0 A;  2GFA A;  1MHN A;  1D3B A;  1E6H A;  1N8R U;  3FEO A;  2DXU A;  2ALY A;  3VYH B;  2Q5H A;  1W1F A;  2A37 A;  2FZG B;  3VS1 A;  5GAO l;  1B70 B;  4H2Y A;  2ODR D;  1RAB B;  2RHY A;  1Y7X A;  4XK8 E;  3V7C A;  4YRM A;  4NCX A;  2MF2 A;  1IXD A;  3VS0 A;  2RJF A;  4QVD A;  2HDA A;  3NPF A;  3S6W A;  3GF5 A;  1QLY A;  1V76 A;  1D09 B;  2ZCF B;  3KXT A;  2D1X A;  1G5H A;  4EDU A;  1BBW A;  5C6S A;  1YWO A;  4GLM A;  2ZT5 A;  2LQN A;  1VQ7 Q;  3MP8 A;  3MEA A;  1I1J A;  2EYW A;  2EIF A;  1NPP A;  1PWT A;  2DZ9 A;  1YFS A;  2G6F X;  3VS5 A;  3L4G B;  1X55 A;  1KMM A;  1X43 A;  1KMN A;  2ZR3 A;  3VS3 A;  3MO8 A;  3UA7 A;  4F04 B;  1HD3 A;  2ZAE A;  4K88 A;  2KE9 A;  2FYK A;  4BY6 C;  4OGC A;  2ROL A;  5GAN e;  1D0Z A;  3JV3 A;  1PC0 A;  3TEH A;  1N27 A;  4YRN A;  5GAN 2;  4IUV A;  3HRU A;  1IRE B;  2EGE A;  4RTW A;  5GJW B;  1VQP T;  2AMC B;  2HD0 A;  1IHW A;  1QWE A;  3HSB A;  3JCM h;  3PTA A;  4M75 B;  4J9C A;  2HL3 A;  1ZLM A;  1X2H A;  2RHU A;  5GAN 5;  2I4L A;  3PIO A;  4BE0 A;  5GMK i;  2LQ8 A;  3EFO A;  2DEU A;  1D0X A;  5IHI A;  1DJ7 B;  4L5G A;  3LH5 A;  4DEY A;  2XD0 A;  4YRG A;  3GOX A;  2YUO A;  1Q95 G;  4ZTZ B;  2QAZ A;  4RCB A;  1OYX A;  2LDM A;  3SWN C;  3JSC A;  1LPL A;  2L5Q A;  3VBB A;  1QVF P;  3PGG A;  3FB9 A;  3NHN A;  3QZ9 B;  2E3I A;  4RQF A;  2DA9 A;  2A28 A;  2RHQ B;  5KCO A;  1EZZ B;  5GAM g;  4HWS A;  4PJO D;  3P8H A;  2ROT A;  2X4Y A;  3QDR B;  5GAN f;  4N4I A;  3M5A A;  4DEX A;  1NNH A;  3QYG B;  2FEI A;  3A7U A;  3OB9 A;  5FLX E;  2VUB A;  2R58 A;  1B7Y A;  3UPU A;  2Y4X A;  3CC7 A;  2L0A A;  3OYM A;  5KYW A;  2YSQ A;  2NS6 A;  3PMT A;  4R55 A;  5A2Q E;  1H8K A;  4KBM B;  4HVV A;  1NEG A;  4J7I A;  4N4G A;  1YI2 A;  2KYM A;  1RAF B;  2O31 A;  1TUC A;  3LGF A;  1UHF A;  2EYX A;  3E9G A;  3IKM B;  1N9W A;  3BDU A;  2J06 A;  5L23 A;  1YJW Q;  1WJQ A;  2F69 A;  4A53 A;  2DU7 A;  3OYY A;  1ASZ A;  1WQW A;  1D1A A;  3SD4 A;  2QTX A;  1N8R C;  1BIB A;  1XJW B;  1YCS B;  2ALY B;  1Z7N A;  4CH6 A;  2CJ9 A;  2ZT6 A;  5C53 B;  1WHM A;  3LLR A;  3PVQ A;  1G2B A;  2JUF A;  1WPY A;  4J15 A;  1VQP A;  3QWY A;  1JJ2 P;  2XKO C;  4JJD A;  4M7A B;  5GAN d;  4N0A C;  2DF6 A;  1FWZ A;  3QBY A;  4HVC A;  4BUG A;  3QHS A;  2LCC A;  2GF7 A;  3X25 B;  1NJ6 A;  3CC2 Q;  3NMZ C;  2CP5 A;  4M77 D;  3ZEH A;  2NUP A;  4A4K A;  4ELZ C;  2NUZ A;  1SET A;  3I5R A;  1M30 A;  1KG1 A;  3G4S Q;  3CC2 A;  3CCV Q;  2IG0 A;  1X01 A;  3ME9 A;  4JRQ A;  4L6V 5;  4LDV A;  1R77 A;  1PKT A;  1PRL C;  3UF4 A;  1Q7Y C;  4A4E A;  2PMF A;  3G7Z A;  4XEM A;  3UGT A;  1X6B A;  4BDY A;  1JXO A;  3VQV A;  5K1X A;  3M4P A;  4A54 A;  4ESR A;  4AFZ C;  2L2P A;  3QO3 A;  1JBM A;  2LT1 A;  2YUN A;  1VUB A;  1K76 A;  1GCP A;  3C95 A;  1WXB A;  3A8H B;  4RTX A;  5HK0 A;  2VXF A;  11AS A;  2DQ3 A;  1Y71 A;  5IN1 A;  3JCM e;  2QA4 A;  4J9I A;  2LRQ A;  2RMO A;  3E9H A;  2PVD B;  4RTY A;  1TU0 B;  4J9F A;  4FW1 A;  5GAM f;  1R0C B;  2WAC A;  3EG9 A;  1H4Q A;  2CH4 A;  2MPX C;  1V29 B;  4PJL A;  2LQW A;  2LP5 A;  4M78 B;  1OV3 A;  2JTM A;  3VRZ A;  4FSS A;  4JZ3 A;  3CEY A;  1CSK A;  1X2G A;  1N5Z A;  2JTF A;  3CCS A;  4M77 C;  1IB8 A;  4P74 A;  2ZPI B;  1YI2 Q;  2L3S A;  2KMT A;  3LYI A;  4Y91 A;  3OYG A;  1LYL A;  1SRL A;  3IQL A;  1E1T A;  1I0C A;  2FRW A;  1LJO A;  5GAO m;  1EIY B;  3CXC A;  2P0L A;  2ZPE B;  3VKI A;  2LVM A;  4FCY A;  3EFR A;  4ANJ A;  4J6Y A;  1JJ2 S;  3CPW P;  3ZBD A;  1NYG A;  2GCX A;  4H2X A;  2DEQ A;  2HKQ B;  1T0H A;  2E1H A;  3A98 A;  4G85 A;  1LNX A;  1KD1 R;  3HXY A;  3CPW A;  2RO0 A;  3A7A A;  4C92 A;  5DLQ E;  4M77 G;  2JZ2 A;  3OBY A;  2IY5 A;  1K9A A;  3VRY A;  1QVP A;  4P75 A;  4YRC A;  1D1C A;  4BI3 A;  1M1F A;  1C0M A;  2F1L A;  5I22 A;  5GAO p;  3JRZ A;  5GAO r;  3RNJ A;  3EHR A;  4C5G A;  1L0W A;  3NEN A;  1B34 B;  1SRM A;  4AFS C;  1C1A A;  3FRN A;  5FRN A;  5KYU A;  2KK4 A;  3EG0 A;  3HRS A;  4P71 A;  1OX8 A;  3OYK A;  2F2V A;  4J8O A;  3I56 Q;  2V1Q A;  4C8Q F;  2DL4 A;  2F2W A;  2JN0 A;  1UGQ B;  2L89 A;  4CC3 A;  2XIC A;  2AT1 B;  4KGV B;  3G4S T;  2QDL A;  5AYF A;  1ZBJ A;  1NYF A;  4C92 F;  1HTT A;  4EX5 A;  1M8V A;  1M2V A;  4FIB A;  4RKU E;  4FM4 B;  4XAX B;  1FX7 A;  3CCR Q;  4R56 A;  2CJB A;  3CCQ T;  1GCQ C;  2NLU A;  1UJ0 A;  4M75 C;  1Y07 A;  5IT9 E;  3CC4 T;  2E12 A;  4HXJ A;  3A32 A;  2EKO A;  1G83 A;  5GMK h;  3MEY A;  2OJ2 A;  2MCN A;  2V8I A;  4MDW A;  4X9D A;  1PNJ A;  2VC8 A;  3CMA Q;  1MND A;  1SHF A;  4ZGD B;  3EGU A;  3LC0 A;  1ZBX A;  1RI0 A;  5DM7 R;  3V8L A;  4F14 A;  5CKB A;  1ACM B;  2ART A;  1K73 R;  1KC8 U;  3MKD A;  4IUP A;  2OAW A;  3WVE B;  1Q86 R;  3UA6 A;  2P0P A;  3CCQ Q;  3G6E A;  4P73 C;  2CSQ A;  1KK7 A;  1PKS A;  5GAO q;  3ULR B;  2K6D A;  4X34 A;  2LJ3 A;  4PJO C;  4N0A A;  4KH0 B;  2HBW A;  2AZS A;  5LJ5 d;  4OMF B;  2A0F B;  1VYT A;  1WZO A;  2PZ1 A;  1Q82 U;  2Z0W A;  5LL6 S;  2MMP A;  2OTJ Q;  2XMF A;  4Y92 A;  2RHZ A;  4FT4 A;  1G8X A;  2MK5 A;  4JZ4 A;  1UG1 A;  4J6X A;  4AG2 C;  4AFU C;  1OZ2 A;  2CP2 A;  3OW2 A;  1Y96 A;  4IIM A;  2CP3 A;  1OX9 A;  3QWX X;  2D9T A;  1VQL Q;  3SEM A;  3L4G A;  2BE9 B;  2DL7 A;  1M1K R;  2CRE A;  4HKE A;  4M75 G;  4RG2 A;  1IRX A;  2KRS A;  4OF1 A;  3CC7 Q;  2XID A;  3VQX A;  3QPH A;  2GTJ A;  2PVG B;  2ZZD A;  3RMQ A;  1YJN A;  1PSF A;  3PIP A;  2RK2 A;  4XTW A;  3VQW A;  4HWT A;  5L8R E;  3QZ5 B;  1Y0M A;  2B86 A;  1YCY A;  3M4G A;  1HK9 A;  5CKE A;  4WF2 A;  1QVG S;  3HXV A;  2I2L A;  3M55 A;  2K2V A;  1M2V B;  1U1T A;  4DA4 A;  4X9C A;  4ELY C;  4KR3 A;  1T3S A;  3ZFJ A;  2DD4 A;  3HRI A;  1SHG A;  1W6X A;  1WXT A;  2LZ6 B;  4Q6G A;  1VQ4 T;  4F7U G;  2QDY B;  2ZR2 A;  1BU1 A;  3O5Z A;  4YPF A;  1MMD A;  3M54 A;  3H0I A;  1E1O A;  1WHK A;  3A8L B;  2L3R A;  4MZT A;  2RA2 A;  1KQ1 A;  3NTH A;  1XTD A;  1FMK A;  2IPO B;  1RL2 A;  4TVR A;  3QSU A;  4LD6 A;  2I4N A;  3SFM A;  2ZPH B;  1QW1 A;  4E7H A;  2QI2 A;  2SEM A;  2R5M A;  1WLE A;  4UPA A;  4CH4 A;  3QO8 A;  2KT8 A;  3QNE A;  3R07 A;  4NOY A;  4YP0 A;  1HJD A;  1H92 A;  1VYU A;  1KHI A;  5I2S A;  3KUF A;  3WXM B;  2LCL A;  2BKD N;  3L2U A;  4C92 D;  1JO8 A;  2HZY A;  1YWP A;  1VQM Q;  4CS4 A;  1WHL A;  5A0D A;  3GLX A;  2E41 A;  4WTO B;  1YJW A;  1X69 A;  5AT1 B;  2KYB A;  2VGM A;  1GL5 A;  4YYE A;  2OX7 A;  1NYR A;  4M78 C;  4EMK B;  3HFO A;  5IXB A;  3OS1 A;  4PHC A;  1TXQ A;  1VQK A;  3UH0 A;  3CPF A;  4ZTU B;  4M7D A;  3MP1 A;  1NE8 A;  1P92 A;  4M77 F;  1V1C A;  2DU5 A;  1BK2 A;  2HSE B;  4M7D D;  4PL6 A;  1N9S A;  3QJY A;  1H3Z A;  3EGD A;  2ARU A;  3LGL A;  1KQ2 A;  2YUQ A;  3Q1J A;  1KQS P;  2RHQ A;  2NWM A;  2ZIM A;  4M7A E;  3TU4 K;  4FT2 A;  2VAS A;  5M9O A;  1Q7Y U;  1YJ9 A;  2RN8 A;  2VWF A;  3NEL A;  3BJU A;  5IAY A;  3M56 A;  3I7F A;  1QVG A;  3PT9 A;  1I81 A;  3HY1 A;  2DNU A;  1GGM A;  4OMO A;  5KYY A;  5GMK m;  4ZN3 A;  3JCM b;  4AMC A;  2KY9 A;  3RAC A;  1RAA B;  3CMA A;  1TOV A;  4IUT A;  5J39 A;  3QO5 A;  2DX1 A;  3AT1 B;  5KE3 A;  1YIJ Q;  1EVK A;  3EG2 A;  1TG0 A;  3AHU A;  4LVK A;  2AK5 A;  2RQT A;  1R8O B;  4J9D A;  1N9R A;  4C8Q A;  1YHQ T;  1KIK A;  5E3I A;  1VQ4 Q;  3CCS T;  1YN8 A;  2QHS A;  5C51 B;  4IUU A;  3QKJ A;  4RQE A;  4LVL A;  1UUE A;  2ZPF B;  1BBZ A;  2ZZF A;  2O01 E;  3SWN B;  3DB3 A;  1AWJ A;  1PYS B;  4BI8 B;  4L87 A;  2EPD A;  3CCE T;  5CKD A;  1K9M C;  3TEH B;  4Y28 E;  2D8H A;  5I11 A;  2EYY A;  4KGZ B;  3OSS C;  2WSE E;  4UP9 A;  1M90 C;  3URG A;  1JJ2 A;  5FU7 B;  3EH2 A;  3HRK A;  2O2O A;  2HNI A;  3I56 T;  2PTK A;  1AZE A;  2H8H A;  3NFC A;  4ZGE B;  4PJO F;  4GLK A;  2RQR A;  1WYD A;  4YRE A;  1Q86 U;  2FZC B;  1GXI E;  4QVZ A;  1PCX A;  4DOV A;  3CBM A;  2F5K A;  1UTI A;  1E24 A;  3LSQ A;  1GFC A;  2YLC A;  4M7D F;  4C5I A;  1VQ9 T;  2QGG A;  2CZ7 B;  1PD1 A;  2DAQ A;  2RJD A;  3BDL A;  4J83 A;  3CXC S;  1OEB A;  4EMH A;  4M7D E;  2GTO A;  2E5K A;  2AKK A;  2LJ0 A;  4OB1 B;  4DOW A;  3V7R A;  3CQT A;  1MV3 A;  5F5W A;  1BCM A;  5D6X A;  2XDP A;  1B70 A;  3EG3 A;  1M4Z A;  2CP0 A;  2DE0 X;  1Q81 C;  1WHH A;  5LJ5 e;  2F2X A;  3JB9 J;  1BKB A;  3OYD A;  3M0U A;  4QKU A;  1YIJ A;  3I9Q A;  3P8T A;  2QA4 T;  4DBH A;  1WXU A;  1QVF S;  4HWP A;  1VQ9 Q;  3THK A;  4J5Y A;  1T0J A;  4IIO A;  2A3L A;  4MDX A;  4P72 A;  4M7A D;  3RKX A;  1USY C;  1GRI A;  2E4H A;  4YCV A;  4XTY A;  3RER A;  3FC3 A;  2PUK B;  1QCO A;  2RJC A;  3D7S B;  2P0K A;  1QCF A;  1N8R R;  1C6V X;  4F7U F;  1B07 A;  4OMP A;  2FB7 A;  4QQD A;  3ICA A;  3M4Q A;  4CC2 A;  1OQK A;  2KVQ G;  4JS5 A;  1VQ7 T;  1KD1 U;  1FYF A;  2RM4 A;  5LJ5 f;  3ASK A;  8ATC B;  2ZXF A;  2JJ9 A;  2XHC A;  4O2D A;  2JXB A;  3TCJ A;  1YIT Q;  3QTC A;  1AWX A;  2VKN A;  4KR2 A;  2XK0 A;  3CC7 T;  2QQA A;  3PNW C;  2Q7G A;  1EIF A;  4WJ4 A;  2JS2 A;  3EFS A;  4ORZ A;  1KC8 C;  5LJ3 d;  2KT1 A;  4H2T A;  4J9E A;  3MJX A;  2DTH A;  2RK1 A;  4ZN1 A;  12AS A;  2EKH A;  4PLI A;  4OMQ A;  1SPK A;  1AT1 B;  1K8A U;  3PCO B;  4Z89 A;  3CCJ A;  1BYM A;  3G4S A;  4QT7 A;  3OMG A;  3L2Q A;  1YGB A;  2BZY A;  4TVA A;  1W70 A;  1OZ3 A;  2LT4 A;  4YTL A;  1JXM A;  2A08 A;  2HQE A;  4KUI A;  1I4K 1;  2DER A;  3WVD B;  1JEG A;  2C06 A;  2V1R A;  1VA7 A;  1YHQ A;  2FL7 A;  1J5W A;  2V8K A;  1WIE A;  3GPL A;  1K8A R;  3E9I A;  4M77 E;  1EOV A;  2X3X D;  4WCI A;  3VQY A;  3NTK A;  4XU0 A;  5GAO n;  3MCA B;  4TQF A;  3TQ7 P;  1H3H A;  2ODR C; 
#chains in the Genus database with same CATH homology
 5CQY A;  2Q5I A;  1VQ4 A;  1M90 U;  2RHX A;  4YCU A;  3RMS A;  2ZPB B;  3GNG A;  3JB9 I;  5D6Y A;  3PCO A;  3G6E T;  4KUD K;  5CQX A;  2A8E A;  3HXU A;  2RI3 A;  5HY6 A;  1G3Y A;  1C0A A;  1K73 U;  3I55 A;  3CCE A;  3V7S A;  1NJ8 A;  3RKY A;  3X28 B;  4JRI A;  3CPW S;  3L2R A;  4ATO A;  1VQK T;  3MEW A;  1E22 A;  5GMK j;  2CZ6 B;  3FJP A;  4HCZ A;  3MF2 A;  2QEX T;  2LTO A;  4XU3 A;  4RMF A;  3W3S A;  4PJO E;  4F7U E;  1VQO A;  1YBY A;  5I2M A;  1YJW T;  1VIE A;  5HKC A;  3CMA T;  1VQL A;  3A8G B;  4C92 B;  3L42 A;  3A5Z B;  4O6J A;  3REX A;  2O4X B;  3INZ A;  1NJ1 A;  2K5F A;  2J3M A;  3OYN A;  1ADJ A;  3P8Y A;  3S3M A;  4LNS A;  4XU2 A;  5I21 A;  5GAM h;  3V8K A;  4YRP A;  1AHJ B;  5GMK e;  4G84 A;  3TEG A;  2HQX A;  4RCC A;  3HXX A;  1B76 A;  4M77 A;  4P74 C;  1EIY A;  4VUB A;  3M58 A;  4M7D B;  4CH3 A;  4PNO A;  5LJ5 j;  3A7R A;  4HA8 A;  3V8J A;  2DTI A;  4E7K A;  3I56 A;  2WSF E;  2VXE A;  3TUP A;  1MGQ A;  2QQB A;  2ZPG B;  3DLM A;  2I4M A;  3RGL A;  1UEB A;  2M1H A;  3E19 A;  1SRY A;  4C92 C;  4YRK A;  4PKC C;  2EJF A;  4C0G A;  2GFU A;  2XGT A;  4ZTF A;  2QHU A;  4C92 G;  2X4J A;  3HFZ A;  1YJN T;  2EAY A;  1S72 T;  2FHD A;  3P8V A;  4YRI A;  4C8Q D;  2IVW A;  3X26 B;  3UGQ A;  3MEU A;  4RG8 A;  3P8D A;  4P71 C;  4EMK A;  4C8Q G;  4EMG A;  4CS2 A;  5A0L A;  2F5T X;  4OP0 A;  1Q81 U;  2K3Y A;  2EJ9 A;  3VV0 A;  3JCM g;  4LVM A;  2PQW A;  1U1S A;  5CKH A;  4Z02 A;  3JCM J;  2J3L A;  1B8A A;  4UP8 A;  4JJN K;  4P75 C;  3HFZ B;  3PZC A;  3LWH A;  4H2U A;  3OW2 S;  2M0O A;  1VQ6 A;  4QW2 A;  3HY0 A;  2MAM A;  2P4T A;  3H8Z A;  5CKF A;  3FLG A;  2Y90 A;  2O4X A;  1BBU A;  2LQK A;  3CCV T;  3JCM Q;  4NS5 A;  2YRV A;  2C7I A;  4P3N A;  4MZP A;  3SB2 A;  5FRM A;  1O9S A;  3HP9 A;  1PYS A;  3CC4 A;  4M78 E;  2R5A A;  4CI0 C;  3PFS A;  1NJ5 A;  5GAN 7;  4M75 A;  4NL3 A;  3WQZ A;  2K57 A;  4PJO A;  2QQR A;  3A31 A;  3C4S A;  4Q5W A;  1VQM A;  1WU7 A;  2LC4 A;  4M75 D;  5LJ5 g;  2QQS A;  5HK3 A;  4M7A C;  4C5H A;  2P5I A;  2VV5 A;  2RHS A;  4K86 A;  4FL6 A;  2EJG A;  1H4S A;  2OTL A;  3OYI A;  1N6A A;  4XTU A;  4ZIB A;  4C92 E;  1B34 A;  3C94 A;  4GY5 A;  3G71 A;  4JS4 A;  3VYG A;  1XOV A;  4H2S A;  2EQM A;  5GAM j;  2ZCE A;  3CCV A;  2YHT A;  2EL9 A;  3SDZ A;  4F7U B;  4C0F A;  3S3O A;  3OMC A;  2ZNI A;  2OAU A;  3OSV A;  3HL8 A;  1VQ6 T;  3LW5 E;  3L2V A;  4BY6 B;  1XNI A;  5DLO A;  2EWN A;  5A0G A;  3OYH A;  1D3B B;  3O8V A;  1YIT A;  1TH7 A;  3LSS A;  4JRK A;  1KQS S;  3BY7 A;  3QII A;  4BW9 A;  2RHS B;  4YCW A;  3DSQ A;  3L2W A;  4OB0 B;  3IAL A;  4ZGJ B;  3VU3 C;  3JCM V;  3FDR A;  4YRL A;  1KQS A;  1VQ8 T;  2E5Q A;  2QQ9 A;  1G5V A;  4ME7 A;  5GAM e;  4PG3 A;  5LJ3 h;  1YI2 T;  2EQJ A;  3RF1 A;  2K5L A;  2KDS A;  3C12 A;  4QQ6 A;  4M75 E;  4YRQ A;  1M1K U;  1QE0 A;  1QP2 A;  3LWI A;  1W2B A;  4TTV A;  2Y4Y A;  4P3O A;  4X5O A;  1QF6 A;  5GAN g;  3E1S A;  2JVV A;  2D0Q B;  1BIA A;  4RDX A;  3OYF A;  1RIQ A;  2XDB A;  2ZT8 A;  1Y96 B;  3VUB A;  2EYQ A;  2EFI A;  2X4W A;  4TVA B;  1ASY A;  3CME T;  1EFW A;  5EG2 A;  1G51 A;  2WSC E;  2ZGW A;  4OVA A;  3GNF B;  3M4Y A;  2XDD A;  1EVL A;  1SER A;  2MI6 A;  1WNL A;  2K5I A;  4M7D C;  3SWN A;  4AH6 A;  1NJI U;  3HFV A;  4E7I A;  1IZ6 A;  2RH2 A;  2PME A;  4H02 A;  1M9S A;  5KH6 A;  4JUV A;  4OB3 B;  4XQ3 A;  3X20 B;  1ATI A;  3CCL A;  3N5B B;  4OGE A;  3MET A;  5GAN 3;  4YRT A;  5CIU A;  4A4G A;  3FIF A;  4YDQ A;  5ELO A;  4XEO A;  4YRR A;  1K9M U;  1QP3 A;  4LD9 K;  1W4S A;  2RI5 A;  2HBP A;  4OB2 B;  4JRP A;  3CC2 T;  4TWA A;  2E6N A;  4BDZ A;  1ZQ1 A;  2Q7E A;  2K3X A;  3CBP A;  3HRT A;  3UFG A;  3JB9 F;  1WJR A;  3I55 T;  1HXD A;  2QHV A;  1B7Y B;  5KCH A;  3BW1 A;  3M53 A;  4M7A A;  3VUZ A;  1VQN T;  3RL6 A;  4HT8 A;  3JB9 D;  3OA6 A;  3CCU A;  1G5I A;  4YRF A;  2HAX A;  3HXZ A;  1H4T A;  4MMK A;  2DDZ A;  3HFN A;  3UT1 A;  4C8Q C;  3REU A;  3UWN A;  2IY5 B;  2OTJ T;  5LJ3 j;  2YLB A;  5FRO A;  2BIV A;  3G71 T;  4P5N A;  3HKS A;  2L8D A;  2CYZ B;  4M78 F;  2DXT A;  2RHI A;  1YFR A;  2ZNJ A;  4H2V A;  2K4Y A;  1WQ7 A;  1ZHI A;  5LJ3 e;  1S72 A;  2DKG A;  2I4O A;  3CMQ A;  2XU8 A;  3J80 E;  3F70 A;  5K1P A;  4ZTJ A;  2ZTG A;  4M78 G;  3OS2 A;  2V8J A;  3CCU T;  4E7J A;  4N4H A;  5HGQ A;  2MWP A;  1USY A;  3M57 A;  4CRI A;  3MF1 A;  2CZ1 B;  2AHJ B;  3CCR A;  4LVJ A;  1NYQ A;  5FU6 B;  4L59 A;  3M59 A;  1PSE A;  4TVY A;  5ELN A;  4OLF A;  5KE2 A;  2JNG A;  2A7Y A;  3T9N A;  4BD3 A;  4O5V A;  3OYA A;  5GAN 6;  3JCM d;  4BWA A;  3X24 B;  4BI4 A;  4H2W A;  1VQZ A;  1SSF A;  5CAI A;  3JCM P;  2VYT A;  1M1K C;  2RI2 A;  3OYE A;  1Z7M A;  1YIJ T;  1VIF A;  2ZZG A;  1VQO T;  3JAM E;  2QEX A;  3JCM f;  4E47 A;  3QUI A;  5GAN 8;  4KUL A;  4C8Q E;  2Q7H A;  1G3S A;  2P0Q A;  2OTJ A;  1X54 A;  4LDW A;  1VQ9 A;  1K73 C;  2DZC A;  4RMO A;  1Q82 C;  5CO7 A;  5J3B A;  4V2S A;  4NL2 A;  4C0D B;  3KBG A;  3HHT B;  4P72 C;  3A5Y A;  3DKM A;  4KT0 E;  2ZZE A;  5FU7 C;  4J6W A;  3OYB A;  5FU6 C;  4J7F A;  4A4F A;  4E51 A;  3LX7 A;  2XTI A;  4YRO A;  2VGN A;  4XTZ A;  1X6O A;  3NEM A;  3KFU A;  1X56 A;  4IUQ A;  3CD6 T;  2DJZ A;  4M7A F;  3DB4 A;  2X35 A;  2KAF A;  4M75 F;  5CVI A;  4TQD A;  2XI9 A;  2ZT7 A;  1JRI A;  4WJ3 M;  4P73 A;  4HCC A;  1QVF A;  5CK9 A;  4DQ2 A;  2LNV A;  5LJ3 g;  1VQM T;  2BUD A;  5GAN h;  2PU9 B;  4HT4 A;  3J81 E;  2CS7 A;  4F7U A;  2QHT A;  2E64 A;  1KD1 C;  1ADY A;  3EAE A;  1NZ9 A;  3OY9 A;  1YJ9 T;  1KOG A;  4FU6 A;  3P8B B;  3QYH B;  4HCB A;  3S3N A;  2GQV A;  4QQG A;  2PUO B;  4JLI A;  3JCM c;  3JCM X;  4LDY A;  3MQZ A;  4HWO A;  2JOY A;  4M77 B;  1VQ7 A;  1H4V B;  3M9Q A;  3JB9 H;  2OTL T;  4TVW A;  4PJO G;  3MP6 A;  1UGS B;  1W66 A;  1JJC A;  2E5A A;  2PVO B;  4K87 A;  4MML A;  3JB9 G;  3NTI A;  1NJI C;  3QJ6 A;  5GAN 4;  1SES A;  1I5L A;  2E65 A;  5LJ3 f;  4JLG A;  2B8A A;  1O75 A;  4CH5 A;  2RD1 A;  1BI0 A;  3GIB A;  1YFT A;  4CS3 A;  1VQL T;  2XG8 D;  3E9F A;  4LDU A;  4C0D C;  1UGP B;  2DIG A;  2AKW A;  4PLL A;  2EQK A;  3CD6 A;  1K8A C;  3ER0 A;  3QO7 A;  2D6F A;  2DXB A;  4QVC A;  4UP7 A;  3ERR A;  3QG1 A;  2X4X A;  4BAC A;  2C8M A;  4B9W A;  5GAM d;  1BI2 A;  3OYJ A;  4EMK C;  1JJC B;  4H2X B;  3H6Z A;  1U8R A;  5C0M A;  4B9X A;  1YIT T;  3R6O A;  2DTO A;  2R57 A;  4PJO B;  3CCM T;  1VQ5 A;  1FXX A;  3OS5 A;  4HT9 A;  2CJA A;  3RKW A;  5CR2 A;  4JDS A;  2CGH A;  2RB6 A;  3BFM A;  2CIM A;  3MEV A;  4EO4 A;  4IUR A;  1JB0 E;  1XQH A;  2DPP B;  3A74 A;  3HTZ A;  3TEE A;  1LOJ A;  2M16 A;  2DIQ A;  3OD1 A;  3A8M B;  4C0Z A;  4KQE A;  4FSX A;  3NET A;  3CCL T;  4M7A G;  2CKK A;  1NJ2 A;  1G3T A;  3CCM A;  1VQ5 T;  3PMI A;  3A8O B;  1OI1 A;  3MHX A;  4YRS A;  1KHC A;  2E10 A;  2EQU A;  2ZIN A;  5J26 A;  3HPW A;  4M7D G;  3OQ5 A;  4LVI A;  3IG2 A;  3RES A;  1WJS A;  4XU1 A;  3VJP A;  2KQW A;  1WGS A;  1M5Q 1;  1HC7 A;  5CCA A;  3GP8 A;  4BE1 A;  2LX9 A;  3CME A;  2DK3 A;  1M1G A;  4II1 A;  1Q86 C;  2G4C A;  3LH0 A;  3CCR T;  3OYC A;  2M9U A;  3TRE A;  2E6Z A;  3CCQ A;  4MZM A;  1X75 C;  2ARS A;  4IKF A;  1YB3 A;  3IKL A;  4DPG A;  3OBW A;  5GAN j;  2DVE A;  5C52 B;  3DLL A;  1H64 1;  3L1A A;  2AMC A;  5D6W A;  1I8F A;  2RJE A;  3RUX A;  3OYL A;  2ZIO A;  4M78 A;  4E7L A;  4C8Q B;  2E70 A;  3L2Z A;  4M78 D;  2FVU A;  2CZ0 B;  4XTV A;  2DD5 A;  4LDX A;  4C5E A;  1IL2 A;  2QXF A;  4UC4 A;  4YRJ A;  4EPC A;  3OS0 A;  5LJ5 h;  3CCJ T;  1W2B S;  3JCM W;  4A4H A;  5GMK l;  3HXW A;  2H3J A;  5DY9 A;  4P3P A;  3RIR A;  4XTX A;  1VQN A;  3A5Z A;  3UDC A;  2AKW B;  3QXE B;  1G3W A;  2DO3 A;  2DXC A;  2KSS A;  2G3R A;  4WI1 A;  1UB4 A;  1UGR B;  2MWO A;  3CBO A;  3G1Z A;  4Q15 A;  1BI1 A;  1NPR A;  1BI3 A;  4D6W A;  1EQR A;  1VQ8 A;  5KNN A;  4HWR A;  4BB7 A;  4BE2 A;  2E3C A;  3J7A F;  2DQ0 A;  2GFA A;  1MHN A;  1D3B A;  1N8R U;  3FEO A;  2DXU A;  2ALY A;  3VYH B;  2Q5H A;  1B70 B;  4H2Y A;  5GAO l;  2ODR D;  2RHY A;  1Y7X A;  4XK8 E;  3V7C A;  4YRM A;  4NCX A;  2MF2 A;  2RJF A;  4QVD A;  3S6W A;  3GF5 A;  2ZCF B;  3KXT A;  1G5H A;  4EDU A;  1BBW A;  5C6S A;  2ZT5 A;  3MP8 A;  3MEA A;  2EIF A;  1NPP A;  2DZ9 A;  1YFS A;  3L4G B;  1X55 A;  1KMM A;  1KMN A;  2ZR3 A;  3MO8 A;  4K88 A;  2FYK A;  4BY6 C;  4OGC A;  5GAN e;  3TEH A;  1N27 A;  4YRN A;  5GAN 2;  4IUV A;  3HRU A;  1IRE B;  1VQP T;  2AMC B;  2HD0 A;  3HSB A;  3JCM h;  3PTA A;  4M75 B;  1X2H A;  2RHU A;  5GAN 5;  2I4L A;  3PIO A;  4BE0 A;  5GMK i;  2LQ8 A;  1DJ7 B;  4L5G A;  4YRG A;  2XD0 A;  3GOX A;  4ZTZ B;  4RCB A;  1OYX A;  2LDM A;  3SWN C;  3JSC A;  2L5Q A;  3VBB A;  3PGG A;  3FB9 A;  3QZ9 B;  4RQF A;  2RHQ B;  5KCO A;  5GAM g;  4HWS A;  4PJO D;  3P8H A;  2X4Y A;  3QDR B;  5GAN f;  4N4I A;  1NNH A;  3M5A A;  3QYG B;  3A7U A;  3OB9 A;  5FLX E;  2VUB A;  2R58 A;  1B7Y A;  3UPU A;  2Y4X A;  3CC7 A;  3OYM A;  2NS6 A;  3PMT A;  4R55 A;  5A2Q E;  4KBM B;  4J7I A;  4N4G A;  1YI2 A;  3LGF A;  3E9G A;  3IKM B;  1N9W A;  3BDU A;  1WJQ A;  2F69 A;  4A53 A;  2DU7 A;  3OYY A;  1ASZ A;  1WQW A;  3SD4 A;  2QTX A;  1N8R C;  1BIB A;  2ALY B;  1Z7N A;  4CH6 A;  2CJ9 A;  2ZT6 A;  5C53 B;  3LLR A;  2JUF A;  1WPY A;  4J15 A;  1VQP A;  2XKO C;  4M7A B;  5GAN d;  4N0A C;  4HVC A;  1FWZ A;  3QBY A;  4BUG A;  3QHS A;  2LCC A;  2GF7 A;  3X25 B;  1NJ6 A;  4M77 D;  3ZEH A;  4A4K A;  4ELZ C;  1SET A;  1KG1 A;  3CC2 A;  2IG0 A;  1X01 A;  3ME9 A;  4JRQ A;  4L6V 5;  4LDV A;  1Q7Y C;  4A4E A;  2PMF A;  3G7Z A;  4XEM A;  3UGT A;  4BDY A;  3VQV A;  5K1X A;  3M4P A;  4A54 A;  3QO3 A;  1JBM A;  2LT1 A;  1VUB A;  3C95 A;  3A8H B;  5HK0 A;  2VXF A;  11AS A;  2DQ3 A;  1Y71 A;  5IN1 A;  3JCM e;  2QA4 A;  2LRQ A;  3E9H A;  2PVD B;  5GAM f;  2WAC A;  1H4Q A;  1V29 B;  4M78 B;  2JTM A;  3CEY A;  1X2G A;  2JTF A;  3CCS A;  4M77 C;  4P74 A;  2ZPI B;  2KMT A;  3LYI A;  4Y91 A;  3OYG A;  1LYL A;  1E1T A;  1LJO A;  5GAO m;  1EIY B;  3CXC A;  2P0L A;  2ZPE B;  3VKI A;  2LVM A;  3EFR A;  4J6Y A;  1JJ2 S;  3ZBD A;  2GCX A;  4H2X A;  2DEQ A;  2E1H A;  4G85 A;  1LNX A;  3HXY A;  3CPW A;  2RO0 A;  3A7A A;  4C92 A;  5DLQ E;  4M77 G;  2JZ2 A;  3OBY A;  2IY5 A;  4P75 A;  1QVP A;  4YRC A;  4BI3 A;  1M1F A;  5GAO p;  3JRZ A;  5GAO r;  4C5G A;  1L0W A;  3NEN A;  1B34 B;  3FRN A;  5FRN A;  2KK4 A;  4P71 A;  3HRS A;  3OYK A;  4J8O A;  4C8Q F;  2JN0 A;  1UGQ B;  2L89 A;  2XIC A;  3G4S T;  5AYF A;  4C92 F;  1HTT A;  4EX5 A;  1M8V A;  4FIB A;  4RKU E;  4FM4 B;  4XAX B;  1FX7 A;  4R56 A;  2CJB A;  3CCQ T;  2NLU A;  4M75 C;  1Y07 A;  5IT9 E;  3CC4 T;  2E12 A;  3A32 A;  2EKO A;  5GMK h;  3MEY A;  2V8I A;  4MDW A;  4X9D A;  2VC8 A;  4ZGD B;  3LC0 A;  1ZBX A;  1RI0 A;  5DM7 R;  3V8L A;  5CKB A;  2ART A;  1KC8 U;  4IUP A;  3WVE B;  2P0P A;  3G6E A;  4P73 C;  5GAO q;  4X34 A;  4PJO C;  4N0A A;  5LJ5 d;  4OMF B;  1Q82 U;  5LL6 S;  2MMP A;  2RHZ A;  4FT4 A;  4J6X A;  1OZ2 A;  3OW2 A;  1Y96 A;  2D9T A;  3L4G A;  4HKE A;  4M75 G;  4RG2 A;  4OF1 A;  2XID A;  3VQX A;  3QPH A;  2PVG B;  2ZZD A;  3RMQ A;  1YJN A;  1PSF A;  3PIP A;  2RK2 A;  4XTW A;  3VQW A;  4HWT A;  5L8R E;  3QZ5 B;  1YCY A;  3M4G A;  1HK9 A;  5CKE A;  4WF2 A;  1QVG S;  3HXV A;  2I2L A;  3M55 A;  2K2V A;  1U1T A;  4DA4 A;  4X9C A;  4ELY C;  4KR3 A;  3ZFJ A;  2DD4 A;  3HRI A;  4Q6G A;  1VQ4 T;  4F7U G;  2QDY B;  2ZR2 A;  4YPF A;  3M54 A;  1E1O A;  3A8L B;  2L3R A;  4MZT A;  2RA2 A;  1KQ1 A;  3NTH A;  1XTD A;  1RL2 A;  4TVR A;  3QSU A;  4LD6 A;  2I4N A;  3SFM A;  2ZPH B;  1QW1 A;  4E7H A;  2QI2 A;  2R5M A;  1WLE A;  4UPA A;  4CH4 A;  3QO8 A;  3QNE A;  3R07 A;  4NOY A;  4YP0 A;  5I2S A;  1KHI A;  3KUF A;  3WXM B;  2LCL A;  2BKD N;  3L2U A;  4C92 D;  4CS4 A;  5A0D A;  3GLX A;  2E41 A;  1YJW A;  2VGM A;  4YYE A;  1NYR A;  4M78 C;  4EMK B;  3HFO A;  3OS1 A;  4PHC A;  1VQK A;  3UH0 A;  3CPF A;  4ZTU B;  4M7D A;  3MP1 A;  1NE8 A;  1P92 A;  4M77 F;  2DU5 A;  4M7D D;  4PL6 A;  1N9S A;  3QJY A;  1H3Z A;  2ARU A;  3LGL A;  1KQ2 A;  3Q1J A;  2RHQ A;  2ZIM A;  4M7A E;  3TU4 K;  4FT2 A;  5M9O A;  1Q7Y U;  1YJ9 A;  3NEL A;  3BJU A;  5IAY A;  3I7F A;  3M56 A;  1QVG A;  3PT9 A;  1I81 A;  3HY1 A;  1GGM A;  5GMK m;  4ZN3 A;  3JCM b;  2KY9 A;  3RAC A;  3CMA A;  4IUT A;  5J39 A;  3QO5 A;  5KE3 A;  1EVK A;  3AHU A;  4LVK A;  1YHQ T;  1R8O B;  1N9R A;  4C8Q A;  5E3I A;  3CCS T;  2QHS A;  5C51 B;  4IUU A;  3QKJ A;  4RQE A;  4LVL A;  2ZPF B;  2ZZF A;  2O01 E;  3SWN B;  3DB3 A;  1PYS B;  4BI8 B;  4L87 A;  3CCE T;  5CKD A;  1K9M C;  3TEH B;  4Y28 E;  3OSS C;  2WSE E;  4UP9 A;  1M90 C;  3URG A;  1JJ2 A;  5FU7 B;  3HRK A;  2HNI A;  3I56 T;  3NFC A;  4ZGE B;  4PJO F;  4GLK A;  1WYD A;  4YRE A;  1Q86 U;  1GXI E;  4QVZ A;  4DOV A;  3CBM A;  2F5K A;  3LSQ A;  1E24 A;  2YLC A;  4M7D F;  4C5I A;  1VQ9 T;  2CZ7 B;  2RJD A;  2DAQ A;  3BDL A;  4J83 A;  3CXC S;  4EMH A;  4M7D E;  4OB1 B;  4DOW A;  3V7R A;  5F5W A;  5D6X A;  2XDP A;  1B70 A;  1M4Z A;  1Q81 C;  5LJ5 e;  3JB9 J;  1BKB A;  3OYD A;  1YIJ A;  3P8T A;  2QA4 T;  1QVF S;  4HWP A;  4J5Y A;  2A3L A;  4MDX A;  4P72 A;  4M7A D;  3RKX A;  1USY C;  4YCV A;  4XTY A;  3RER A;  3FC3 A;  2PUK B;  2RJC A;  2P0K A;  4F7U F;  2FB7 A;  4QQD A;  3ICA A;  3M4Q A;  2KVQ G;  4JS5 A;  1VQ7 T;  1KD1 U;  1FYF A;  2RM4 A;  5LJ5 f;  3ASK A;  2ZXF A;  2XHC A;  4O2D A;  3TCJ A;  3QTC A;  4KR2 A;  2XK0 A;  3CC7 T;  2QQA A;  3PNW C;  2Q7G A;  1EIF A;  4WJ4 A;  3EFS A;  1KC8 C;  5LJ3 d;  4H2T A;  2DTH A;  2RK1 A;  4ZN1 A;  12AS A;  4PLI A;  1K8A U;  3PCO B;  3CCJ A;  1BYM A;  3G4S A;  3OMG A;  3L2Q A;  1YGB A;  4TVA A;  1OZ3 A;  2LT4 A;  4YTL A;  2HQE A;  4KUI A;  1I4K 1;  3WVD B;  2C06 A;  1YHQ A;  2FL7 A;  1J5W A;  2V8K A;  3GPL A;  3E9I A;  4M77 E;  1EOV A;  3VQY A;  3NTK A;  4XU0 A;  5GAO n;  3MCA B;  4TQF A;  2ODR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...