4XU2A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 87 with a 3'deoxy ribose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
264
structure length
262
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 90
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu2A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu2A01
3BJUA 4CH5A 4TQDA 3CMQA 1YB3A 3JCMW 3UGTA 4H2XB 4M77A 4M78F 2ZZFA 4TVAA 4V2SA 3JB9J 3LC0A 5ELOA 2QTXA 4YP0A 4P74C 4UP8A 1BBWA 4M78D 4YREA 2RHSB 2J3MA 3IKMB 1WYDA 1SERA 2ZXFA 3ERRA 1FYFA 3R07A 4KR3A 4C8QC 3M4PA 2AKWB 2QHVA 1NJ8A 3LSSA 1KMNA 2ZR3A 3IKLA 4DPGA 4K88A 4O2DA 4RDXA 3RF1A 2ZIOA 2DTIA 1E1OA 2EJFA 3A7RA 5GAMj 4YRQA 4YRIA 3QNEA 3A32A 3VQYA 2ALYA 1I81A 4E51A 4YRKA 1BBUA 4Q6GA 4M78E 2IY5A 1KQ2A 2Q5HA 12ASA 1ASYA 4M7DA 3V7SA 4UP9A 4XTVA 3QO7A 4EMHA 1EVLA 4JRKA 4M75F 3JB9G 4XU1A 4YCWA 4HT9A 2PMFA 4J6YA 4PNOA 5LJ3d 1EFWA 1YFSA 4H2SA 4CH3A 1D3BB 4YPFA 4M75D 3FJPA 5LJ3g 1B34B 1H4VB 2EJGA 1I8FA 2EJ9A 3QTCA 4H2XA 4G84A 4HWOA 4J6XA 4Y91A 2DJZA 5GANj 4NCXA 3M4GA 2CGHA 5LJ5j 4C8QB 4C92F 2XTIA 3QO3A 4AH6A 2EAYA 4C92D 2AKWA 1E1TA 4K87A 3UH0A 3HFVA 3EFRA 4M7AF 4EO4A 1U1SA 1TH7A 2DZCA 3HTZA 4YRMA 4M7AD 4M75E 2DZ9A 2E64A 4M77G 3INZA 5GAMd 1YGBA 5GAMe 3TUPA 5GAN7 1HXDA 3NETA 3G1ZA 5GAMg 4P71C 4HWPA 1EVKA 3MF1A 2I4NA 4RQFA 4H2WA 3V7RA 4NL3A 4P3PA 4PJOC 3PCOB 3JB9F 1D3BA 2CJ9A 4XEMA 1ASZA 2ODRD 1B34A 4M7AE 2Q7GA 4C92C 2C7IA 2DU7A 3SB2A 2ZNJA 4P74A 3RACA 3JB9D 3TEGA 3WQZA 2ALYB 4XEOA 2IY5B 2ARUA 2E10A 3HXZA 4C8QA 4EX5A 3LSQA 4EMGA 5GANd 1B7YB 4N0AA 4BWAA 2ZT8A 5GANe 3HFZB 1G5IA 3QO8A 4H02A 1EIYA 5LJ5e 4F7UA 1NJ2A 5GANg 2RA2A 4QVDA 1SETA 4CS4A 5LJ5g 2HNIA 1YCYA 3PGGA 4P72C 4HVCA 3KFUA 4MMKA 4K86A 2P0LA 3RKYA 2DKGA 2DDZA 2FB7A 3RUXA 1Y96A 2P5IA 1NJ1A 2E3CA 4M77F 3HSBA 2I4MA 5GMKm 2DXTA 2ZZGA 4H2TA 4H2UA 2VXFA 4P73C 4M77D 4PJOB 3P8TA 1NJ6A 3VQVA 3E9HA 3V8KA 4ZTZB 4PJOG 4YCVA 1L0WA 2QHSA 3PCOA 5GMKh 3UGQA 1IL2A 4A54A 5LJ3h 4JRIA 1N9SA 3JCMJ 3PZCA 1H4TA 1VQZA 3MF2A 5DY9A 4MMLA 3RKWA 1G51A 3SWNC 4YRPA 2RM4A 3JCMf 2CJBA 4XU0A 5GAOm 1B7YA 4LNSA 1N9RA 3HFZA 1YFTA 4M77E 1X55A 4XTUA 4M78C 4M7DF 3V8JA 1NYQA 5HGQA 2Y90A 1KQ1A 3MEYA 3JCMh 4M7DD 2ZT5A 3HXVA 4XTXA 1SESA 4J5YA 1USYC 4ZIBA 1BIBA 5GMKl 4ZTUB 4KR2A 3HFOA 1JRIA 4P71A 1M5Q1 2E65A 3A5YA 4C8QG 2DTHA 4HA8A 1J5WA 2EWNA 3JB9I 3JCMb 1WPYA 1EIYB 4PJOA 1I4K1 4F7UB 3RESA 1HK9A 1E22A 2ARTA 5CAIA 4F7UG 1E24A 3TEHB 4HWRA 4C92A 4OLFA 4TVYA 3P8VA 2I4LA 4PG3A 3GIBA 4M7DE 2DXUA 1QE0A 3JCMP 1Y96B 3SWNB 3HXWA 4BW9A 4M75C 4XU3A 5GAN4 4M78B 1Z7MA 4P75C 4YRCA 1SRYA 1B70A 4M78G 1MGQA 2G4CA 2ZNIA 1HC7A 1LJOA 4KQEA 2PMEA 4P72A 4RQEA 2RHQB 2DEQA 3HRIA 2E1HA 3HY1A 3IG2A 1WNLA 2E5AA 1X54A 4J15A 3REXA 1KOGA 1LNXA 1X01A 1YFRA 4UPAA 4M7AC 3E9IA 5E3IA 1W66A 4P73A 5F5WA 2QHTA 3A5ZA 5LJ5d 2CIMA 3VU3C 5GAN3 4H2VA 4C8QF 3L1AA 2ZT6A 3P8YA 3RERA 4H2YA 5C51B 11ASA 3TEHA 3RIRA 1PYSB 4TQFA 4C8QD 4F7UF 2ZINA 3M4QA 5GMKj 4M75B 3I7FA 3A7AA 2JN0A 4YRNA 5C52B 2I2LA 4HWTA 4CH4A 4TTVA 4M75G 5I21A 1EOVA 1GGMA 3SWNA 5LJ3j 4QVCA 4WI1A 2ODRC 3NEMA 4XTYA 2AMCB 4P3OA 4TWAA 1EQRA 4M78A 2ZZEA 1NNHA 1LOJA 5LJ3f 2RB6A 1ADJA 5GAN2 4C92B 3ICAA 2VC8A 2DQ0A 1USYA 4J6WA 4YRFA 2CJAA 4C92G 2RHQA 4C8QE 1NJ5A 4XU2A 3BW1A 2Q7HA 4NL2A 4CS2A 4OP0A 4M7AB 2YHTA 4CH6A 2YLCA 3BFMA 1WQWA 1B8AA 4M7AG 4F7UE 2DVEA 3EFSA 3FB9A 4EMKC 3AHUA 3JCMX 1Z7NA 4A53A 2I4OA 5KNNA 3QSUA 4YRLA 4RCBA 2K57A 4N0AC 4HT8A 1C0AA 3HXYA 1U1TA 1B70B 2E41A 3L2ZA 3HRKA 1WU7A 4YYEA 3NELA 3JB9H 3UFGA 1WLEA 5GAN5 4CS3A 3A74A 1B76A 1PYSA 3HXUA 4M77C 4UP7A 3RGLA 3HXXA 1JJCB 4RMFA 4M75A 5GAMf 1ADYA 5GAN8 4HWSA 2Q5IA 3IALA 2EL9A 4P3NA 5GAN6 3L4GB 5C53B 4P75A 1LYLA 5GMKe 3FIFA 2AMCA 4RCCA 4YCUA 5GAMh 2DTOA 5LJ3e 1X2GA 1QF6A 4YRGA 1ATIA 3A31A 3QO5A 4JUVA 4TVWA 2VXEA 1RIQA 3JCMV 4PJOF 2ARSA 3QHSA 3BDUA 2J3LA 4YRSA 4X9DA 3QUIA 4EMKB 4PJOD 2RHSA 4M7AA 3A7UA 2ZCEA 4WJ3M 4YRTA 4XTWA 2FYKA 5GAOp 3VBBA 5GAOl 3JCMd 4M7DC 3JCMe 1BIAA 5GANf 5K1XA 3VQWA 5LJ5f 2C8MA 3JCMg 1NYRA 1H4SA 3BY7A 1KMMA 2RD1A 4NOYA 5K1PA 2DU5A 4YRRA 4G85A 2ZT7A 2ZGWA 4XQ3A 4M77B 4XTZA 1X56A 4TVAB 5GANh 3VQXA 2YLBA 4X9CA 5GMKi 5LJ5h 2DQ3A 3W3SA 5GAOr 3V8LA 2Q7EA 4PHCA 5GAOn 4Q15A 1JJCA 2XGTA 3RKXA 3REUA 1H641 4PJOE 1JBMA 3NENA 3L4GA 3JCMc 5ELNA 4YDQA 4C92E 4DQ2A 5GAOq 1G5HA 1N9WA 3OD1A 2ZIMA 3DSQA 1M8VA 4L87A 3HY0A 4X5OA 3JCMQ 1WQ7A 3V7CA 2QHUA 1H4QA 4WF2A 4EMKA 4M7DB 1X2HA 3HFNA 4M7DG 2ZTGA 4YROA 3RL6A 4JLIA 4WJ4A 1I5LA 4YRJA 2ZR2A 1HTTA
chains in the Genus database with same CATH superfamily
4CH5A 1MNEA 1VQ5T 2VASA 3UGTA 4QVZA 4M78F 1VQNT 4TVAA 4V2SA 1F1BB 2EYZA 4ZGDB 3CCET 1NYFA 4UP8A 3QDRB 3OYFA 1VQOA 2J3MA 2X3WD 1WYDA 1YJWT 4KUIA 1PHTA 3R07A 1VQMA 3ERRA 2A8EA 2AKWB 4J9EA 3VV0A 1PG5B 1FWZA 1VIEA 2YUNA 3CEYA 1ACMB 1E1OA 1H8KA 1C1AA 3A7RA 2DE0X 1SHFA 2H8HA 4YRIA 2KRNA 2M9UA 3CCVQ 2JJ9A 3X28B 2NWMA 4M7DA 5ECAA 4D6WA 2CUDA 2DL3A 4RG2A 1EVLA 1QCNA 3EGUA 3JB9G 2E6NA 2FVUA 4BI3A 1EFWA 1PD0A 1YFSA 4CH3A 4YPFA 1YCSB 4M75D 3UATA 5LJ3g 1A0NB 3DB3A 2DNUA 1I8FA 1BYMA 4PFPA 3LYIA 2FPFA 4JJDA 1WFWA 4G84A 4HWOA 4J6XA 3LGFA 2BIVA 1YHQA 9ATCB 4KULA 2M0OA 1Q86R 3M54A 1M3AA 3LX7A 3CPWA 1YJNT 3HTRA 1E1TA 3CCLQ 2DL7A 1BKBA 4F14A 1Y57A 5KYNA 4M7AD 2LT1A 3CCQA 4CC3A 1NJIC 5A0DA 3VYGA 2E64A 8ATCB 3H8ZA 1XJWB 1UECA 2RMOA 4JRPA 4ZTJA 4AG2C 3EG9A 4IIMA 5GAMg 4C5IA 3OYLA 4P71C 1K9MR 1RADB 2OX7A 1EVKA 2GTJA 4J9CA 2D0QB 3GBQA 4NS5A 4PJOC 3CPWS 2K9GA 1D3BA 4XEMA 1V1CA 4PLLA 2ODRD 4PFOA 1S72T 4MDWA 4C92C 2K79A 2ZPBB 2PQWA 2VB6A 1RAGB 2ALYB 1WHGA 3QYHB 3C12A 4ME7A 2IY5B 4LDWA 1FYNA 3RDVA 4N0AA 1SPKA 1VQ4T 1CSKA 3HFZB 4F7UA 5CCAA 3M0PA 2J7IA 1G83A 1TWBA 3HRSA 3OW2A 4J8OA 1M1KU 1O9SA 2CZ7B 2O88A 3RKYA 3PFSA 2DDZA 2CZ6B 5KCOA 1NLOC 2WSCE 4O6JA 4QW2A 4BE1A 2DXTA 3G4ST 2LNVA 4H2UA 2KVQG 2VXFA 4M77D 4PJOB 1NJ6A 3VQVA 4ZTZB 4E7IA 1KD1U 3PCOA 4ELZC 1ZUUA 1GCPA 3UGQA 3DLMA 2JTMA 2RHIA 4B9WA 5CIUA 4DBQA 3CCMT 4OMOA 3OW2S 3JCMJ 3PZCA 1W2BP 5DY9A 5CKFA 5L8RE 3S3MA 1R0BG 1TXQA 4C5EA 1B7YA 3OYGA 3VS7A 1N9RA 5KYYA 1VQ7T 4Z88A 5HGQA 1YP5A 2B86A 3CPFA 3MP6A 2HD0A 5DLQE 3WVDB 2ZT5A 3HXVA 2QQAA 1WHJA 1KG1A 3MP8A 2FZCB 2G3RA 2X35A 1USYC 1BIBA 1SKUB 1X6BA 5CKDA 1JJ2P 3MP1A 2NUZA 1YIJQ 4KR2A 3JRZA 3OYKA 1K73C 2OAUA 1ZA2B 1ZBJA 1M5Q1 2OTLQ 2FHDA 1K9AA 3A5YA 2DTHA 1J5WA 2EWNA 1VQKT 3CBOA 3H0FA 3JCMb 1EIYB 1Q81C 1HJDA 1AWOA 3E2UA 1NPPA 3TEHB 2X4YA 2DPPB 4TVYA 2I4LA 1VQOT 4M7DE 2NUPA 2CZ0B 1VQMT 3OYDA 4E7HA 3HXWA 4M75C 1WJQA 1D09B 2GFAA 1RLQC 3ZFJA 4P75C 3VS1A 1I07A 3I56A 4XAXB 2A37A 5DM7R 4MDXA 2VGNA 4P72A 3CCJA 3CCUA 2MMPA 4QQ6A 2PVDB 3HRIA 2E1HA 5D6XA 3IG2A 2FEIA 1D1AA 5HCKA 3G6EQ 3REXA 2FG0A 1X01A 4M7AC 5I11A 2M0YA 3VUZA 1YI2Q 1RABB 3RNJA 3X20B 2CIMA 2CP2A 1JB0E 1WDXA 4C8QF 3L1AA 2ZT6A 3D7SB 2QASA 11ASA 3CMAT 2NUTB 2CSQA 3EFOB 2KRSA 1N8RU 2BE7D 5GMKj 4M75B 2AHJB 4CC7A 1KQSP 3A7AA 2JN0A 4ZN3A 4YRNA 4TTVA 2L3SA 1QVGS 4GBQA 2XI9A 1J3TA 3EG0A 1Y7XA 2ODRC 2LT4A 2OJ2A 4XTYA 1OX8A 3CC4Q 2RF0A 1QVFP 2QAZA 4HVVA 2VKNA 4M78A 2D0NA 1NNHA 2A0FB 4OMNA 2RB6A 1ADJA 2YDLA 2VC8A 3HHTB 1TUDA 3EH2A 1TSFA 4J6WA 4C92G 3EH1A 3KBGA 3CC7T 4NL2A 2K2MA 5I2MA 4M7AB 2YHTA 1SRLA 1B8AA 1UE9A 1UUEA 3GPLA 2KDSA 4F7UE 3FB9A 2I4OA 1X2QA 3JCMX 1Z7NA 4A53A 3KUFA 3P8DA 4YRLA 3EGDB 2L3PA 2K57A 4N0AC 4RCBA 4JRQA 2W0ZA 3HXYA 4LDVA 3QPHA 1B70B 3PIPA 2JUFA 3NELA 2YUOA 1RAEB 3JB9H 3UFGA 4ZGJB 4CS3A 3A74A 1PYSA 2R57A 2W10A 3HXUA 4M77C 1YITT 4RTUA 3I55T 4RMFA 3M55A 4P3NA 1Y0MA 5C53B 3HL8A 5GMKe 3CC2Q 5CKBA 5IXBA 4YCUA 1X2GA 1T3LA 2DTOA 3A31A 2CT4A 1MV3A 4JUVA 3M4YA 2VXEA 2X4XA 2C0TA 4LVLA 1NE8A 2QEXT 1M9SA 3EGXB 2ARSA 3BDUA 3CCLA 3KFVA 5CK9A 3LWHA 2OI3A 2FYKA 3VBBA 5GAOl 3JCMe 4C5HA 1MMNA 4E7KA 1AOJA 4LNPA 5J26A 5KH6A 1Q86U 1ZLMA 4NOYA 2DU5A 4XTZA 4M77B 1X56A 4QKUA 5GANh 2OTJQ 2YLBA 5LJ5h 3UT1A 2DRKA 3CD6T 2CREA 4PHCA 1JJCA 4WCIA 1H641 4OB3B 2P4TA 1VQ6T 3UPUA 3L4GA 1YBYA 4PL6A 3M59A 2QA4T 4MZPA 4YDQA 4DQ2A 3OBYA 1K4US 2DM1A 4UC4A 2CP5A 1M1KR 1KSWA 3OSSC 3S3NA 2LZ6B 3OYBA 4RTWA 3VRZA 3A8HB 1U3OA 4JS5A 1M90C 1XQHA 5KYXB 3JCMQ 4WF2A 4EMKA 2LCSA 4IUUA 1QWEA 4R0KA 3HFNA 4FSXA 4M7DG 4YROA 4AFQC 1G3TA 4KUDK 4KH0B 2K3XA 4K11A 4DEYA 3PIOA 1C6VX 1I5LA 1X75C 2A36A 1HTTA 1K0SA 1WHLA 4TQDA 1VUBA 1K1ZA 1UGRB 1YB3A 3DB4A 4OMPA 2F2WA 4H2XB 2VVKA 4LUEA 2RI2A 4FT2A 1PSEA 2VGMA 2QTXA 4YP0A 4P74C 1XOVA 5HKCA 2EKHA 3NMZC 4FW2A 1SERA 2YRCA 2ZXFA 4KR3A 3GLXA 3HRTA 2BZYA 1ZUKA 3LSSA 2ZR3A 4QQDA 3VKIA 3IKLA 4DPGA 3BDLA 4K88A 3JV3A 2DA9A 4ATOA 3RF1A 5GAMj 1OOTA 2PVGB 3DLLA 3CCRQ 1Q82C 1X27A 3A32A 2ALYA 3CXCP 4IURA 3ZBDA 1BBUA 1ZSZB 2FZKB 4Q6GA 4FYVB 4M78E 2IY5A 2MYSA 5IHKA 12ASA 3V7SA 3PNWC 5D6YA 4FYWB 3I5SA 4XU1A 4HT9A 4J6YA 3QG1A 3TSZA 1UGPB 1YIJA 3OYJA 4H2SA 1Z9QA 1ZBXA 1ZUYA 3EG3A 4OMLA 3FJPA 3CCSQ 1B34B 1H4VB 5LL6S 2EJ9A 4Q5WA 2OTLA 3QTCA 1AT1B 2CP6A 4OB1B 4A4EA 4NCXA 4PJJA 1NZ9A 4PLIA 4EDUA 4AH6A 3OYEA 3TU4K 4C92D 2ZPGB 1U1SA 4OMFB 2DZCA 3O5ZA 2CP3A 4Z8AA 1SHGA 1R77A 2LQ8A 2XIDA 3X24B 3M5AA 2DZ9A 5DLOA 2RQWA 4M77G 3INZA 3I56Q 1YGBA 1QCOA 2KR3A 3E19A 5GAMe 5GAN7 3TUPA 1HXDA 1WXUA 4FYXB 2QGFB 4LE9A 4B6MA 3CCVT 1KC8C 2I4NA 4BACA 1BI2A 2YUQA 1JJ2A 4P3PA 1BI1A 1GBQA 4LVMA 3G6EA 3JB9F 1N8RR 2CJ9A 3OYHA 5FROA 1YI2A 2KT8A 4Z89A 3EHQA 3BE3A 4XEOA 2E10A 1VQ8A 2M02A 3HXZA 1UEBA 4C8QA 2BE9B 4EMGA 5GANd 2ZT8A 4OF1A 3QO8A 1EIYA 4FT4A 3EAEA 4WTOB 1UHFA 1NJ2A 2AKLA 1YCYA 2PVOB 3MEWA 3PGGA 1JJ2S 2KBTA 2LJ3A 3CC4A 4KGXB 3KFUA 3OA6A 2P0LA 2ZPHB 1T3SA 5FWCA 4AFSC 2FB7A 3RUXA 1K8AU 1NLPC 2E3CA 2RK2A 2HSPA 4DA4A 1QQJA 2I4MA 1Y71A 5GMKm 2JM8A 2V8IA 1JU5C 4RUGA 1GFDA 3P8TA 3RBBB 2IIMA 4GLMA 4YCVA 1L0WA 3EG2A 1SSFA 5KCHA 3ZL7C 3PMIA 2D9TA 1IL2A 1HYOA 2X4JA 5LJ3h 4JRIA 2QGGA 1N9SA 1NPRA 4JZ3A 1H4TA 4CC2A 1GBRA 3H0IA 3MF2A 4MMLA 2AK5A 3RKWA 1G51A 3TSWA 4PJLA 1TUGB 5CKEA 3JCMf 1ABQA 5GAOm 2DVJA 1X55A 1RACB 4XTUA 1NYQA 4JLGA 1CKAA 1KQ1A 3MEYA 1NM7A 4LXCA 2JXBA 1KIKA 4J9BA 4DOWA 3GF5A 5CQYA 2O4XA 1OQKA 4M7DD 2RI5A 2MWOA 3A8OB 4XTXA 1SESA 4J5YA 1SEMA 2JOYA 3CC2A 1VQ9A 4ZIBA 4ZTUB 3G71T 1B7TA 5C6SA 2J6FA 1JRIA 3HFOA 4J83A 4ZN1A 3M0UA 4BY6C 3JB9I 2CT3A 1M3CA 3RESA 1HK9A 1E22A 1EZZB 4JZ4A 1E24A 2E3HA 4MZMA 3P8VA 4J7IA 2PUKB 2CS7A 3M9QA 4BW9A 5KYUB 3H9NA 2M51A 5CR2A 1VQ5Q 4XU3A 2LCCA 2KT1A 2OTJA 1E7OA 3EGDA 1KJWA 1UGVA 2DJQA 5AT1B 1VQNQ 1B70A 4M78G 1MGQA 2K7AA 1EFNA 1UDLA 1UG1A 2V8KA 1YJ9T 1HC7A 2A3LA 4BDYA 2PMEA 1AD5A 4FIBA 4RTVA 2YT6A 3TEEA 1YJWQ 1UJYA 2X9HA 2XDDA 1K0XA 4JJBA 3MPUB 5IT9E 3L2RA 5FRMA 1G2BA 2NYSA 1X54A 4J15A 4BY6B 2LQKA 1YFRA 2HQEA 3E9IA 1W66A 3OY9A 4P73A 2C0IA 1IB8A 1K76A 2K5LA 2HCKA 1YIJT 5D6WA 3A5ZA 1RAHB 4C0ZA 4OGEA 4FL6A 5GAN3 4H2VA 2PNIA 1OZ2A 3J80E 4BE0A 5C51B 5IN1A 4RTTA 3RIRA 2AT1B 4TQFA 3EGXA 5EC7A 3UA7A 6AT1B 1IZ6A 1RUWA 2F1LA 3I7FA 4IUVA 2I2LA 4CH4A 3S6WA 2VUBA 1EOVA 1R8OB 3SWNA 1CKBA 2AMCB 4TWAA 3LW5E 2BZXA 1YWPA 2PZ1A 2KAFA 2RJEA 3TREA 2L0AA 1G8XA 1VQPA 1LOJA 1RLPC 5LJ3f 2EGAA 1P92A 1UGQB 2MPXC 4C92B 4YRFA 2BUDA 2L8DA 2RHQA 1M27C 1YN8A 1OI1A 4C8QE 1NJ5A 3BW1A 4CH6A 2YLCA 1WQWA 2KXDA 1WGSA 4RKUE 3M0TA 3EFSA 1M2VB 1UTIA 4GLKA 3CCRA 3QSUA 4M4ZA 5KNNA 2HBWA 4HVWA 1RL2A 3G6ET 1C0AA 2E12A 1WU7A 3MEVA 3M0QA 3G1JA 2L89A 2ROTA 1B76A 2JZ2A 1ABOA 1GCQA 1M8MA 3RGLA 4J9HA 5GAMf 3SEMA 2DL4A 5C0MA 4HWSA 3IALA 3RMQA 3CCSA 3NFCA 4JJCA 3FIFA 5FLXE 2HDAA 1S72Q 1X2KA 1QF6A 1ATIA 2VWFA 3QO5A 1SG5A 4L6V5 3UA6A 1RIQA 2KQWA 4PJOF 1MHNA 2EPDA 2XHCA 5I22A 3FC3A 2LX7A 3QHSA 1VQ4Q 4X9DA 3QUIA 3A7UA 2ZCEA 4WJ3M 4XTWA 4F16A 5GAOp 4M7DC 2QDYB 2DIQA 2J6KA 2MAMA 1NJIU 1NYRA 4DBRA 3BY7A 3NHNA 5K1PA 3OS2A 2ZT7A 3M56A 4XQ3A 4TVAB 3OQ5A 1NBEB 4X9CA 1M4ZA 2KE9A 1MMAA 2Q7EA 4Q15A 5GAOn 1I1JA 1ZSZA 2XGTA 1MMDA 1WI7A 3OMGA 4FW1A 2SRCA 3NENA 1D0ZA 3OMCA 4JPBW 2OAWA 1OZ3A 3L2QA 1RAAB 2HKNA 2JW4A 4BD3A 1QKWA 4KH1B 2XD0A 2P4RA 1MV0B 5FWBA 1VOMA 1PKSA 2DETA 1VQ8Q 4LDYA 1K8AR 1Q95G 4N4HA 4L87A 3NTKA 2XK0A 2P0PA 2RH2A 3I35A 2QQRA 2LTOA 3HY0A 4X5OA 1YHQT 5GJVB 4C0DC 5J39A 3QWXX 2DILA 2GBQA 4M7DB 2YRDA 3L2UA 2ZPIB 1O75A 4BE2A 1RI9A 5L23A 2WSFE 2ZR2A 3QYGB 4CC4B 5FW9A 3CCQT 4Y28E 3JCMW 2JTFA 2O9SA 1JEGA 4LVJA 2QG9B 5FU7C 2DD4A 3UWNA 2EQKA 3JB9J 5ELOA 3NGPA 4ORZA 1VQKQ 1BBWA 4M78D 1G3WA 2L3RA 2XU8A 3L42A 2RHSB 1Q82R 4BDZA 1ZSGA 2EIFA 3M4PA 3QWYA 1NJ8A 2VYTA 3GP8A 1WJRA 4LDXA 4ZTFA 4O2DA 2DTIA 2EJFA 4X34A 1WJSA 1H3HA 3CPWP 4C0DB 1BI3A 4IUTA 2EYWA 1I81A 2XKOC 4E51A 1XTDA 4YRKA 3EG9B 1SSHA 3PTAA 2A08A 1ASYA 3QBYA 3MCAB 4UP9A 4XTVA 5KYWB 4F17A 3SD4A 3QO7A 2QYZA 4JRKA 4M75F 2EYYA 1SRMA 2YSQA 3QDFA 1VQ9Q 2JNGA 1WIEA 3MEUA 4DBFA 4BB7A 1D3BB 1K73U 3QKJA 5FU7B 2MWPA 2EJGA 2QK0A 4HCZA 4RMOA 3HRUA 4ZGEB 4Y91A 3ME9A 4C0FA 3LH5A 1Q81U 3X25B 3VUBA 4D8KA 2XTIA 3CMAQ 2MK5A 1WXTA 2RQUA 2Y4YA 2AKWA 2COZA 3HFVA 2DX1A 4M7AF 1PWTA 4EO4A 3ASKA 1TH7A 4KGVB 4N4GA 1E6HA 3HTZA 1IGQA 2QQ9A 4B9XA 1PD1A 2RJDA 1IXDA 1VQ5A 3HKSA 1G3SA 3OS0A 1GCQC 1VQNA 3GOXA 3CCEA 2JM9A 2DXCA 3NETA 2XG8D 4PK4A 1W4SA 4BUGA 1W6XA 2CP0A 2ZCFB 1YJWA 4IIOA 4HWPA 4RQFA 4H2WA 4NL3A 3MJXA 3R6OA 2ZPEB 1AWJA 4XK8E 4FYYB 3PCOB 2GNCA 3VYHB 2JMAA 1ASZA 5J3BA 1GL5A 2C7IA 2K5FA 2ZNJA 3RACA 3TEGA 7AT1B 1WZOA 1LVKA 3OS5A 1KFZA 3LSQA 1WXBA 1AVZC 2AZVA 2KK4A 3OBWA 1B7YB 3OS1A 1VQLQ 3O8VA 1DJ7B 5KYYB 1G5IA 2DD5A 1YWOA 4RTXA 2HQHA 3PE0A 2F2XA 5GANg 1T0JA 2MF2A 3JSCA 5LJ5g 4FCYA 3VS5A 4P72C 2VV5A 4OMMA 4HVCA 2KRMA 2DO3A 4K86A 2EFIA 2KSSA 2FRWA 1VQPQ 1NJ1A 1QCFA 1RAFB 4E7ZA 4CI0C 4FM4B 4GY5A 4M77F 1GRIA 2P0QA 4H2TA 4A4FA 4HT4A 2DL5A 3U23A 3I56T 1UFFA 3E9HA 3V8KA 1NEBA 4OVAA 2DIGA 1YJNA 5CO7A 3OYMA 3CCJT 3CCUT 2Y4XA 2QHSA 1IREB 2K4YA 1N27A 5GMKh 3GNFB 4HCBA 4A54A 4LDUA 2NUPB 5HK0A 3VS4A 2GQVA 4HXJA 4F04B 1YFNA 5FRNA 1VQZA 1FXXA 1PNJA 4LD6A 3ULRB 4AT1B 4YRPA 2RM4A 3CBPA 4XU0A 4YTLA 4LNSA 5A0LA 3HFZA 1VYTA 2O2OA 3P8HA 4M78C 3CD6Q 1G5VA 3MHXA 3JCMh 1I5OB 3UDCA 1VQ6Q 1OULA 1S72A 3I5RA 2QA4Q 1IRXA 2HEQA 4BI8B 2FO0A 1NJIR 1QP2A 4P71A 2LQNA 2E65A 2F5KA 4RTZA 1QVGP 4HA8A 4R56A 2A28A 2DMOA 2YXYA 1KHCA 1WPYA 4PJOA 1I4K1 1VQ4A 2LX9A 4F7UG 4LN2A 1OU9A 4FSSA 1W2BA 2RQTA 4HWRA 4C92A 4PG3A 3LWIA 3X26B 1QE0A 3CQTA 3OYCA 1Y96B 4IKFA 2NS6A 1Y07A 2V8JA 2AZSA 1E6GA 3QJ6A 2D8HA 1OV3A 2MOXA 3N5BB 5GAN4 4M78B 3G4SA 1Z7MA 3REAB 5IH2A 3A8GB 4TVRA 4YRCA 2DAQA 2ZNIA 1WHMA 3MO8A 3C4SA 1LPLA 3A8LB 2D1XA 1VIFA 2DEQA 1W2BS 3HY1A 3NTHA 1IO6A 1WNLA 3Q1JA 3CCMA 2PU9B 2ABLA 3QXEB 1KOGA 5E3IA 2F2VA 1W1FA 4D8DA 2ENMA 2LQWA 5LJ5d 1M90U 2ED1A 2XDBA 2P0KA 3P8YA 5D7UA 2J05A 3RERA 4H2YA 3L2VA 3TEHA 1PYSB 2HQXA 1JO8A 4C8QD 3CCLT 3H41A 2ZINA 2ZPFB 1M1FA 1PRLC 5C52B 3VS3A 1X69A 3J7AF 4HWTA 3L2WA 5I21A 3TQ7P 1M1KC 4L5GA 3NEMA 1EQRA 4QT7A 4PKCC 2K3BA 3QJYA 2DYBA 1VQKA 2JMCA 1EX4A 1FX7A 4A4GA 2YRVA 5GAN2 3ICAA 1W70A 5KE2A 1USYA 2CJAA 4XU2A 2Q7HA 8AT1B 1PM3A 4OP0A 5HK3A 1KD1C 3BFMA 1BCOA 1QMCA 1YNZA 2DVEA 1WHHA 2LJ0A 4EMKC 2GFUA 1WLPB 1LCKA 3OYIA 1KK7A 4J9FA 4OB0B 1Q82U 1K73R 1U1TA 2WACA 2E41A 1TTHB 3L2ZA 3LH0A 3CMEQ 3PMTA 1KQSA 1HD3A 2ED0A 1QP3A 1WLEA 2NUTA 3RMSA 3EFOA 1Q81R 1AZGB 3URGA 1QVFA 2CP7A 1JJCB 1QVPA 3H6ZA 2YUPA 4M75A 5GAN8 2J06A 1S1NA 2ECZA 5IXFA 1TS9A 5GAN6 3L4GB 1HSQA 2C06A 4P75A 2K3YA 3A98A 2M1HA 1IHVA 2RHZA 5GAMh 2WSEE 4YRGA 3FEOA 3VRYA 2LCLA 5EG2A 2CH4A 2KYMA 2ESWA 2GTOA 1KQSS 4II1A 3CMAA 1U5SA 3OSVA 3C0CA 1AZEA 1N6AA 5IHIA 2J3LA 2Z0WA 3MEAA 2IG0A 4EMKB 2RHSA 4M7AA 2ZZDA 2QQBA 1QVFS 4YRTA 1BCMA 2H3EB 3JCMd 2DL8A 3NPFA 1BIAA 5K1XA 2D8JA 1V29B 2C8MA 2FRYA 3A8MB 3CCEQ 2RD1A 1KMMA 1TOVA 4G85A 2ZGWA 3KXTA 1X6OA 1OPLA 3VQXA 4CRIA 5GMKi 3SHWA 1GFCA 2EQIA 1KC8U 3M0SA 3W3SA 2FPDA 3HP9A 5GAOr 1UB4A 4P5NA 4ZNXA 3RKXA 3CC7A 4LD9K 2JT4A 4PJOE 5IHNA 5KYWA 4PJNA 3JCMc 5ELNA 4C92E 4MZTA 5GAOq 1G5HA 3OB9A 2K2VA 3M57A 3OD1A 2OTLT 1QWFA 2ATCB 1AWXA 1V76A 2G6FX 1M8VA 1VQLA 2KMTA 3G7ZA 3V7CA 1YITA 3I55A 1N5ZA 4QQGA 1I0CA 1T0HA 2EKOA 2ZTGA 1N8RC 3RL6A 1PSFA 2O01E 1AHJB 1MUZA 4A4KA 4WJ4A 2O31A 3BJUA 4J7FA 3C94A 3CMQA 3G71Q 3M58A 4BI4A 1ZX6A 4M77A 3F70A 4DBHA 2ZZFA 3LC0A 1UGSB 4IUPA 2QEXA 4AMCA 1YJNQ 3M0RA 4Z02A 4YREA 4A63B 3S3OA 3IKMB 2LDMA 3QZ5B 1OX9A 5M9OA 1FYFA 2HAXA 1Q7YC 2LRQA 3WVEB 4C8QC 2QHVA 2O9VA 2RQRA 1KMNA 3ER0A 2L5QA 4RDXA 4O5VA 4ELYC 2ZIOA 1OEBA 3MQZA 1YI2T 2RJFA 4YRQA 3QNEA 2FL7A 2JVVA 1WHKA 2BZ8A 3VQYA 3OYAA 1VQ8T 5KYXA 3CD6A 2RNAA 1VA7A 1KQ2A 2Q5HA 3SDZA 1YJ9Q 1IGUA 1RI0A 4EMHA 1VQ6A 4YCWA 2PMFA 4PNOA 5LJ3d 2QA4A 3OYYA 5CKHA 1QLYA 1D1CA 3CC4T 1D0YA 1PRMC 2E4HA 2GGRA 4H2XA 3M53A 2MCNA 2DERA 5FU6C 2DJZA 5GANj 2V1RA 4OB2B 3M4GA 2F5TX 2CGHA 4C92F 4C8QB 5LJ5j 3VS2A 4R55A 1VYUA 3QO3A 4IUQA 2GF7A 2AIRB 2DBMA 2EAYA 5I2SA 2JTEA 4K87A 3UH0A 3EFRA 1R0CB 2L2PA 4KRTA 3CXCA 2KXCA 4N4IA 4J9IA 4RG8A 3J81E 4YRMA 4M75E 2QQSA 3EHRA 2CDTA 4E6RA 3G4SQ 2CH4W 1Q86C 5GAMd 1X6GA 4KGZB 2A7YA 1WA7A 3G1ZA 1M90R 2E5QA 3MF1A 2D6FA 3V7RA 2I0NA 3PT9A 3CCMQ 3VS0A 1BBZA 2COWA 2E3IA 3CC2T 1QW1A 1B34A 3DKMA 1VQ9T 3CXCS 4M7AE 1BB9A 4E7LA 5FU6B 2HBPA 3SB2A 1QVGA 2DU7A 2Q7GA 3JB9D 4P74A 3WQZA 4E7JA 2RK1A 1K9MC 2GCXA 2ARUA 4Y92A 1VQ7Q 4EX5A 2E5KA 4BWAA 1Z9ZA 5GANe 3C95A 4H02A 1EIFA 5LJ5e 2RA2A 4QVDA 1SETA 2LMJA 4CS4A 2HNIA 3FLGA 2X51A 2O4XB 4C5GA 2L3QA 4MMKA 2DKGA 2V1QA 1Y96A 2P5IA 2XICA 4HVUA 1ZA1B 3HSBA 2OTJT 2ZZGA 1BU1A 2LC4A 4J9DA 4EIKA 4C0GA 4P73C 2R58A 4JDSA 2CUBA 5IAYA 1UHCA 3VJPA 2XDPA 3LGLA 2KGTA 1OU8A 1VQOQ 4PJOG 2PUOB 2B8AA 4OGCA 2K6DA 4HCKA 4FU6A 1IHWA 1VQMQ 3R6NA 1Q7YU 2E70A 2CZ1B 3CMEA 2PTKA 2RHXA 2HMAA 2EQUA 4J9GA 3SWNC 3ZEHA 2CJBA 2MIOA 4OMQA 3CCVA 2RN8A 5KE3A 4M77E 1YFTA 4M7DF 3V8JA 2Y90A 2GQIA 4AFZC 1BI0A 1VQLT 4X1VA 2BKDN 3WXMB 4AG1C 3FRNA 2RHYA 1QKXA 3I9QA 5GMKl 2DXBA 5A2QE 4LVKA 3VS6A 2HZYA 3SFMA 4C8QG 3A5ZB 1VQPT 3CBMA 1C0MA 4F7UB 2RI3A 1M2OA 1WX6A 2CSIA 2EYQA 3P8BB 1FMWA 1NG2A 5CAIA 2KI7A 1YHQQ 1JXMA 1NYGA 2ARTA 1KC8R 4OLFA 2RO0A 3GIBA 2DXUA 3QIIA 3JCMP 2DRMA 4VUBA 3SWNB 2JS2A 3CCRT 4E2FB 3CCQQ 3OW2P 4E7SA 1ZQ1A 2DFUA 1M1GA 3GNGA 1SRYA 4JJNK 2YWWA 4ESRA 2KROA 2G4CA 1RAIB 2KNBB 3CC7Q 1LJOA 4KQEA 2EBPA 4RQEA 2RHQB 1WYXA 2NLUA 3E9GA 2X3XD 2E5AA 3PVQA 3CCST 2H3JA 1LNXA 2IVWA 4UPAA 2IPOB 1M30A 2X4WA 5F5WA 2QHTA 4JS4A 2DF6A 2RQVA 3VU3C 1K9MU 1B3QA 1M3BA 5AYFA 2CKKA 1JXOA 2RJCA 5A0GA 1YITQ 2DEUA 2DK3A 2F69A 3I55Q 1H3ZA 4A4HA 1NEGA 3PVLA 1GXIE 1AEYA 3EG1A 4F7UF 3M4QA 1ZHIA 1ARKA 1PKTA 1VYVA 2DYIA 4M75G 1GGMA 1ZSZC 4ANJA 4QVCA 5KYUA 5LJ3j 2QI2A 4WI1A 3G71A 2QXFA 4P3OA 3META 1KD1R 2V26A 1U06A 1K8AC 3UF4A 2ZZEA 3FJ5A 2QEXQ 2JS0A 4RTYA 2DQ0A 1JQQA 3TCJA 1MMGA 2P84A 3NTIA 4CS2A 1FMVA 2ZAEA 4EPCA 2HKQB 1D1BA 4M7AG 2C0OA 2FPEA 3AHUA 1TG0A 4LVIA 3LLRA 2RPNA 4HT8A 2AKKA 4LUDA 3HRKA 2HL5C 4YYEA 2COYA 1YJ9A 5GAN5 2DLPA 4KBMB 2KY9A 2M16A 4UP7A 1UJ0A 3HXXA 1ADYA 2EQJA 2Q5IA 2EL9A 2EYXA 1LYLA 2K5IA 2EGEA 2AMCA 2LVMA 4RCCA 4PFZA 1SF9A 5LJ3e 1OPKA 5HY6A 3THKA 3T9NA 4TVWA 3AT1B 3QZ9B 3JCMV 4E47A 3E1SA 3MKDA 2DBKA 5CVIA 1H92A 4YRSA 2CYZB 4PJOD 4DOVA 3FDRA 1D0XA 3E9FA 5CQXA 1M2VA 3RR6A 5GANf 3VQWA 1TUCA 3H0HA 5LJ5f 5GJWB 3JCMg 1H4SA 4HCCA 1BK2A 2EVRA 2MI6A 2LJ1A 3TVTA 2QTVA 1OYXA 4YRRA 2FZGB 2LNHB 4AFUC 4PJMA 2E6ZA 2KYBA 3CMET 2DQ3A 3A1PA 4DEXA 3V8LA 3REUA 1JBMA 3CCJQ 3CCUQ 1U8RA 2HSEB 1TU0B 2R5AA 2EGCA 2EQMA 3REBB 1KHIA 2SEMA 2J6OA 3JAME 1FMKA 4L59A 1X43A 1N9WA 2ROLA 4HKEA 2ZIMA 3DSQA 1VQ7A 2XMFA 3HPWA 3IQLA 4KT0E 2QDLA 3OYNA 2BTTA 1MNDA 2QHUA 1WQ7A 2LP5A 1H4QA 2HL3A 2RHUA 2R5MA 1PC0A 1PCXA 1B07A 2EW3A 1X2HA 1G3YA 1AWWA 4JLIA 1XNIA 4YRJA 2KEAA 1Q7YR
chains in the Genus database with same CATH topology
4CH5A 1VQ5T 3UGTA 4QVZA 4M78F 1VQNT 4TVAA 4V2SA 4ZGDB 3CCET 4UP8A 3QDRB 3OYFA 1VQOA 2J3MA 1WYDA 1YJWT 4KUIA 3R07A 1VQMA 3ERRA 2A8EA 2AKWB 3VV0A 1FWZA 1VIEA 3CEYA 1E1OA 3A7RA 4YRIA 2M9UA 3X28B 4M7DA 4D6WA 4RG2A 1EVLA 3JB9G 2E6NA 2FVUA 4BI3A 1EFWA 1YFSA 4CH3A 4YPFA 4M75D 5LJ3g 3DB3A 1I8FA 1BYMA 3LYIA 4G84A 4HWOA 4J6XA 3LGFA 2BIVA 1YHQA 4KULA 2M0OA 3M54A 3LX7A 3CPWA 1YJNT 1E1TA 1BKBA 4M7AD 2LT1A 3CCQA 1NJIC 5A0DA 3VYGA 2E64A 3H8ZA 4JRPA 4ZTJA 5GAMg 4C5IA 3OYLA 4P71C 1EVKA 2D0QB 4NS5A 4PJOC 3CPWS 1D3BA 4XEMA 4PLLA 2ODRD 1S72T 4MDWA 4C92C 2ZPBB 2PQWA 2ALYB 3QYHB 3C12A 4ME7A 2IY5B 4LDWA 4N0AA 1VQ4T 3HFZB 4F7UA 5CCAA 3HRSA 3OW2A 4J8OA 1M1KU 1O9SA 2CZ7B 3RKYA 3PFSA 2DDZA 2CZ6B 5KCOA 2WSCE 4O6JA 4QW2A 4BE1A 2DXTA 3G4ST 2LNVA 4H2UA 2KVQG 2VXFA 4M77D 4PJOB 1NJ6A 3VQVA 4ZTZB 4E7IA 1KD1U 3PCOA 4ELZC 3UGQA 3DLMA 2JTMA 2RHIA 4B9WA 5CIUA 3CCMT 3OW2S 3JCMJ 3PZCA 5DY9A 5CKFA 5L8RE 3S3MA 4C5EA 1B7YA 3OYGA 1N9RA 1VQ7T 5HGQA 3CPFA 3MP6A 2HD0A 5DLQE 3WVDB 2ZT5A 3HXVA 2QQAA 1KG1A 3MP8A 2X35A 2G3RA 1USYC 1BIBA 5CKDA 3MP1A 4KR2A 3JRZA 3OYKA 1K73C 2OAUA 1M5Q1 2FHDA 3A5YA 2DTHA 1J5WA 2EWNA 1VQKT 3CBOA 3JCMb 1EIYB 1Q81C 1NPPA 3TEHB 2X4YA 2DPPB 4TVYA 2I4LA 1VQOT 4M7DE 2CZ0B 1VQMT 3OYDA 4E7HA 3HXWA 4M75C 1WJQA 2GFAA 3ZFJA 4P75C 3I56A 4XAXB 5DM7R 4MDXA 2VGNA 4P72A 3CCJA 3CCUA 2MMPA 4QQ6A 2PVDB 3HRIA 2E1HA 5D6XA 3IG2A 3REXA 1X01A 4M7AC 3VUZA 3X20B 2CIMA 1JB0E 4C8QF 3L1AA 2ZT6A 11ASA 3CMAT 1N8RU 5GMKj 4M75B 2AHJB 3A7AA 2JN0A 4ZN3A 4YRNA 4TTVA 1QVGS 2XI9A 1Y7XA 2ODRC 2LT4A 4XTYA 4M78A 1NNHA 2RB6A 1ADJA 2VC8A 3HHTB 4J6WA 4C92G 3KBGA 3CC7T 4NL2A 5I2MA 4M7AB 2YHTA 1B8AA 3GPLA 2KDSA 4F7UE 3FB9A 2I4OA 1Z7NA 3JCMX 4A53A 3KUFA 3P8DA 4YRLA 4RCBA 2K57A 4N0AC 4JRQA 3HXYA 4LDVA 3QPHA 1B70B 3PIPA 2JUFA 3NELA 3JB9H 3UFGA 4ZGJB 4CS3A 3A74A 1PYSA 2R57A 3HXUA 4M77C 1YITT 3I55T 4RMFA 3M55A 4P3NA 5C53B 3HL8A 5GMKe 5CKBA 4YCUA 1X2GA 2DTOA 3A31A 4JUVA 3M4YA 2VXEA 2X4XA 4LVLA 1NE8A 2QEXT 1M9SA 2ARSA 3BDUA 3CCLA 5CK9A 3LWHA 2FYKA 3VBBA 5GAOl 3JCMe 4C5HA 4E7KA 5J26A 5KH6A 1Q86U 4NOYA 2DU5A 4XTZA 4M77B 1X56A 5GANh 2YLBA 5LJ5h 3UT1A 3CD6T 4PHCA 1JJCA 1H641 4OB3B 2P4TA 1VQ6T 3UPUA 3L4GA 1YBYA 4PL6A 3M59A 2QA4T 4MZPA 4YDQA 4DQ2A 3OBYA 4UC4A 3OSSC 3S3NA 3OYBA 3A8HB 4JS5A 1M90C 1XQHA 3JCMQ 4WF2A 4EMKA 4IUUA 3HFNA 4FSXA 4M7DG 4YROA 1G3TA 4KUDK 2K3XA 3PIOA 1I5LA 1X75C 1HTTA 4TQDA 1VUBA 1UGRB 1YB3A 3DB4A 4H2XB 2RI2A 4FT2A 1PSEA 2VGMA 2QTXA 4YP0A 4P74C 1XOVA 5HKCA 1SERA 2ZXFA 4KR3A 3GLXA 3HRTA 3LSSA 2ZR3A 4QQDA 3VKIA 3IKLA 4DPGA 3BDLA 4K88A 4ATOA 3RF1A 5GAMj 2PVGB 3DLLA 1Q82C 3A32A 2ALYA 4IURA 3ZBDA 1BBUA 4Q6GA 4M78E 2IY5A 12ASA 3V7SA 3PNWC 5D6YA 4XU1A 4HT9A 4J6YA 3QG1A 1UGPB 1YIJA 3OYJA 4H2SA 1ZBXA 3FJPA 1H4VB 1B34B 5LL6S 2EJ9A 4Q5WA 2OTLA 3QTCA 4OB1B 4A4EA 4NCXA 1NZ9A 4PLIA 4EDUA 4AH6A 3OYEA 3TU4K 4C92D 2ZPGB 1U1SA 2DZCA 4OMFB 2LQ8A 2XIDA 3X24B 3M5AA 2DZ9A 5DLOA 4M77G 3INZA 1YGBA 5GAMe 3E19A 5GAN7 3TUPA 1HXDA 3CCVT 1KC8C 2I4NA 4BACA 1BI2A 1JJ2A 4P3PA 1BI1A 4LVMA 3G6EA 3JB9F 2CJ9A 3OYHA 5FROA 1YI2A 4XEOA 2E10A 1VQ8A 3HXZA 1UEBA 4C8QA 4EMGA 5GANd 2ZT8A 4OF1A 3QO8A 1EIYA 4FT4A 3EAEA 1NJ2A 1YCYA 2PVOB 3MEWA 3PGGA 1JJ2S 3CC4A 3KFUA 3OA6A 2P0LA 2ZPHB 2FB7A 3RUXA 1K8AU 2E3CA 2RK2A 4DA4A 2I4MA 1Y71A 5GMKm 2V8IA 3P8TA 4YCVA 1L0WA 1SSFA 5KCHA 3PMIA 2D9TA 1IL2A 2X4JA 5LJ3h 4JRIA 1N9SA 1NPRA 1H4TA 3MF2A 4MMLA 3RKWA 1G51A 5CKEA 3JCMf 5GAOm 1X55A 4XTUA 1NYQA 4JLGA 1KQ1A 3MEYA 4DOWA 3GF5A 5CQYA 2O4XA 4M7DD 2RI5A 2MWOA 3A8OB 4XTXA 1SESA 4J5YA 2JOYA 3CC2A 1VQ9A 4ZIBA 4ZTUB 3G71T 5C6SA 3HFOA 1JRIA 4J83A 4ZN1A 4BY6C 3JB9I 3RESA 1HK9A 1E22A 1E24A 4MZMA 3P8VA 4J7IA 2PUKB 2CS7A 3M9QA 4BW9A 5CR2A 4XU3A 2LCCA 2OTJA 1B70A 4M78G 1MGQA 1YJ9T 2V8KA 1HC7A 2A3LA 4BDYA 2PMEA 4FIBA 3TEEA 2XDDA 5IT9E 3L2RA 5FRMA 1X54A 4J15A 4BY6B 2LQKA 1YFRA 2HQEA 3E9IA 1W66A 3OY9A 4P73A 1YIJT 2K5LA 5D6WA 3A5ZA 4C0ZA 4OGEA 4FL6A 5GAN3 4H2VA 1OZ2A 3J80E 4BE0A 5C51B 5IN1A 3RIRA 4TQFA 1IZ6A 3I7FA 4IUVA 2I2LA 4CH4A 3S6WA 2VUBA 1EOVA 1R8OB 3SWNA 2AMCB 4TWAA 3LW5E 2KAFA 2RJEA 3TREA 1VQPA 1LOJA 5LJ3f 1P92A 1UGQB 4C92B 4YRFA 2BUDA 2L8DA 2RHQA 1OI1A 4C8QE 1NJ5A 3BW1A 4CH6A 2YLCA 1WQWA 1WGSA 4RKUE 3EFSA 4GLKA 3CCRA 3QSUA 5KNNA 1RL2A 3G6ET 1C0AA 2E12A 1WU7A 3MEVA 2L89A 1B76A 2JZ2A 3RGLA 5GAMf 5C0MA 4HWSA 3IALA 3RMQA 3CCSA 3NFCA 3FIFA 5FLXE 1QF6A 1ATIA 3QO5A 4L6V5 1RIQA 2KQWA 4PJOF 1MHNA 2XHCA 3FC3A 3QHSA 4X9DA 3QUIA 3A7UA 2ZCEA 4WJ3M 4XTWA 5GAOp 4M7DC 2QDYB 2DIQA 2MAMA 1NJIU 1NYRA 3BY7A 5K1PA 3OS2A 2ZT7A 3M56A 4XQ3A 4TVAB 3OQ5A 4X9CA 1M4ZA 2Q7EA 4Q15A 5GAOn 2XGTA 3OMGA 3NENA 3OMCA 1OZ3A 3L2QA 4BD3A 2XD0A 4LDYA 4N4HA 4L87A 3NTKA 2XK0A 2P0PA 2RH2A 2QQRA 2LTOA 3HY0A 4X5OA 1YHQT 4C0DC 5J39A 4M7DB 3L2UA 2ZPIB 1O75A 4BE2A 2WSFE 2ZR2A 3QYGB 3CCQT 4Y28E 3JCMW 2JTFA 4LVJA 3UWNA 5FU7C 2DD4A 3JB9J 2EQKA 5ELOA 1BBWA 4M78D 1G3WA 2L3RA 2XU8A 3L42A 2RHSB 4BDZA 2EIFA 3M4PA 1NJ8A 2VYTA 3GP8A 1WJRA 4LDXA 4ZTFA 4O2DA 2DTIA 2EJFA 4X34A 1WJSA 4C0DB 1BI3A 4IUTA 1I81A 2XKOC 4E51A 1XTDA 4YRKA 3PTAA 1ASYA 3QBYA 3MCAB 4UP9A 4XTVA 3QO7A 3SD4A 4JRKA 4M75F 2JNGA 3MEUA 4BB7A 1D3BB 1K73U 3QKJA 5FU7B 2MWPA 2EJGA 4HCZA 4RMOA 3HRUA 4ZGEB 4Y91A 3ME9A 4C0FA 1Q81U 3X25B 3VUBA 2XTIA 2Y4YA 2AKWA 3HFVA 4M7AF 4EO4A 3ASKA 1TH7A 4N4GA 3HTZA 2QQ9A 4B9XA 2RJDA 1VQ5A 3HKSA 1G3SA 3OS0A 1VQNA 3GOXA 3CCEA 2DXCA 3NETA 2XG8D 1W4SA 4BUGA 2ZCFB 1YJWA 4HWPA 4RQFA 4H2WA 4NL3A 3R6OA 2ZPEB 4XK8E 3PCOB 3VYHB 1ASZA 5J3BA 2C7IA 2K5FA 2ZNJA 3RACA 3TEGA 3OS5A 3LSQA 2KK4A 1B7YB 3OBWA 3OS1A 3O8VA 1DJ7B 1G5IA 2DD5A 5GANg 2MF2A 3JSCA 5LJ5g 4P72C 2VV5A 4HVCA 2DO3A 4K86A 2EFIA 2KSSA 1NJ1A 4CI0C 4FM4B 4GY5A 4M77F 2P0QA 4H2TA 4A4FA 4HT4A 3I56T 3E9HA 3V8KA 4OVAA 2DIGA 1YJNA 5CO7A 3OYMA 3CCJT 3CCUT 2Y4XA 2QHSA 1IREB 2K4YA 1N27A 5GMKh 3GNFB 4HCBA 4A54A 4LDUA 5HK0A 2GQVA 5FRNA 1VQZA 1FXXA 4LD6A 4YRPA 2RM4A 3CBPA 4XU0A 4YTLA 4LNSA 5A0LA 3HFZA 3P8HA 4M78C 1G5VA 3MHXA 3JCMh 3UDCA 1S72A 4BI8B 1QP2A 4P71A 2E65A 2F5KA 4HA8A 4R56A 1KHCA 1WPYA 4PJOA 1I4K1 1VQ4A 2LX9A 4F7UG 1W2BA 4HWRA 4C92A 4PG3A 3LWIA 3X26B 1QE0A 3OYCA 1Y96B 4IKFA 2NS6A 1Y07A 2V8JA 3QJ6A 3N5BB 5GAN4 4M78B 3G4SA 1Z7MA 4YRCA 3A8GB 4TVRA 2DAQA 2ZNIA 3MO8A 3C4SA 3A8LB 1VIFA 2DEQA 1W2BS 3HY1A 3NTHA 1WNLA 3Q1JA 3CCMA 2PU9B 1KOGA 3QXEB 5E3IA 5LJ5d 1M90U 2XDBA 2P0KA 3P8YA 3RERA 4H2YA 3L2VA 3TEHA 1PYSB 2HQXA 4C8QD 3CCLT 2ZINA 2ZPFB 1M1FA 5C52B 3J7AF 4HWTA 3L2WA 5I21A 1M1KC 4L5GA 3NEMA 1EQRA 4PKCC 3QJYA 1VQKA 1FX7A 4A4GA 2YRVA 5GAN2 3ICAA 5KE2A 1USYA 2CJAA 4XU2A 2Q7HA 4OP0A 5HK3A 1KD1C 3BFMA 2DVEA 4EMKC 2GFUA 3OYIA 4OB0B 1Q82U 1U1TA 2WACA 2E41A 3LH0A 3L2ZA 1KQSA 3PMTA 1QP3A 1WLEA 3RMSA 3URGA 1QVFA 1JJCB 1QVPA 3H6ZA 4M75A 5GAN8 5GAN6 3L4GB 4P75A 2C06A 2K3YA 2M1HA 2RHZA 5GAMh 2WSEE 4YRGA 3FEOA 2LCLA 5EG2A 1KQSS 4II1A 3CMAA 3OSVA 1N6AA 2J3LA 3MEAA 2IG0A 4EMKB 2RHSA 4M7AA 2ZZDA 2QQBA 1QVFS 4YRTA 3JCMd 1BIAA 5K1XA 1V29B 2C8MA 3A8MB 1KMMA 2RD1A 4G85A 2ZGWA 3KXTA 1X6OA 3VQXA 4CRIA 5GMKi 1KC8U 3W3SA 5GAOr 3HP9A 1UB4A 4P5NA 3RKXA 3CC7A 4LD9K 4PJOE 3JCMc 5ELNA 4C92E 4MZTA 5GAOq 1G5HA 3OB9A 2K2VA 3M57A 3OD1A 2OTLT 1M8VA 1VQLA 2KMTA 3G7ZA 3V7CA 1YITA 3I55A 4QQGA 2EKOA 2ZTGA 1N8RC 3RL6A 1PSFA 2O01E 1AHJB 4A4KA 4WJ4A 3BJUA 4J7FA 3C94A 3CMQA 3M58A 4BI4A 4M77A 3F70A 2ZZFA 3LC0A 1UGSB 4IUPA 2QEXA 4Z02A 4YREA 3S3OA 3IKMB 2LDMA 3QZ5B 5M9OA 1FYFA 2HAXA 1Q7YC 2LRQA 3WVEB 4C8QC 2QHVA 1KMNA 3ER0A 2L5QA 4RDXA 4O5VA 4ELYC 2ZIOA 3MQZA 1YI2T 2RJFA 4YRQA 3QNEA 2FL7A 2JVVA 3VQYA 3OYAA 1VQ8T 3CD6A 1KQ2A 2Q5HA 3SDZA 1RI0A 4EMHA 1VQ6A 4YCWA 2PMFA 4PNOA 5LJ3d 2QA4A 3OYYA 5CKHA 3CC4T 4H2XA 3M53A 5FU6C 2DJZA 5GANj 4OB2B 3M4GA 2F5TX 2CGHA 4C92F 4C8QB 5LJ5j 4R55A 3QO3A 4IUQA 2GF7A 2EAYA 5I2SA 4K87A 3UH0A 3EFRA 3CXCA 4N4IA 4RG8A 3J81E 4YRMA 4M75E 2QQSA 1Q86C 5GAMd 2A7YA 3G1ZA 2E5QA 3MF1A 2D6FA 3V7RA 3PT9A 3CC2T 1QW1A 1B34A 3DKMA 4M7AE 1VQ9T 3CXCS 4E7LA 2Q7GA 5FU6B 2HBPA 3SB2A 1QVGA 2DU7A 4P74A 3JB9D 3WQZA 4E7JA 2RK1A 1K9MC 2GCXA 2ARUA 4EX5A 4BWAA 5GANe 3C95A 4H02A 1EIFA 5LJ5e 2RA2A 4QVDA 1SETA 4CS4A 2HNIA 3FLGA 2O4XB 4C5GA 4MMKA 2DKGA 1Y96A 2P5IA 2XICA 3HSBA 2OTJT 2ZZGA 2LC4A 4C0GA 4P73C 2R58A 4JDSA 5IAYA 3VJPA 2XDPA 3LGLA 4PJOG 2PUOB 2B8AA 4OGCA 4FU6A 1Q7YU 2E70A 2CZ1B 3CMEA 2RHXA 2EQUA 3SWNC 3ZEHA 2CJBA 3CCVA 5KE3A 4M77E 1YFTA 4M7DF 3V8JA 2Y90A 1BI0A 1VQLT 2BKDN 3WXMB 3FRNA 2RHYA 5GMKl 2DXBA 5A2QE 4LVKA 3SFMA 4C8QG 3A5ZB 1VQPT 3CBMA 4F7UB 2RI3A 3P8BB 2EYQA 2ARTA 5CAIA 4OLFA 2RO0A 3GIBA 2DXUA 3QIIA 3JCMP 4VUBA 3SWNB 3CCRT 1ZQ1A 1M1GA 3GNGA 1SRYA 4JJNK 2G4CA 1LJOA 4KQEA 4RQEA 2RHQB 2NLUA 3E9GA 2E5AA 3CCST 2H3JA 1LNXA 2IVWA 4UPAA 2X4WA 5F5WA 2QHTA 4JS4A 3VU3C 1K9MU 5AYFA 2RJCA 2CKKA 5A0GA 2DK3A 2F69A 1H3ZA 4A4HA 1GXIE 4F7UF 3M4QA 1ZHIA 1GGMA 4M75G 5LJ3j 4QVCA 2QI2A 4WI1A 3G71A 2QXFA 4P3OA 3META 1K8AC 2ZZEA 2DQ0A 3TCJA 3NTIA 4CS2A 4EPCA 4M7AG 3AHUA 4LVIA 3LLRA 4HT8A 3HRKA 4YYEA 1YJ9A 5GAN5 4KBMB 2KY9A 2M16A 4UP7A 3HXXA 1ADYA 2EQJA 2Q5IA 2EL9A 1LYLA 2K5IA 2AMCA 2LVMA 4RCCA 5LJ3e 5HY6A 3T9NA 4TVWA 3QZ9B 3JCMV 4E47A 3E1SA 5CVIA 4YRSA 2CYZB 4PJOD 4DOVA 3FDRA 3E9FA 5CQXA 5GANf 3VQWA 5LJ5f 3JCMg 1H4SA 4HCCA 2MI6A 1OYXA 4YRRA 2E6ZA 3CMET 2DQ3A 3V8LA 3REUA 1JBMA 1U8RA 2R5AA 2EQMA 1KHIA 3JAME 4L59A 1N9WA 4HKEA 2ZIMA 3DSQA 1VQ7A 3HPWA 4KT0E 3OYNA 2QHUA 1WQ7A 1H4QA 2RHUA 2R5MA 1X2HA 1G3YA 4JLIA 1XNIA 4YRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BJU A;  4CH5 A;  4TQD A;  3CMQ A;  1YB3 A;  3JCM W;  3UGT A;  4H2X B;  4M77 A;  4M78 F;  2ZZF A;  4TVA A;  4V2S A;  3JB9 J;  3LC0 A;  5ELO A;  2QTX A;  4YP0 A;  4P74 C;  4UP8 A;  1BBW A;  4M78 D;  4YRE A;  2RHS B;  2J3M A;  3IKM B;  1WYD A;  1SER A;  2ZXF A;  3ERR A;  1FYF A;  3R07 A;  4KR3 A;  4C8Q C;  3M4P A;  2AKW B;  2QHV A;  1NJ8 A;  3LSS A;  1KMN A;  2ZR3 A;  3IKL A;  4DPG A;  4K88 A;  4O2D A;  4RDX A;  3RF1 A;  2ZIO A;  2DTI A;  1E1O A;  2EJF A;  3A7R A;  5GAM j;  4YRQ A;  4YRI A;  3QNE A;  3A32 A;  3VQY A;  2ALY A;  1I81 A;  4E51 A;  4YRK A;  1BBU A;  4Q6G A;  4M78 E;  2IY5 A;  1KQ2 A;  2Q5H A;  12AS A;  1ASY A;  4M7D A;  3V7S A;  4UP9 A;  4XTV A;  3QO7 A;  4EMH A;  1EVL A;  4JRK A;  4M75 F;  3JB9 G;  4XU1 A;  4YCW A;  4HT9 A;  2PMF A;  4J6Y A;  4PNO A;  5LJ3 d;  1EFW A;  1YFS A;  4H2S A;  4CH3 A;  1D3B B;  4YPF A;  4M75 D;  3FJP A;  5LJ3 g;  1B34 B;  1H4V B;  2EJG A;  1I8F A;  2EJ9 A;  3QTC A;  4H2X A;  4G84 A;  4HWO A;  4J6X A;  4Y91 A;  2DJZ A;  5GAN j;  4NCX A;  3M4G A;  2CGH A;  5LJ5 j;  4C8Q B;  4C92 F;  2XTI A;  3QO3 A;  4AH6 A;  2EAY A;  4C92 D;  2AKW A;  1E1T A;  4K87 A;  3UH0 A;  3HFV A;  3EFR A;  4M7A F;  4EO4 A;  1U1S A;  1TH7 A;  2DZC A;  3HTZ A;  4YRM A;  4M7A D;  4M75 E;  2DZ9 A;  2E64 A;  4M77 G;  3INZ A;  5GAM d;  1YGB A;  5GAM e;  3TUP A;  5GAN 7;  1HXD A;  3NET A;  3G1Z A;  5GAM g;  4P71 C;  4HWP A;  1EVK A;  3MF1 A;  2I4N A;  4RQF A;  4H2W A;  3V7R A;  4NL3 A;  4P3P A;  4PJO C;  3PCO B;  3JB9 F;  1D3B A;  2CJ9 A;  4XEM A;  1ASZ A;  2ODR D;  1B34 A;  4M7A E;  2Q7G A;  4C92 C;  2C7I A;  2DU7 A;  3SB2 A;  2ZNJ A;  4P74 A;  3RAC A;  3JB9 D;  3TEG A;  3WQZ A;  2ALY B;  4XEO A;  2IY5 B;  2ARU A;  2E10 A;  3HXZ A;  4C8Q A;  4EX5 A;  3LSQ A;  4EMG A;  5GAN d;  1B7Y B;  4N0A A;  4BWA A;  2ZT8 A;  5GAN e;  3HFZ B;  1G5I A;  3QO8 A;  4H02 A;  1EIY A;  5LJ5 e;  4F7U A;  1NJ2 A;  5GAN g;  2RA2 A;  4QVD A;  1SET A;  4CS4 A;  5LJ5 g;  2HNI A;  1YCY A;  3PGG A;  4P72 C;  4HVC A;  3KFU A;  4MMK A;  4K86 A;  2P0L A;  3RKY A;  2DKG A;  2DDZ A;  2FB7 A;  3RUX A;  1Y96 A;  2P5I A;  1NJ1 A;  2E3C A;  4M77 F;  3HSB A;  2I4M A;  5GMK m;  2DXT A;  2ZZG A;  4H2T A;  4H2U A;  2VXF A;  4P73 C;  4M77 D;  4PJO B;  3P8T A;  1NJ6 A;  3VQV A;  3E9H A;  3V8K A;  4ZTZ B;  4PJO G;  4YCV A;  1L0W A;  2QHS A;  3PCO A;  5GMK h;  3UGQ A;  1IL2 A;  4A54 A;  5LJ3 h;  4JRI A;  1N9S A;  3JCM J;  3PZC A;  1H4T A;  1VQZ A;  3MF2 A;  5DY9 A;  4MML A;  3RKW A;  1G51 A;  3SWN C;  4YRP A;  2RM4 A;  3JCM f;  2CJB A;  4XU0 A;  5GAO m;  1B7Y A;  4LNS A;  1N9R A;  3HFZ A;  1YFT A;  4M77 E;  1X55 A;  4XTU A;  4M78 C;  4M7D F;  3V8J A;  1NYQ A;  5HGQ A;  2Y90 A;  1KQ1 A;  3MEY A;  3JCM h;  4M7D D;  2ZT5 A;  3HXV A;  4XTX A;  1SES A;  4J5Y A;  1USY C;  4ZIB A;  1BIB A;  5GMK l;  4ZTU B;  4KR2 A;  3HFO A;  1JRI A;  4P71 A;  1M5Q 1;  2E65 A;  3A5Y A;  4C8Q G;  2DTH A;  4HA8 A;  1J5W A;  2EWN A;  3JB9 I;  3JCM b;  1WPY A;  1EIY B;  4PJO A;  1I4K 1;  4F7U B;  3RES A;  1HK9 A;  1E22 A;  2ART A;  5CAI A;  4F7U G;  1E24 A;  3TEH B;  4HWR A;  4C92 A;  4OLF A;  4TVY A;  3P8V A;  2I4L A;  4PG3 A;  3GIB A;  4M7D E;  2DXU A;  1QE0 A;  3JCM P;  1Y96 B;  3SWN B;  3HXW A;  4BW9 A;  4M75 C;  4XU3 A;  5GAN 4;  4M78 B;  1Z7M A;  4P75 C;  4YRC A;  1SRY A;  1B70 A;  4M78 G;  1MGQ A;  2G4C A;  2ZNI A;  1HC7 A;  1LJO A;  4KQE A;  2PME A;  4P72 A;  4RQE A;  2RHQ B;  2DEQ A;  3HRI A;  2E1H A;  3HY1 A;  3IG2 A;  1WNL A;  2E5A A;  1X54 A;  4J15 A;  3REX A;  1KOG A;  1LNX A;  1X01 A;  1YFR A;  4UPA A;  4M7A C;  3E9I A;  5E3I A;  1W66 A;  4P73 A;  5F5W A;  2QHT A;  3A5Z A;  5LJ5 d;  2CIM A;  3VU3 C;  5GAN 3;  4H2V A;  4C8Q F;  3L1A A;  2ZT6 A;  3P8Y A;  3RER A;  4H2Y A;  5C51 B;  11AS A;  3TEH A;  3RIR A;  1PYS B;  4TQF A;  4C8Q D;  4F7U F;  2ZIN A;  3M4Q A;  5GMK j;  4M75 B;  3I7F A;  3A7A A;  2JN0 A;  4YRN A;  5C52 B;  2I2L A;  4HWT A;  4CH4 A;  4TTV A;  4M75 G;  5I21 A;  1EOV A;  1GGM A;  3SWN A;  5LJ3 j;  4QVC A;  4WI1 A;  2ODR C;  3NEM A;  4XTY A;  2AMC B;  4P3O A;  4TWA A;  1EQR A;  4M78 A;  2ZZE A;  1NNH A;  1LOJ A;  5LJ3 f;  2RB6 A;  1ADJ A;  5GAN 2;  4C92 B;  3ICA A;  2VC8 A;  2DQ0 A;  1USY A;  4J6W A;  4YRF A;  2CJA A;  4C92 G;  2RHQ A;  4C8Q E;  1NJ5 A;  4XU2 A;  3BW1 A;  2Q7H A;  4NL2 A;  4CS2 A;  4OP0 A;  4M7A B;  2YHT A;  4CH6 A;  2YLC A;  3BFM A;  1WQW A;  1B8A A;  4M7A G;  4F7U E;  2DVE A;  3EFS A;  3FB9 A;  4EMK C;  3AHU A;  3JCM X;  1Z7N A;  4A53 A;  2I4O A;  5KNN A;  3QSU A;  4YRL A;  4RCB A;  2K57 A;  4N0A C;  4HT8 A;  1C0A A;  3HXY A;  1U1T A;  1B70 B;  2E41 A;  3L2Z A;  3HRK A;  1WU7 A;  4YYE A;  3NEL A;  3JB9 H;  3UFG A;  1WLE A;  5GAN 5;  4CS3 A;  3A74 A;  1B76 A;  1PYS A;  3HXU A;  4M77 C;  4UP7 A;  3RGL A;  3HXX A;  1JJC B;  4RMF A;  4M75 A;  5GAM f;  1ADY A;  5GAN 8;  4HWS A;  2Q5I A;  3IAL A;  2EL9 A;  4P3N A;  5GAN 6;  3L4G B;  5C53 B;  4P75 A;  1LYL A;  5GMK e;  3FIF A;  2AMC A;  4RCC A;  4YCU A;  5GAM h;  2DTO A;  5LJ3 e;  1X2G A;  1QF6 A;  4YRG A;  1ATI A;  3A31 A;  3QO5 A;  4JUV A;  4TVW A;  2VXE A;  1RIQ A;  3JCM V;  4PJO F;  2ARS A;  3QHS A;  3BDU A;  2J3L A;  4YRS A;  4X9D A;  3QUI A;  4EMK B;  4PJO D;  2RHS A;  4M7A A;  3A7U A;  2ZCE A;  4WJ3 M;  4YRT A;  4XTW A;  2FYK A;  5GAO p;  3VBB A;  5GAO l;  3JCM d;  4M7D C;  3JCM e;  1BIA A;  5GAN f;  5K1X A;  3VQW A;  5LJ5 f;  2C8M A;  3JCM g;  1NYR A;  1H4S A;  3BY7 A;  1KMM A;  2RD1 A;  4NOY A;  5K1P A;  2DU5 A;  4YRR A;  4G85 A;  2ZT7 A;  2ZGW A;  4XQ3 A;  4M77 B;  4XTZ A;  1X56 A;  4TVA B;  5GAN h;  3VQX A;  2YLB A;  4X9C A;  5GMK i;  5LJ5 h;  2DQ3 A;  3W3S A;  5GAO r;  3V8L A;  2Q7E A;  4PHC A;  5GAO n;  4Q15 A;  1JJC A;  2XGT A;  3RKX A;  3REU A;  1H64 1;  4PJO E;  1JBM A;  3NEN A;  3L4G A;  3JCM c;  5ELN A;  4YDQ A;  4C92 E;  4DQ2 A;  5GAO q;  1G5H A;  1N9W A;  3OD1 A;  2ZIM A;  3DSQ A;  1M8V A;  4L87 A;  3HY0 A;  4X5O A;  3JCM Q;  1WQ7 A;  3V7C A;  2QHU A;  1H4Q A;  4WF2 A;  4EMK A;  4M7D B;  1X2H A;  3HFN A;  4M7D G;  2ZTG A;  4YRO A;  3RL6 A;  4JLI A;  4WJ4 A;  1I5L A;  4YRJ A;  2ZR2 A;  1HTT A; 
#chains in the Genus database with same CATH topology
 4CH5 A;  1MNE A;  1VQ5 T;  2VAS A;  3UGT A;  4QVZ A;  4M78 F;  1VQN T;  4TVA A;  4V2S A;  1F1B B;  2EYZ A;  4ZGD B;  3CCE T;  1NYF A;  4UP8 A;  3QDR B;  3OYF A;  1VQO A;  2J3M A;  2X3W D;  1WYD A;  1YJW T;  4KUI A;  1PHT A;  3R07 A;  1VQM A;  3ERR A;  2A8E A;  2AKW B;  4J9E A;  3VV0 A;  1PG5 B;  1FWZ A;  1VIE A;  2YUN A;  3CEY A;  1ACM B;  1E1O A;  1H8K A;  1C1A A;  3A7R A;  2DE0 X;  1SHF A;  2H8H A;  4YRI A;  2KRN A;  2M9U A;  3CCV Q;  2JJ9 A;  3X28 B;  2NWM A;  4M7D A;  5ECA A;  4D6W A;  2CUD A;  2DL3 A;  4RG2 A;  1EVL A;  1QCN A;  3EGU A;  3JB9 G;  2E6N A;  2FVU A;  4BI3 A;  1EFW A;  1PD0 A;  1YFS A;  4CH3 A;  4YPF A;  1YCS B;  4M75 D;  3UAT A;  5LJ3 g;  1A0N B;  3DB3 A;  2DNU A;  1I8F A;  1BYM A;  4PFP A;  3LYI A;  2FPF A;  4JJD A;  1WFW A;  4G84 A;  4HWO A;  4J6X A;  3LGF A;  2BIV A;  1YHQ A;  9ATC B;  4KUL A;  2M0O A;  1Q86 R;  3M54 A;  1M3A A;  3LX7 A;  3CPW A;  1YJN T;  3HTR A;  1E1T A;  3CCL Q;  2DL7 A;  1BKB A;  4F14 A;  1Y57 A;  5KYN A;  4M7A D;  2LT1 A;  3CCQ A;  4CC3 A;  1NJI C;  5A0D A;  3VYG A;  2E64 A;  8ATC B;  3H8Z A;  1XJW B;  1UEC A;  2RMO A;  4JRP A;  4ZTJ A;  4AG2 C;  3EG9 A;  4IIM A;  5GAM g;  4C5I A;  3OYL A;  4P71 C;  1K9M R;  1RAD B;  2OX7 A;  1EVK A;  2GTJ A;  4J9C A;  2D0Q B;  3GBQ A;  4NS5 A;  4PJO C;  3CPW S;  2K9G A;  1D3B A;  4XEM A;  1V1C A;  4PLL A;  2ODR D;  4PFO A;  1S72 T;  4MDW A;  4C92 C;  2K79 A;  2ZPB B;  2PQW A;  2VB6 A;  1RAG B;  2ALY B;  1WHG A;  3QYH B;  3C12 A;  4ME7 A;  2IY5 B;  4LDW A;  1FYN A;  3RDV A;  4N0A A;  1SPK A;  1VQ4 T;  1CSK A;  3HFZ B;  4F7U A;  5CCA A;  3M0P A;  2J7I A;  1G83 A;  1TWB A;  3HRS A;  3OW2 A;  4J8O A;  1M1K U;  1O9S A;  2CZ7 B;  2O88 A;  3RKY A;  3PFS A;  2DDZ A;  2CZ6 B;  5KCO A;  1NLO C;  2WSC E;  4O6J A;  4QW2 A;  4BE1 A;  2DXT A;  3G4S T;  2LNV A;  4H2U A;  2KVQ G;  2VXF A;  4M77 D;  4PJO B;  1NJ6 A;  3VQV A;  4ZTZ B;  4E7I A;  1KD1 U;  3PCO A;  4ELZ C;  1ZUU A;  1GCP A;  3UGQ A;  3DLM A;  2JTM A;  2RHI A;  4B9W A;  5CIU A;  4DBQ A;  3CCM T;  4OMO A;  3OW2 S;  3JCM J;  3PZC A;  1W2B P;  5DY9 A;  5CKF A;  5L8R E;  3S3M A;  1R0B G;  1TXQ A;  4C5E A;  1B7Y A;  3OYG A;  3VS7 A;  1N9R A;  5KYY A;  1VQ7 T;  4Z88 A;  5HGQ A;  1YP5 A;  2B86 A;  3CPF A;  3MP6 A;  2HD0 A;  5DLQ E;  3WVD B;  2ZT5 A;  3HXV A;  2QQA A;  1WHJ A;  1KG1 A;  3MP8 A;  2FZC B;  2G3R A;  2X35 A;  1USY C;  1BIB A;  1SKU B;  1X6B A;  5CKD A;  1JJ2 P;  3MP1 A;  2NUZ A;  1YIJ Q;  4KR2 A;  3JRZ A;  3OYK A;  1K73 C;  2OAU A;  1ZA2 B;  1ZBJ A;  1M5Q 1;  2OTL Q;  2FHD A;  1K9A A;  3A5Y A;  2DTH A;  1J5W A;  2EWN A;  1VQK T;  3CBO A;  3H0F A;  3JCM b;  1EIY B;  1Q81 C;  1HJD A;  1AWO A;  3E2U A;  1NPP A;  3TEH B;  2X4Y A;  2DPP B;  4TVY A;  2I4L A;  1VQO T;  4M7D E;  2NUP A;  2CZ0 B;  1VQM T;  3OYD A;  4E7H A;  3HXW A;  4M75 C;  1WJQ A;  1D09 B;  2GFA A;  1RLQ C;  3ZFJ A;  4P75 C;  3VS1 A;  1I07 A;  3I56 A;  4XAX B;  2A37 A;  5DM7 R;  4MDX A;  2VGN A;  4P72 A;  3CCJ A;  3CCU A;  2MMP A;  4QQ6 A;  2PVD B;  3HRI A;  2E1H A;  5D6X A;  3IG2 A;  2FEI A;  1D1A A;  5HCK A;  3G6E Q;  3REX A;  2FG0 A;  1X01 A;  4M7A C;  5I11 A;  2M0Y A;  3VUZ A;  1YI2 Q;  1RAB B;  3RNJ A;  3X20 B;  2CIM A;  2CP2 A;  1JB0 E;  1WDX A;  4C8Q F;  3L1A A;  2ZT6 A;  3D7S B;  2QAS A;  11AS A;  3CMA T;  2NUT B;  2CSQ A;  3EFO B;  2KRS A;  1N8R U;  2BE7 D;  5GMK j;  4M75 B;  2AHJ B;  4CC7 A;  1KQS P;  3A7A A;  2JN0 A;  4ZN3 A;  4YRN A;  4TTV A;  2L3S A;  1QVG S;  4GBQ A;  2XI9 A;  1J3T A;  3EG0 A;  1Y7X A;  2ODR C;  2LT4 A;  2OJ2 A;  4XTY A;  1OX8 A;  3CC4 Q;  2RF0 A;  1QVF P;  2QAZ A;  4HVV A;  2VKN A;  4M78 A;  2D0N A;  1NNH A;  2A0F B;  4OMN A;  2RB6 A;  1ADJ A;  2YDL A;  2VC8 A;  3HHT B;  1TUD A;  3EH2 A;  1TSF A;  4J6W A;  4C92 G;  3EH1 A;  3KBG A;  3CC7 T;  4NL2 A;  2K2M A;  5I2M A;  4M7A B;  2YHT A;  1SRL A;  1B8A A;  1UE9 A;  1UUE A;  3GPL A;  2KDS A;  4F7U E;  3FB9 A;  2I4O A;  1X2Q A;  3JCM X;  1Z7N A;  4A53 A;  3KUF A;  3P8D A;  4YRL A;  3EGD B;  2L3P A;  2K57 A;  4N0A C;  4RCB A;  4JRQ A;  2W0Z A;  3HXY A;  4LDV A;  3QPH A;  1B70 B;  3PIP A;  2JUF A;  3NEL A;  2YUO A;  1RAE B;  3JB9 H;  3UFG A;  4ZGJ B;  4CS3 A;  3A74 A;  1PYS A;  2R57 A;  2W10 A;  3HXU A;  4M77 C;  1YIT T;  4RTU A;  3I55 T;  4RMF A;  3M55 A;  4P3N A;  1Y0M A;  5C53 B;  3HL8 A;  5GMK e;  3CC2 Q;  5CKB A;  5IXB A;  4YCU A;  1X2G A;  1T3L A;  2DTO A;  3A31 A;  2CT4 A;  1MV3 A;  4JUV A;  3M4Y A;  2VXE A;  2X4X A;  2C0T A;  4LVL A;  1NE8 A;  2QEX T;  1M9S A;  3EGX B;  2ARS A;  3BDU A;  3CCL A;  3KFV A;  5CK9 A;  3LWH A;  2OI3 A;  2FYK A;  3VBB A;  5GAO l;  3JCM e;  4C5H A;  1MMN A;  4E7K A;  1AOJ A;  4LNP A;  5J26 A;  5KH6 A;  1Q86 U;  1ZLM A;  4NOY A;  2DU5 A;  4XTZ A;  4M77 B;  1X56 A;  4QKU A;  5GAN h;  2OTJ Q;  2YLB A;  5LJ5 h;  3UT1 A;  2DRK A;  3CD6 T;  2CRE A;  4PHC A;  1JJC A;  4WCI A;  1H64 1;  4OB3 B;  2P4T A;  1VQ6 T;  3UPU A;  3L4G A;  1YBY A;  4PL6 A;  3M59 A;  2QA4 T;  4MZP A;  4YDQ A;  4DQ2 A;  3OBY A;  1K4U S;  2DM1 A;  4UC4 A;  2CP5 A;  1M1K R;  1KSW A;  3OSS C;  3S3N A;  2LZ6 B;  3OYB A;  4RTW A;  3VRZ A;  3A8H B;  1U3O A;  4JS5 A;  1M90 C;  1XQH A;  5KYX B;  3JCM Q;  4WF2 A;  4EMK A;  2LCS A;  4IUU A;  1QWE A;  4R0K A;  3HFN A;  4FSX A;  4M7D G;  4YRO A;  4AFQ C;  1G3T A;  4KUD K;  4KH0 B;  2K3X A;  4K11 A;  4DEY A;  3PIO A;  1C6V X;  1I5L A;  1X75 C;  2A36 A;  1HTT A;  1K0S A;  1WHL A;  4TQD A;  1VUB A;  1K1Z A;  1UGR B;  1YB3 A;  3DB4 A;  4OMP A;  2F2W A;  4H2X B;  2VVK A;  4LUE A;  2RI2 A;  4FT2 A;  1PSE A;  2VGM A;  2QTX A;  4YP0 A;  4P74 C;  1XOV A;  5HKC A;  2EKH A;  3NMZ C;  4FW2 A;  1SER A;  2YRC A;  2ZXF A;  4KR3 A;  3GLX A;  3HRT A;  2BZY A;  1ZUK A;  3LSS A;  2ZR3 A;  4QQD A;  3VKI A;  3IKL A;  4DPG A;  3BDL A;  4K88 A;  3JV3 A;  2DA9 A;  4ATO A;  3RF1 A;  5GAM j;  1OOT A;  2PVG B;  3DLL A;  3CCR Q;  1Q82 C;  1X27 A;  3A32 A;  2ALY A;  3CXC P;  4IUR A;  3ZBD A;  1BBU A;  1ZSZ B;  2FZK B;  4Q6G A;  4FYV B;  4M78 E;  2IY5 A;  2MYS A;  5IHK A;  12AS A;  3V7S A;  3PNW C;  5D6Y A;  4FYW B;  3I5S A;  4XU1 A;  4HT9 A;  4J6Y A;  3QG1 A;  3TSZ A;  1UGP B;  1YIJ A;  3OYJ A;  4H2S A;  1Z9Q A;  1ZBX A;  1ZUY A;  3EG3 A;  4OML A;  3FJP A;  3CCS Q;  1B34 B;  1H4V B;  5LL6 S;  2EJ9 A;  4Q5W A;  2OTL A;  3QTC A;  1AT1 B;  2CP6 A;  4OB1 B;  4A4E A;  4NCX A;  4PJJ A;  1NZ9 A;  4PLI A;  4EDU A;  4AH6 A;  3OYE A;  3TU4 K;  4C92 D;  2ZPG B;  1U1S A;  4OMF B;  2DZC A;  3O5Z A;  2CP3 A;  4Z8A A;  1SHG A;  1R77 A;  2LQ8 A;  2XID A;  3X24 B;  3M5A A;  2DZ9 A;  5DLO A;  2RQW A;  4M77 G;  3INZ A;  3I56 Q;  1YGB A;  1QCO A;  2KR3 A;  3E19 A;  5GAM e;  5GAN 7;  3TUP A;  1HXD A;  1WXU A;  4FYX B;  2QGF B;  4LE9 A;  4B6M A;  3CCV T;  1KC8 C;  2I4N A;  4BAC A;  1BI2 A;  2YUQ A;  1JJ2 A;  4P3P A;  1BI1 A;  1GBQ A;  4LVM A;  3G6E A;  3JB9 F;  1N8R R;  2CJ9 A;  3OYH A;  5FRO A;  1YI2 A;  2KT8 A;  4Z89 A;  3EHQ A;  3BE3 A;  4XEO A;  2E10 A;  1VQ8 A;  2M02 A;  3HXZ A;  1UEB A;  4C8Q A;  2BE9 B;  4EMG A;  5GAN d;  2ZT8 A;  4OF1 A;  3QO8 A;  1EIY A;  4FT4 A;  3EAE A;  4WTO B;  1UHF A;  1NJ2 A;  2AKL A;  1YCY A;  2PVO B;  3MEW A;  3PGG A;  1JJ2 S;  2KBT A;  2LJ3 A;  3CC4 A;  4KGX B;  3KFU A;  3OA6 A;  2P0L A;  2ZPH B;  1T3S A;  5FWC A;  4AFS C;  2FB7 A;  3RUX A;  1K8A U;  1NLP C;  2E3C A;  2RK2 A;  2HSP A;  4DA4 A;  1QQJ A;  2I4M A;  1Y71 A;  5GMK m;  2JM8 A;  2V8I A;  1JU5 C;  4RUG A;  1GFD A;  3P8T A;  3RBB B;  2IIM A;  4GLM A;  4YCV A;  1L0W A;  3EG2 A;  1SSF A;  5KCH A;  3ZL7 C;  3PMI A;  2D9T A;  1IL2 A;  1HYO A;  2X4J A;  5LJ3 h;  4JRI A;  2QGG A;  1N9S A;  1NPR A;  4JZ3 A;  1H4T A;  4CC2 A;  1GBR A;  3H0I A;  3MF2 A;  4MML A;  2AK5 A;  3RKW A;  1G51 A;  3TSW A;  4PJL A;  1TUG B;  5CKE A;  3JCM f;  1ABQ A;  5GAO m;  2DVJ A;  1X55 A;  1RAC B;  4XTU A;  1NYQ A;  4JLG A;  1CKA A;  1KQ1 A;  3MEY A;  1NM7 A;  4LXC A;  2JXB A;  1KIK A;  4J9B A;  4DOW A;  3GF5 A;  5CQY A;  2O4X A;  1OQK A;  4M7D D;  2RI5 A;  2MWO A;  3A8O B;  4XTX A;  1SES A;  4J5Y A;  1SEM A;  2JOY A;  3CC2 A;  1VQ9 A;  4ZIB A;  4ZTU B;  3G71 T;  1B7T A;  5C6S A;  2J6F A;  1JRI A;  3HFO A;  4J83 A;  4ZN1 A;  3M0U A;  4BY6 C;  3JB9 I;  2CT3 A;  1M3C A;  3RES A;  1HK9 A;  1E22 A;  1EZZ B;  4JZ4 A;  1E24 A;  2E3H A;  4MZM A;  3P8V A;  4J7I A;  2PUK B;  2CS7 A;  3M9Q A;  4BW9 A;  5KYU B;  3H9N A;  2M51 A;  5CR2 A;  1VQ5 Q;  4XU3 A;  2LCC A;  2KT1 A;  2OTJ A;  1E7O A;  3EGD A;  1KJW A;  1UGV A;  2DJQ A;  5AT1 B;  1VQN Q;  1B70 A;  4M78 G;  1MGQ A;  2K7A A;  1EFN A;  1UDL A;  1UG1 A;  2V8K A;  1YJ9 T;  1HC7 A;  2A3L A;  4BDY A;  2PME A;  1AD5 A;  4FIB A;  4RTV A;  2YT6 A;  3TEE A;  1YJW Q;  1UJY A;  2X9H A;  2XDD A;  1K0X A;  4JJB A;  3MPU B;  5IT9 E;  3L2R A;  5FRM A;  1G2B A;  2NYS A;  1X54 A;  4J15 A;  4BY6 B;  2LQK A;  1YFR A;  2HQE A;  3E9I A;  1W66 A;  3OY9 A;  4P73 A;  2C0I A;  1IB8 A;  1K76 A;  2K5L A;  2HCK A;  1YIJ T;  5D6W A;  3A5Z A;  1RAH B;  4C0Z A;  4OGE A;  4FL6 A;  5GAN 3;  4H2V A;  2PNI A;  1OZ2 A;  3J80 E;  4BE0 A;  5C51 B;  5IN1 A;  4RTT A;  3RIR A;  2AT1 B;  4TQF A;  3EGX A;  5EC7 A;  3UA7 A;  6AT1 B;  1IZ6 A;  1RUW A;  2F1L A;  3I7F A;  4IUV A;  2I2L A;  4CH4 A;  3S6W A;  2VUB A;  1EOV A;  1R8O B;  3SWN A;  1CKB A;  2AMC B;  4TWA A;  3LW5 E;  2BZX A;  1YWP A;  2PZ1 A;  2KAF A;  2RJE A;  3TRE A;  2L0A A;  1G8X A;  1VQP A;  1LOJ A;  1RLP C;  5LJ3 f;  2EGA A;  1P92 A;  1UGQ B;  2MPX C;  4C92 B;  4YRF A;  2BUD A;  2L8D A;  2RHQ A;  1M27 C;  1YN8 A;  1OI1 A;  4C8Q E;  1NJ5 A;  3BW1 A;  4CH6 A;  2YLC A;  1WQW A;  2KXD A;  1WGS A;  4RKU E;  3M0T A;  3EFS A;  1M2V B;  1UTI A;  4GLK A;  3CCR A;  3QSU A;  4M4Z A;  5KNN A;  2HBW A;  4HVW A;  1RL2 A;  3G6E T;  1C0A A;  2E12 A;  1WU7 A;  3MEV A;  3M0Q A;  3G1J A;  2L89 A;  2ROT A;  1B76 A;  2JZ2 A;  1ABO A;  1GCQ A;  1M8M A;  3RGL A;  4J9H A;  5GAM f;  3SEM A;  2DL4 A;  5C0M A;  4HWS A;  3IAL A;  3RMQ A;  3CCS A;  3NFC A;  4JJC A;  3FIF A;  5FLX E;  2HDA A;  1S72 Q;  1X2K A;  1QF6 A;  1ATI A;  2VWF A;  3QO5 A;  1SG5 A;  4L6V 5;  3UA6 A;  1RIQ A;  2KQW A;  4PJO F;  1MHN A;  2EPD A;  2XHC A;  5I22 A;  3FC3 A;  2LX7 A;  3QHS A;  1VQ4 Q;  4X9D A;  3QUI A;  3A7U A;  2ZCE A;  4WJ3 M;  4XTW A;  4F16 A;  5GAO p;  4M7D C;  2QDY B;  2DIQ A;  2J6K A;  2MAM A;  1NJI U;  1NYR A;  4DBR A;  3BY7 A;  3NHN A;  5K1P A;  3OS2 A;  2ZT7 A;  3M56 A;  4XQ3 A;  4TVA B;  3OQ5 A;  1NBE B;  4X9C A;  1M4Z A;  2KE9 A;  1MMA A;  2Q7E A;  4Q15 A;  5GAO n;  1I1J A;  1ZSZ A;  2XGT A;  1MMD A;  1WI7 A;  3OMG A;  4FW1 A;  2SRC A;  3NEN A;  1D0Z A;  3OMC A;  4JPB W;  2OAW A;  1OZ3 A;  3L2Q A;  1RAA B;  2HKN A;  2JW4 A;  4BD3 A;  1QKW A;  4KH1 B;  2XD0 A;  2P4R A;  1MV0 B;  5FWB A;  1VOM A;  1PKS A;  2DET A;  1VQ8 Q;  4LDY A;  1K8A R;  1Q95 G;  4N4H A;  4L87 A;  3NTK A;  2XK0 A;  2P0P A;  2RH2 A;  3I35 A;  2QQR A;  2LTO A;  3HY0 A;  4X5O A;  1YHQ T;  5GJV B;  4C0D C;  5J39 A;  3QWX X;  2DIL A;  2GBQ A;  4M7D B;  2YRD A;  3L2U A;  2ZPI B;  1O75 A;  4BE2 A;  1RI9 A;  5L23 A;  2WSF E;  2ZR2 A;  3QYG B;  4CC4 B;  5FW9 A;  3CCQ T;  4Y28 E;  3JCM W;  2JTF A;  2O9S A;  1JEG A;  4LVJ A;  2QG9 B;  5FU7 C;  2DD4 A;  3UWN A;  2EQK A;  3JB9 J;  5ELO A;  3NGP A;  4ORZ A;  1VQK Q;  1BBW A;  4M78 D;  1G3W A;  2L3R A;  2XU8 A;  3L42 A;  2RHS B;  1Q82 R;  4BDZ A;  1ZSG A;  2EIF A;  3M4P A;  3QWY A;  1NJ8 A;  2VYT A;  3GP8 A;  1WJR A;  4LDX A;  4ZTF A;  4O2D A;  2DTI A;  2EJF A;  4X34 A;  1WJS A;  1H3H A;  3CPW P;  4C0D B;  1BI3 A;  4IUT A;  2EYW A;  1I81 A;  2XKO C;  4E51 A;  1XTD A;  4YRK A;  3EG9 B;  1SSH A;  3PTA A;  2A08 A;  1ASY A;  3QBY A;  3MCA B;  4UP9 A;  4XTV A;  5KYW B;  4F17 A;  3SD4 A;  3QO7 A;  2QYZ A;  4JRK A;  4M75 F;  2EYY A;  1SRM A;  2YSQ A;  3QDF A;  1VQ9 Q;  2JNG A;  1WIE A;  3MEU A;  4DBF A;  4BB7 A;  1D3B B;  1K73 U;  3QKJ A;  5FU7 B;  2MWP A;  2EJG A;  2QK0 A;  4HCZ A;  4RMO A;  3HRU A;  4ZGE B;  4Y91 A;  3ME9 A;  4C0F A;  3LH5 A;  1Q81 U;  3X25 B;  3VUB A;  4D8K A;  2XTI A;  3CMA Q;  2MK5 A;  1WXT A;  2RQU A;  2Y4Y A;  2AKW A;  2COZ A;  3HFV A;  2DX1 A;  4M7A F;  1PWT A;  4EO4 A;  3ASK A;  1TH7 A;  4KGV B;  4N4G A;  1E6H A;  3HTZ A;  1IGQ A;  2QQ9 A;  4B9X A;  1PD1 A;  2RJD A;  1IXD A;  1VQ5 A;  3HKS A;  1G3S A;  3OS0 A;  1GCQ C;  1VQN A;  3GOX A;  3CCE A;  2JM9 A;  2DXC A;  3NET A;  2XG8 D;  4PK4 A;  1W4S A;  4BUG A;  1W6X A;  2CP0 A;  2ZCF B;  1YJW A;  4IIO A;  4HWP A;  4RQF A;  4H2W A;  4NL3 A;  3MJX A;  3R6O A;  2ZPE B;  1AWJ A;  4XK8 E;  4FYY B;  3PCO B;  2GNC A;  3VYH B;  2JMA A;  1ASZ A;  5J3B A;  1GL5 A;  2C7I A;  2K5F A;  2ZNJ A;  3RAC A;  3TEG A;  7AT1 B;  1WZO A;  1LVK A;  3OS5 A;  1KFZ A;  3LSQ A;  1WXB A;  1AVZ C;  2AZV A;  2KK4 A;  3OBW A;  1B7Y B;  3OS1 A;  1VQL Q;  3O8V A;  1DJ7 B;  5KYY B;  1G5I A;  2DD5 A;  1YWO A;  4RTX A;  2HQH A;  3PE0 A;  2F2X A;  5GAN g;  1T0J A;  2MF2 A;  3JSC A;  5LJ5 g;  4FCY A;  3VS5 A;  4P72 C;  2VV5 A;  4OMM A;  4HVC A;  2KRM A;  2DO3 A;  4K86 A;  2EFI A;  2KSS A;  2FRW A;  1VQP Q;  1NJ1 A;  1QCF A;  1RAF B;  4E7Z A;  4CI0 C;  4FM4 B;  4GY5 A;  4M77 F;  1GRI A;  2P0Q A;  4H2T A;  4A4F A;  4HT4 A;  2DL5 A;  3U23 A;  3I56 T;  1UFF A;  3E9H A;  3V8K A;  1NEB A;  4OVA A;  2DIG A;  1YJN A;  5CO7 A;  3OYM A;  3CCJ T;  3CCU T;  2Y4X A;  2QHS A;  1IRE B;  2K4Y A;  1N27 A;  5GMK h;  3GNF B;  4HCB A;  4A54 A;  4LDU A;  2NUP B;  5HK0 A;  3VS4 A;  2GQV A;  4HXJ A;  4F04 B;  1YFN A;  5FRN A;  1VQZ A;  1FXX A;  1PNJ A;  4LD6 A;  3ULR B;  4AT1 B;  4YRP A;  2RM4 A;  3CBP A;  4XU0 A;  4YTL A;  4LNS A;  5A0L A;  3HFZ A;  1VYT A;  2O2O A;  3P8H A;  4M78 C;  3CD6 Q;  1G5V A;  3MHX A;  3JCM h;  1I5O B;  3UDC A;  1VQ6 Q;  1OUL A;  1S72 A;  3I5R A;  2QA4 Q;  1IRX A;  2HEQ A;  4BI8 B;  2FO0 A;  1NJI R;  1QP2 A;  4P71 A;  2LQN A;  2E65 A;  2F5K A;  4RTZ A;  1QVG P;  4HA8 A;  4R56 A;  2A28 A;  2DMO A;  2YXY A;  1KHC A;  1WPY A;  4PJO A;  1I4K 1;  1VQ4 A;  2LX9 A;  4F7U G;  4LN2 A;  1OU9 A;  4FSS A;  1W2B A;  2RQT A;  4HWR A;  4C92 A;  4PG3 A;  3LWI A;  3X26 B;  1QE0 A;  3CQT A;  3OYC A;  1Y96 B;  4IKF A;  2NS6 A;  1Y07 A;  2V8J A;  2AZS A;  1E6G A;  3QJ6 A;  2D8H A;  1OV3 A;  2MOX A;  3N5B B;  5GAN 4;  4M78 B;  3G4S A;  1Z7M A;  3REA B;  5IH2 A;  3A8G B;  4TVR A;  4YRC A;  2DAQ A;  2ZNI A;  1WHM A;  3MO8 A;  3C4S A;  1LPL A;  3A8L B;  2D1X A;  1VIF A;  2DEQ A;  1W2B S;  3HY1 A;  3NTH A;  1IO6 A;  1WNL A;  3Q1J A;  3CCM A;  2PU9 B;  2ABL A;  3QXE B;  1KOG A;  5E3I A;  2F2V A;  1W1F A;  4D8D A;  2ENM A;  2LQW A;  5LJ5 d;  1M90 U;  2ED1 A;  2XDB A;  2P0K A;  3P8Y A;  5D7U A;  2J05 A;  3RER A;  4H2Y A;  3L2V A;  3TEH A;  1PYS B;  2HQX A;  1JO8 A;  4C8Q D;  3CCL T;  3H41 A;  2ZIN A;  2ZPF B;  1M1F A;  1PRL C;  5C52 B;  3VS3 A;  1X69 A;  3J7A F;  4HWT A;  3L2W A;  5I21 A;  3TQ7 P;  1M1K C;  4L5G A;  3NEM A;  1EQR A;  4QT7 A;  4PKC C;  2K3B A;  3QJY A;  2DYB A;  1VQK A;  2JMC A;  1EX4 A;  1FX7 A;  4A4G A;  2YRV A;  5GAN 2;  3ICA A;  1W70 A;  5KE2 A;  1USY A;  2CJA A;  4XU2 A;  2Q7H A;  8AT1 B;  1PM3 A;  4OP0 A;  5HK3 A;  1KD1 C;  3BFM A;  1BCO A;  1QMC A;  1YNZ A;  2DVE A;  1WHH A;  2LJ0 A;  4EMK C;  2GFU A;  1WLP B;  1LCK A;  3OYI A;  1KK7 A;  4J9F A;  4OB0 B;  1Q82 U;  1K73 R;  1U1T A;  2WAC A;  2E41 A;  1TTH B;  3L2Z A;  3LH0 A;  3CME Q;  3PMT A;  1KQS A;  1HD3 A;  2ED0 A;  1QP3 A;  1WLE A;  2NUT A;  3RMS A;  3EFO A;  1Q81 R;  1AZG B;  3URG A;  1QVF A;  2CP7 A;  1JJC B;  1QVP A;  3H6Z A;  2YUP A;  4M75 A;  5GAN 8;  2J06 A;  1S1N A;  2ECZ A;  5IXF A;  1TS9 A;  5GAN 6;  3L4G B;  1HSQ A;  2C06 A;  4P75 A;  2K3Y A;  3A98 A;  2M1H A;  1IHV A;  2RHZ A;  5GAM h;  2WSE E;  4YRG A;  3FEO A;  3VRY A;  2LCL A;  5EG2 A;  2CH4 A;  2KYM A;  2ESW A;  2GTO A;  1KQS S;  4II1 A;  3CMA A;  1U5S A;  3OSV A;  3C0C A;  1AZE A;  1N6A A;  5IHI A;  2J3L A;  2Z0W A;  3MEA A;  2IG0 A;  4EMK B;  2RHS A;  4M7A A;  2ZZD A;  2QQB A;  1QVF S;  4YRT A;  1BCM A;  2H3E B;  3JCM d;  2DL8 A;  3NPF A;  1BIA A;  5K1X A;  2D8J A;  1V29 B;  2C8M A;  2FRY A;  3A8M B;  3CCE Q;  2RD1 A;  1KMM A;  1TOV A;  4G85 A;  2ZGW A;  3KXT A;  1X6O A;  1OPL A;  3VQX A;  4CRI A;  5GMK i;  3SHW A;  1GFC A;  2EQI A;  1KC8 U;  3M0S A;  3W3S A;  2FPD A;  3HP9 A;  5GAO r;  1UB4 A;  4P5N A;  4ZNX A;  3RKX A;  3CC7 A;  4LD9 K;  2JT4 A;  4PJO E;  5IHN A;  5KYW A;  4PJN A;  3JCM c;  5ELN A;  4C92 E;  4MZT A;  5GAO q;  1G5H A;  3OB9 A;  2K2V A;  3M57 A;  3OD1 A;  2OTL T;  1QWF A;  2ATC B;  1AWX A;  1V76 A;  2G6F X;  1M8V A;  1VQL A;  2KMT A;  3G7Z A;  3V7C A;  1YIT A;  3I55 A;  1N5Z A;  4QQG A;  1I0C A;  1T0H A;  2EKO A;  2ZTG A;  1N8R C;  3RL6 A;  1PSF A;  2O01 E;  1AHJ B;  1MUZ A;  4A4K A;  4WJ4 A;  2O31 A;  3BJU A;  4J7F A;  3C94 A;  3CMQ A;  3G71 Q;  3M58 A;  4BI4 A;  1ZX6 A;  4M77 A;  3F70 A;  4DBH A;  2ZZF A;  3LC0 A;  1UGS B;  4IUP A;  2QEX A;  4AMC A;  1YJN Q;  3M0R A;  4Z02 A;  4YRE A;  4A63 B;  3S3O A;  3IKM B;  2LDM A;  3QZ5 B;  1OX9 A;  5M9O A;  1FYF A;  2HAX A;  1Q7Y C;  2LRQ A;  3WVE B;  4C8Q C;  2QHV A;  2O9V A;  2RQR A;  1KMN A;  3ER0 A;  2L5Q A;  4RDX A;  4O5V A;  4ELY C;  2ZIO A;  1OEB A;  3MQZ A;  1YI2 T;  2RJF A;  4YRQ A;  3QNE A;  2FL7 A;  2JVV A;  1WHK A;  2BZ8 A;  3VQY A;  3OYA A;  1VQ8 T;  5KYX A;  3CD6 A;  2RNA A;  1VA7 A;  1KQ2 A;  2Q5H A;  3SDZ A;  1YJ9 Q;  1IGU A;  1RI0 A;  4EMH A;  1VQ6 A;  4YCW A;  2PMF A;  4PNO A;  5LJ3 d;  2QA4 A;  3OYY A;  5CKH A;  1QLY A;  1D1C A;  3CC4 T;  1D0Y A;  1PRM C;  2E4H A;  2GGR A;  4H2X A;  3M53 A;  2MCN A;  2DER A;  5FU6 C;  2DJZ A;  5GAN j;  2V1R A;  4OB2 B;  3M4G A;  2F5T X;  2CGH A;  4C92 F;  4C8Q B;  5LJ5 j;  3VS2 A;  4R55 A;  1VYU A;  3QO3 A;  4IUQ A;  2GF7 A;  2AIR B;  2DBM A;  2EAY A;  5I2S A;  2JTE A;  4K87 A;  3UH0 A;  3EFR A;  1R0C B;  2L2P A;  4KRT A;  3CXC A;  2KXC A;  4N4I A;  4J9I A;  4RG8 A;  3J81 E;  4YRM A;  4M75 E;  2QQS A;  3EHR A;  2CDT A;  4E6R A;  3G4S Q;  2CH4 W;  1Q86 C;  5GAM d;  1X6G A;  4KGZ B;  2A7Y A;  1WA7 A;  3G1Z A;  1M90 R;  2E5Q A;  3MF1 A;  2D6F A;  3V7R A;  2I0N A;  3PT9 A;  3CCM Q;  3VS0 A;  1BBZ A;  2COW A;  2E3I A;  3CC2 T;  1QW1 A;  1B34 A;  3DKM A;  1VQ9 T;  3CXC S;  4M7A E;  1BB9 A;  4E7L A;  5FU6 B;  2HBP A;  3SB2 A;  1QVG A;  2DU7 A;  2Q7G A;  3JB9 D;  4P74 A;  3WQZ A;  4E7J A;  2RK1 A;  1K9M C;  2GCX A;  2ARU A;  4Y92 A;  1VQ7 Q;  4EX5 A;  2E5K A;  4BWA A;  1Z9Z A;  5GAN e;  3C95 A;  4H02 A;  1EIF A;  5LJ5 e;  2RA2 A;  4QVD A;  1SET A;  2LMJ A;  4CS4 A;  2HNI A;  3FLG A;  2X51 A;  2O4X B;  4C5G A;  2L3Q A;  4MMK A;  2DKG A;  2V1Q A;  1Y96 A;  2P5I A;  2XIC A;  4HVU A;  1ZA1 B;  3HSB A;  2OTJ T;  2ZZG A;  1BU1 A;  2LC4 A;  4J9D A;  4EIK A;  4C0G A;  4P73 C;  2R58 A;  4JDS A;  2CUB A;  5IAY A;  1UHC A;  3VJP A;  2XDP A;  3LGL A;  2KGT A;  1OU8 A;  1VQO Q;  4PJO G;  2PUO B;  2B8A A;  4OGC A;  2K6D A;  4HCK A;  4FU6 A;  1IHW A;  1VQM Q;  3R6N A;  1Q7Y U;  2E70 A;  2CZ1 B;  3CME A;  2PTK A;  2RHX A;  2HMA A;  2EQU A;  4J9G A;  3SWN C;  3ZEH A;  2CJB A;  2MIO A;  4OMQ A;  3CCV A;  2RN8 A;  5KE3 A;  4M77 E;  1YFT A;  4M7D F;  3V8J A;  2Y90 A;  2GQI A;  4AFZ C;  1BI0 A;  1VQL T;  4X1V A;  2BKD N;  3WXM B;  4AG1 C;  3FRN A;  2RHY A;  1QKX A;  3I9Q A;  5GMK l;  2DXB A;  5A2Q E;  4LVK A;  3VS6 A;  2HZY A;  3SFM A;  4C8Q G;  3A5Z B;  1VQP T;  3CBM A;  1C0M A;  4F7U B;  2RI3 A;  1M2O A;  1WX6 A;  2CSI A;  2EYQ A;  3P8B B;  1FMW A;  1NG2 A;  5CAI A;  2KI7 A;  1YHQ Q;  1JXM A;  1NYG A;  2ART A;  1KC8 R;  4OLF A;  2RO0 A;  3GIB A;  2DXU A;  3QII A;  3JCM P;  2DRM A;  4VUB A;  3SWN B;  2JS2 A;  3CCR T;  4E2F B;  3CCQ Q;  3OW2 P;  4E7S A;  1ZQ1 A;  2DFU A;  1M1G A;  3GNG A;  1SRY A;  4JJN K;  2YWW A;  4ESR A;  2KRO A;  2G4C A;  1RAI B;  2KNB B;  3CC7 Q;  1LJO A;  4KQE A;  2EBP A;  4RQE A;  2RHQ B;  1WYX A;  2NLU A;  3E9G A;  2X3X D;  2E5A A;  3PVQ A;  3CCS T;  2H3J A;  1LNX A;  2IVW A;  4UPA A;  2IPO B;  1M30 A;  2X4W A;  5F5W A;  2QHT A;  4JS4 A;  2DF6 A;  2RQV A;  3VU3 C;  1K9M U;  1B3Q A;  1M3B A;  5AYF A;  2CKK A;  1JXO A;  2RJC A;  5A0G A;  1YIT Q;  2DEU A;  2DK3 A;  2F69 A;  3I55 Q;  1H3Z A;  4A4H A;  1NEG A;  3PVL A;  1GXI E;  1AEY A;  3EG1 A;  4F7U F;  3M4Q A;  1ZHI A;  1ARK A;  1PKT A;  1VYV A;  2DYI A;  4M75 G;  1GGM A;  1ZSZ C;  4ANJ A;  4QVC A;  5KYU A;  5LJ3 j;  2QI2 A;  4WI1 A;  3G71 A;  2QXF A;  4P3O A;  3MET A;  1KD1 R;  2V26 A;  1U06 A;  1K8A C;  3UF4 A;  2ZZE A;  3FJ5 A;  2QEX Q;  2JS0 A;  4RTY A;  2DQ0 A;  1JQQ A;  3TCJ A;  1MMG A;  2P84 A;  3NTI A;  4CS2 A;  1FMV A;  2ZAE A;  4EPC A;  2HKQ B;  1D1B A;  4M7A G;  2C0O A;  2FPE A;  3AHU A;  1TG0 A;  4LVI A;  3LLR A;  2RPN A;  4HT8 A;  2AKK A;  4LUD A;  3HRK A;  2HL5 C;  4YYE A;  2COY A;  1YJ9 A;  5GAN 5;  2DLP A;  4KBM B;  2KY9 A;  2M16 A;  4UP7 A;  1UJ0 A;  3HXX A;  1ADY A;  2EQJ A;  2Q5I A;  2EL9 A;  2EYX A;  1LYL A;  2K5I A;  2EGE A;  2AMC A;  2LVM A;  4RCC A;  4PFZ A;  1SF9 A;  5LJ3 e;  1OPK A;  5HY6 A;  3THK A;  3T9N A;  4TVW A;  3AT1 B;  3QZ9 B;  3JCM V;  4E47 A;  3E1S A;  3MKD A;  2DBK A;  5CVI A;  1H92 A;  4YRS A;  2CYZ B;  4PJO D;  4DOV A;  3FDR A;  1D0X A;  3E9F A;  5CQX A;  1M2V A;  3RR6 A;  5GAN f;  3VQW A;  1TUC A;  3H0H A;  5LJ5 f;  5GJW B;  3JCM g;  1H4S A;  4HCC A;  1BK2 A;  2EVR A;  2MI6 A;  2LJ1 A;  3TVT A;  2QTV A;  1OYX A;  4YRR A;  2FZG B;  2LNH B;  4AFU C;  4PJM A;  2E6Z A;  2KYB A;  3CME T;  2DQ3 A;  3A1P A;  4DEX A;  3V8L A;  3REU A;  1JBM A;  3CCJ Q;  3CCU Q;  1U8R A;  2HSE B;  1TU0 B;  2R5A A;  2EGC A;  2EQM A;  3REB B;  1KHI A;  2SEM A;  2J6O A;  3JAM E;  1FMK A;  4L59 A;  1X43 A;  1N9W A;  2ROL A;  4HKE A;  2ZIM A;  3DSQ A;  1VQ7 A;  2XMF A;  3HPW A;  3IQL A;  4KT0 E;  2QDL A;  3OYN A;  2BTT A;  1MND A;  2QHU A;  1WQ7 A;  2LP5 A;  1H4Q A;  2HL3 A;  2RHU A;  2R5M A;  1PC0 A;  1PCX A;  1B07 A;  2EW3 A;  1X2H A;  1G3Y A;  1AWW A;  4JLI A;  1XNI A;  4YRJ A;  2KEA A;  1Q7Y R; 
#chains in the Genus database with same CATH homology
 4CH5 A;  1VQ5 T;  3UGT A;  4QVZ A;  4M78 F;  1VQN T;  4TVA A;  4V2S A;  4ZGD B;  3CCE T;  4UP8 A;  3QDR B;  3OYF A;  1VQO A;  2J3M A;  1WYD A;  1YJW T;  4KUI A;  3R07 A;  1VQM A;  3ERR A;  2A8E A;  2AKW B;  3VV0 A;  1FWZ A;  1VIE A;  3CEY A;  1E1O A;  3A7R A;  4YRI A;  2M9U A;  3X28 B;  4M7D A;  4D6W A;  4RG2 A;  1EVL A;  3JB9 G;  2E6N A;  2FVU A;  4BI3 A;  1EFW A;  1YFS A;  4CH3 A;  4YPF A;  4M75 D;  5LJ3 g;  3DB3 A;  1I8F A;  1BYM A;  3LYI A;  4G84 A;  4HWO A;  4J6X A;  3LGF A;  2BIV A;  1YHQ A;  4KUL A;  2M0O A;  3M54 A;  3LX7 A;  3CPW A;  1YJN T;  1E1T A;  1BKB A;  4M7A D;  2LT1 A;  3CCQ A;  1NJI C;  5A0D A;  3VYG A;  2E64 A;  3H8Z A;  4JRP A;  4ZTJ A;  5GAM g;  4C5I A;  3OYL A;  4P71 C;  1EVK A;  2D0Q B;  4NS5 A;  4PJO C;  3CPW S;  1D3B A;  4XEM A;  4PLL A;  2ODR D;  1S72 T;  4MDW A;  4C92 C;  2ZPB B;  2PQW A;  2ALY B;  3QYH B;  3C12 A;  4ME7 A;  2IY5 B;  4LDW A;  4N0A A;  1VQ4 T;  3HFZ B;  4F7U A;  5CCA A;  3HRS A;  3OW2 A;  4J8O A;  1M1K U;  1O9S A;  2CZ7 B;  3RKY A;  3PFS A;  2DDZ A;  2CZ6 B;  5KCO A;  2WSC E;  4O6J A;  4QW2 A;  4BE1 A;  2DXT A;  3G4S T;  2LNV A;  4H2U A;  2KVQ G;  2VXF A;  4M77 D;  4PJO B;  1NJ6 A;  3VQV A;  4ZTZ B;  4E7I A;  1KD1 U;  3PCO A;  4ELZ C;  3UGQ A;  3DLM A;  2JTM A;  2RHI A;  4B9W A;  5CIU A;  3CCM T;  3OW2 S;  3JCM J;  3PZC A;  5DY9 A;  5CKF A;  5L8R E;  3S3M A;  4C5E A;  1B7Y A;  3OYG A;  1N9R A;  1VQ7 T;  5HGQ A;  3CPF A;  3MP6 A;  2HD0 A;  5DLQ E;  3WVD B;  2ZT5 A;  3HXV A;  2QQA A;  1KG1 A;  3MP8 A;  2X35 A;  2G3R A;  1USY C;  1BIB A;  5CKD A;  3MP1 A;  4KR2 A;  3JRZ A;  3OYK A;  1K73 C;  2OAU A;  1M5Q 1;  2FHD A;  3A5Y A;  2DTH A;  1J5W A;  2EWN A;  1VQK T;  3CBO A;  3JCM b;  1EIY B;  1Q81 C;  1NPP A;  3TEH B;  2X4Y A;  2DPP B;  4TVY A;  2I4L A;  1VQO T;  4M7D E;  2CZ0 B;  1VQM T;  3OYD A;  4E7H A;  3HXW A;  4M75 C;  1WJQ A;  2GFA A;  3ZFJ A;  4P75 C;  3I56 A;  4XAX B;  5DM7 R;  4MDX A;  2VGN A;  4P72 A;  3CCJ A;  3CCU A;  2MMP A;  4QQ6 A;  2PVD B;  3HRI A;  2E1H A;  5D6X A;  3IG2 A;  3REX A;  1X01 A;  4M7A C;  3VUZ A;  3X20 B;  2CIM A;  1JB0 E;  4C8Q F;  3L1A A;  2ZT6 A;  11AS A;  3CMA T;  1N8R U;  5GMK j;  4M75 B;  2AHJ B;  3A7A A;  2JN0 A;  4ZN3 A;  4YRN A;  4TTV A;  1QVG S;  2XI9 A;  1Y7X A;  2ODR C;  2LT4 A;  4XTY A;  4M78 A;  1NNH A;  2RB6 A;  1ADJ A;  2VC8 A;  3HHT B;  4J6W A;  4C92 G;  3KBG A;  3CC7 T;  4NL2 A;  5I2M A;  4M7A B;  2YHT A;  1B8A A;  3GPL A;  2KDS A;  4F7U E;  3FB9 A;  2I4O A;  1Z7N A;  3JCM X;  4A53 A;  3KUF A;  3P8D A;  4YRL A;  4RCB A;  2K57 A;  4N0A C;  4JRQ A;  3HXY A;  4LDV A;  3QPH A;  1B70 B;  3PIP A;  2JUF A;  3NEL A;  3JB9 H;  3UFG A;  4ZGJ B;  4CS3 A;  3A74 A;  1PYS A;  2R57 A;  3HXU A;  4M77 C;  1YIT T;  3I55 T;  4RMF A;  3M55 A;  4P3N A;  5C53 B;  3HL8 A;  5GMK e;  5CKB A;  4YCU A;  1X2G A;  2DTO A;  3A31 A;  4JUV A;  3M4Y A;  2VXE A;  2X4X A;  4LVL A;  1NE8 A;  2QEX T;  1M9S A;  2ARS A;  3BDU A;  3CCL A;  5CK9 A;  3LWH A;  2FYK A;  3VBB A;  5GAO l;  3JCM e;  4C5H A;  4E7K A;  5J26 A;  5KH6 A;  1Q86 U;  4NOY A;  2DU5 A;  4XTZ A;  4M77 B;  1X56 A;  5GAN h;  2YLB A;  5LJ5 h;  3UT1 A;  3CD6 T;  4PHC A;  1JJC A;  1H64 1;  4OB3 B;  2P4T A;  1VQ6 T;  3UPU A;  3L4G A;  1YBY A;  4PL6 A;  3M59 A;  2QA4 T;  4MZP A;  4YDQ A;  4DQ2 A;  3OBY A;  4UC4 A;  3OSS C;  3S3N A;  3OYB A;  3A8H B;  4JS5 A;  1M90 C;  1XQH A;  3JCM Q;  4WF2 A;  4EMK A;  4IUU A;  3HFN A;  4FSX A;  4M7D G;  4YRO A;  1G3T A;  4KUD K;  2K3X A;  3PIO A;  1I5L A;  1X75 C;  1HTT A;  4TQD A;  1VUB A;  1UGR B;  1YB3 A;  3DB4 A;  4H2X B;  2RI2 A;  4FT2 A;  1PSE A;  2VGM A;  2QTX A;  4YP0 A;  4P74 C;  1XOV A;  5HKC A;  1SER A;  2ZXF A;  4KR3 A;  3GLX A;  3HRT A;  3LSS A;  2ZR3 A;  4QQD A;  3VKI A;  3IKL A;  4DPG A;  3BDL A;  4K88 A;  4ATO A;  3RF1 A;  5GAM j;  2PVG B;  3DLL A;  1Q82 C;  3A32 A;  2ALY A;  4IUR A;  3ZBD A;  1BBU A;  4Q6G A;  4M78 E;  2IY5 A;  12AS A;  3V7S A;  3PNW C;  5D6Y A;  4XU1 A;  4HT9 A;  4J6Y A;  3QG1 A;  1UGP B;  1YIJ A;  3OYJ A;  4H2S A;  1ZBX A;  3FJP A;  1H4V B;  1B34 B;  5LL6 S;  2EJ9 A;  4Q5W A;  2OTL A;  3QTC A;  4OB1 B;  4A4E A;  4NCX A;  1NZ9 A;  4PLI A;  4EDU A;  4AH6 A;  3OYE A;  3TU4 K;  4C92 D;  2ZPG B;  1U1S A;  2DZC A;  4OMF B;  2LQ8 A;  2XID A;  3X24 B;  3M5A A;  2DZ9 A;  5DLO A;  4M77 G;  3INZ A;  1YGB A;  5GAM e;  3E19 A;  5GAN 7;  3TUP A;  1HXD A;  3CCV T;  1KC8 C;  2I4N A;  4BAC A;  1BI2 A;  1JJ2 A;  4P3P A;  1BI1 A;  4LVM A;  3G6E A;  3JB9 F;  2CJ9 A;  3OYH A;  5FRO A;  1YI2 A;  4XEO A;  2E10 A;  1VQ8 A;  3HXZ A;  1UEB A;  4C8Q A;  4EMG A;  5GAN d;  2ZT8 A;  4OF1 A;  3QO8 A;  1EIY A;  4FT4 A;  3EAE A;  1NJ2 A;  1YCY A;  2PVO B;  3MEW A;  3PGG A;  1JJ2 S;  3CC4 A;  3KFU A;  3OA6 A;  2P0L A;  2ZPH B;  2FB7 A;  3RUX A;  1K8A U;  2E3C A;  2RK2 A;  4DA4 A;  2I4M A;  1Y71 A;  5GMK m;  2V8I A;  3P8T A;  4YCV A;  1L0W A;  1SSF A;  5KCH A;  3PMI A;  2D9T A;  1IL2 A;  2X4J A;  5LJ3 h;  4JRI A;  1N9S A;  1NPR A;  1H4T A;  3MF2 A;  4MML A;  3RKW A;  1G51 A;  5CKE A;  3JCM f;  5GAO m;  1X55 A;  4XTU A;  1NYQ A;  4JLG A;  1KQ1 A;  3MEY A;  4DOW A;  3GF5 A;  5CQY A;  2O4X A;  4M7D D;  2RI5 A;  2MWO A;  3A8O B;  4XTX A;  1SES A;  4J5Y A;  2JOY A;  3CC2 A;  1VQ9 A;  4ZIB A;  4ZTU B;  3G71 T;  5C6S A;  3HFO A;  1JRI A;  4J83 A;  4ZN1 A;  4BY6 C;  3JB9 I;  3RES A;  1HK9 A;  1E22 A;  1E24 A;  4MZM A;  3P8V A;  4J7I A;  2PUK B;  2CS7 A;  3M9Q A;  4BW9 A;  5CR2 A;  4XU3 A;  2LCC A;  2OTJ A;  1B70 A;  4M78 G;  1MGQ A;  1YJ9 T;  2V8K A;  1HC7 A;  2A3L A;  4BDY A;  2PME A;  4FIB A;  3TEE A;  2XDD A;  5IT9 E;  3L2R A;  5FRM A;  1X54 A;  4J15 A;  4BY6 B;  2LQK A;  1YFR A;  2HQE A;  3E9I A;  1W66 A;  3OY9 A;  4P73 A;  1YIJ T;  2K5L A;  5D6W A;  3A5Z A;  4C0Z A;  4OGE A;  4FL6 A;  5GAN 3;  4H2V A;  1OZ2 A;  3J80 E;  4BE0 A;  5C51 B;  5IN1 A;  3RIR A;  4TQF A;  1IZ6 A;  3I7F A;  4IUV A;  2I2L A;  4CH4 A;  3S6W A;  2VUB A;  1EOV A;  1R8O B;  3SWN A;  2AMC B;  4TWA A;  3LW5 E;  2KAF A;  2RJE A;  3TRE A;  1VQP A;  1LOJ A;  5LJ3 f;  1P92 A;  1UGQ B;  4C92 B;  4YRF A;  2BUD A;  2L8D A;  2RHQ A;  1OI1 A;  4C8Q E;  1NJ5 A;  3BW1 A;  4CH6 A;  2YLC A;  1WQW A;  1WGS A;  4RKU E;  3EFS A;  4GLK A;  3CCR A;  3QSU A;  5KNN A;  1RL2 A;  3G6E T;  1C0A A;  2E12 A;  1WU7 A;  3MEV A;  2L89 A;  1B76 A;  2JZ2 A;  3RGL A;  5GAM f;  5C0M A;  4HWS A;  3IAL A;  3RMQ A;  3CCS A;  3NFC A;  3FIF A;  5FLX E;  1QF6 A;  1ATI A;  3QO5 A;  4L6V 5;  1RIQ A;  2KQW A;  4PJO F;  1MHN A;  2XHC A;  3FC3 A;  3QHS A;  4X9D A;  3QUI A;  3A7U A;  2ZCE A;  4WJ3 M;  4XTW A;  5GAO p;  4M7D C;  2QDY B;  2DIQ A;  2MAM A;  1NJI U;  1NYR A;  3BY7 A;  5K1P A;  3OS2 A;  2ZT7 A;  3M56 A;  4XQ3 A;  4TVA B;  3OQ5 A;  4X9C A;  1M4Z A;  2Q7E A;  4Q15 A;  5GAO n;  2XGT A;  3OMG A;  3NEN A;  3OMC A;  1OZ3 A;  3L2Q A;  4BD3 A;  2XD0 A;  4LDY A;  4N4H A;  4L87 A;  3NTK A;  2XK0 A;  2P0P A;  2RH2 A;  2QQR A;  2LTO A;  3HY0 A;  4X5O A;  1YHQ T;  4C0D C;  5J39 A;  4M7D B;  3L2U A;  2ZPI B;  1O75 A;  4BE2 A;  2WSF E;  2ZR2 A;  3QYG B;  3CCQ T;  4Y28 E;  3JCM W;  2JTF A;  4LVJ A;  3UWN A;  5FU7 C;  2DD4 A;  3JB9 J;  2EQK A;  5ELO A;  1BBW A;  4M78 D;  1G3W A;  2L3R A;  2XU8 A;  3L42 A;  2RHS B;  4BDZ A;  2EIF A;  3M4P A;  1NJ8 A;  2VYT A;  3GP8 A;  1WJR A;  4LDX A;  4ZTF A;  4O2D A;  2DTI A;  2EJF A;  4X34 A;  1WJS A;  4C0D B;  1BI3 A;  4IUT A;  1I81 A;  2XKO C;  4E51 A;  1XTD A;  4YRK A;  3PTA A;  1ASY A;  3QBY A;  3MCA B;  4UP9 A;  4XTV A;  3QO7 A;  3SD4 A;  4JRK A;  4M75 F;  2JNG A;  3MEU A;  4BB7 A;  1D3B B;  1K73 U;  3QKJ A;  5FU7 B;  2MWP A;  2EJG A;  4HCZ A;  4RMO A;  3HRU A;  4ZGE B;  4Y91 A;  3ME9 A;  4C0F A;  1Q81 U;  3X25 B;  3VUB A;  2XTI A;  2Y4Y A;  2AKW A;  3HFV A;  4M7A F;  4EO4 A;  3ASK A;  1TH7 A;  4N4G A;  3HTZ A;  2QQ9 A;  4B9X A;  2RJD A;  1VQ5 A;  3HKS A;  1G3S A;  3OS0 A;  1VQN A;  3GOX A;  3CCE A;  2DXC A;  3NET A;  2XG8 D;  1W4S A;  4BUG A;  2ZCF B;  1YJW A;  4HWP A;  4RQF A;  4H2W A;  4NL3 A;  3R6O A;  2ZPE B;  4XK8 E;  3PCO B;  3VYH B;  1ASZ A;  5J3B A;  2C7I A;  2K5F A;  2ZNJ A;  3RAC A;  3TEG A;  3OS5 A;  3LSQ A;  2KK4 A;  1B7Y B;  3OBW A;  3OS1 A;  3O8V A;  1DJ7 B;  1G5I A;  2DD5 A;  5GAN g;  2MF2 A;  3JSC A;  5LJ5 g;  4P72 C;  2VV5 A;  4HVC A;  2DO3 A;  4K86 A;  2EFI A;  2KSS A;  1NJ1 A;  4CI0 C;  4FM4 B;  4GY5 A;  4M77 F;  2P0Q A;  4H2T A;  4A4F A;  4HT4 A;  3I56 T;  3E9H A;  3V8K A;  4OVA A;  2DIG A;  1YJN A;  5CO7 A;  3OYM A;  3CCJ T;  3CCU T;  2Y4X A;  2QHS A;  1IRE B;  2K4Y A;  1N27 A;  5GMK h;  3GNF B;  4HCB A;  4A54 A;  4LDU A;  5HK0 A;  2GQV A;  5FRN A;  1VQZ A;  1FXX A;  4LD6 A;  4YRP A;  2RM4 A;  3CBP A;  4XU0 A;  4YTL A;  4LNS A;  5A0L A;  3HFZ A;  3P8H A;  4M78 C;  1G5V A;  3MHX A;  3JCM h;  3UDC A;  1S72 A;  4BI8 B;  1QP2 A;  4P71 A;  2E65 A;  2F5K A;  4HA8 A;  4R56 A;  1KHC A;  1WPY A;  4PJO A;  1I4K 1;  1VQ4 A;  2LX9 A;  4F7U G;  1W2B A;  4HWR A;  4C92 A;  4PG3 A;  3LWI A;  3X26 B;  1QE0 A;  3OYC A;  1Y96 B;  4IKF A;  2NS6 A;  1Y07 A;  2V8J A;  3QJ6 A;  3N5B B;  5GAN 4;  4M78 B;  3G4S A;  1Z7M A;  4YRC A;  3A8G B;  4TVR A;  2DAQ A;  2ZNI A;  3MO8 A;  3C4S A;  3A8L B;  1VIF A;  2DEQ A;  1W2B S;  3HY1 A;  3NTH A;  1WNL A;  3Q1J A;  3CCM A;  2PU9 B;  1KOG A;  3QXE B;  5E3I A;  5LJ5 d;  1M90 U;  2XDB A;  2P0K A;  3P8Y A;  3RER A;  4H2Y A;  3L2V A;  3TEH A;  1PYS B;  2HQX A;  4C8Q D;  3CCL T;  2ZIN A;  2ZPF B;  1M1F A;  5C52 B;  3J7A F;  4HWT A;  3L2W A;  5I21 A;  1M1K C;  4L5G A;  3NEM A;  1EQR A;  4PKC C;  3QJY A;  1VQK A;  1FX7 A;  4A4G A;  2YRV A;  5GAN 2;  3ICA A;  5KE2 A;  1USY A;  2CJA A;  4XU2 A;  2Q7H A;  4OP0 A;  5HK3 A;  1KD1 C;  3BFM A;  2DVE A;  4EMK C;  2GFU A;  3OYI A;  4OB0 B;  1Q82 U;  1U1T A;  2WAC A;  2E41 A;  3LH0 A;  3L2Z A;  1KQS A;  3PMT A;  1QP3 A;  1WLE A;  3RMS A;  3URG A;  1QVF A;  1JJC B;  1QVP A;  3H6Z A;  4M75 A;  5GAN 8;  5GAN 6;  3L4G B;  4P75 A;  2C06 A;  2K3Y A;  2M1H A;  2RHZ A;  5GAM h;  2WSE E;  4YRG A;  3FEO A;  2LCL A;  5EG2 A;  1KQS S;  4II1 A;  3CMA A;  3OSV A;  1N6A A;  2J3L A;  3MEA A;  2IG0 A;  4EMK B;  2RHS A;  4M7A A;  2ZZD A;  2QQB A;  1QVF S;  4YRT A;  3JCM d;  1BIA A;  5K1X A;  1V29 B;  2C8M A;  3A8M B;  1KMM A;  2RD1 A;  4G85 A;  2ZGW A;  3KXT A;  1X6O A;  3VQX A;  4CRI A;  5GMK i;  1KC8 U;  3W3S A;  5GAO r;  3HP9 A;  1UB4 A;  4P5N A;  3RKX A;  3CC7 A;  4LD9 K;  4PJO E;  3JCM c;  5ELN A;  4C92 E;  4MZT A;  5GAO q;  1G5H A;  3OB9 A;  2K2V A;  3M57 A;  3OD1 A;  2OTL T;  1M8V A;  1VQL A;  2KMT A;  3G7Z A;  3V7C A;  1YIT A;  3I55 A;  4QQG A;  2EKO A;  2ZTG A;  1N8R C;  3RL6 A;  1PSF A;  2O01 E;  1AHJ B;  4A4K A;  4WJ4 A;  3BJU A;  4J7F A;  3C94 A;  3CMQ A;  3M58 A;  4BI4 A;  4M77 A;  3F70 A;  2ZZF A;  3LC0 A;  1UGS B;  4IUP A;  2QEX A;  4Z02 A;  4YRE A;  3S3O A;  3IKM B;  2LDM A;  3QZ5 B;  5M9O A;  1FYF A;  2HAX A;  1Q7Y C;  2LRQ A;  3WVE B;  4C8Q C;  2QHV A;  1KMN A;  3ER0 A;  2L5Q A;  4RDX A;  4O5V A;  4ELY C;  2ZIO A;  3MQZ A;  1YI2 T;  2RJF A;  4YRQ A;  3QNE A;  2FL7 A;  2JVV A;  3VQY A;  3OYA A;  1VQ8 T;  3CD6 A;  1KQ2 A;  2Q5H A;  3SDZ A;  1RI0 A;  4EMH A;  1VQ6 A;  4YCW A;  2PMF A;  4PNO A;  5LJ3 d;  2QA4 A;  3OYY A;  5CKH A;  3CC4 T;  4H2X A;  3M53 A;  5FU6 C;  2DJZ A;  5GAN j;  4OB2 B;  3M4G A;  2F5T X;  2CGH A;  4C92 F;  4C8Q B;  5LJ5 j;  4R55 A;  3QO3 A;  4IUQ A;  2GF7 A;  2EAY A;  5I2S A;  4K87 A;  3UH0 A;  3EFR A;  3CXC A;  4N4I A;  4RG8 A;  3J81 E;  4YRM A;  4M75 E;  2QQS A;  1Q86 C;  5GAM d;  2A7Y A;  3G1Z A;  2E5Q A;  3MF1 A;  2D6F A;  3V7R A;  3PT9 A;  3CC2 T;  1QW1 A;  1B34 A;  3DKM A;  4M7A E;  1VQ9 T;  3CXC S;  4E7L A;  2Q7G A;  5FU6 B;  2HBP A;  3SB2 A;  1QVG A;  2DU7 A;  4P74 A;  3JB9 D;  3WQZ A;  4E7J A;  2RK1 A;  1K9M C;  2GCX A;  2ARU A;  4EX5 A;  4BWA A;  5GAN e;  3C95 A;  4H02 A;  1EIF A;  5LJ5 e;  2RA2 A;  4QVD A;  1SET A;  4CS4 A;  2HNI A;  3FLG A;  2O4X B;  4C5G A;  4MMK A;  2DKG A;  1Y96 A;  2P5I A;  2XIC A;  3HSB A;  2OTJ T;  2ZZG A;  2LC4 A;  4C0G A;  4P73 C;  2R58 A;  4JDS A;  5IAY A;  3VJP A;  2XDP A;  3LGL A;  4PJO G;  2PUO B;  2B8A A;  4OGC A;  4FU6 A;  1Q7Y U;  2E70 A;  2CZ1 B;  3CME A;  2RHX A;  2EQU A;  3SWN C;  3ZEH A;  2CJB A;  3CCV A;  5KE3 A;  4M77 E;  1YFT A;  4M7D F;  3V8J A;  2Y90 A;  1BI0 A;  1VQL T;  2BKD N;  3WXM B;  3FRN A;  2RHY A;  5GMK l;  2DXB A;  5A2Q E;  4LVK A;  3SFM A;  4C8Q G;  3A5Z B;  1VQP T;  3CBM A;  4F7U B;  2RI3 A;  3P8B B;  2EYQ A;  2ART A;  5CAI A;  4OLF A;  2RO0 A;  3GIB A;  2DXU A;  3QII A;  3JCM P;  4VUB A;  3SWN B;  3CCR T;  1ZQ1 A;  1M1G A;  3GNG A;  1SRY A;  4JJN K;  2G4C A;  1LJO A;  4KQE A;  4RQE A;  2RHQ B;  2NLU A;  3E9G A;  2E5A A;  3CCS T;  2H3J A;  1LNX A;  2IVW A;  4UPA A;  2X4W A;  5F5W A;  2QHT A;  4JS4 A;  3VU3 C;  1K9M U;  5AYF A;  2RJC A;  2CKK A;  5A0G A;  2DK3 A;  2F69 A;  1H3Z A;  4A4H A;  1GXI E;  4F7U F;  3M4Q A;  1ZHI A;  1GGM A;  4M75 G;  5LJ3 j;  4QVC A;  2QI2 A;  4WI1 A;  3G71 A;  2QXF A;  4P3O A;  3MET A;  1K8A C;  2ZZE A;  2DQ0 A;  3TCJ A;  3NTI A;  4CS2 A;  4EPC A;  4M7A G;  3AHU A;  4LVI A;  3LLR A;  4HT8 A;  3HRK A;  4YYE A;  1YJ9 A;  5GAN 5;  4KBM B;  2KY9 A;  2M16 A;  4UP7 A;  3HXX A;  1ADY A;  2EQJ A;  2Q5I A;  2EL9 A;  1LYL A;  2K5I A;  2AMC A;  2LVM A;  4RCC A;  5LJ3 e;  5HY6 A;  3T9N A;  4TVW A;  3QZ9 B;  3JCM V;  4E47 A;  3E1S A;  5CVI A;  4YRS A;  2CYZ B;  4PJO D;  4DOV A;  3FDR A;  3E9F A;  5CQX A;  5GAN f;  3VQW A;  5LJ5 f;  3JCM g;  1H4S A;  4HCC A;  2MI6 A;  1OYX A;  4YRR A;  2E6Z A;  3CME T;  2DQ3 A;  3V8L A;  3REU A;  1JBM A;  1U8R A;  2R5A A;  2EQM A;  1KHI A;  3JAM E;  4L59 A;  1N9W A;  4HKE A;  2ZIM A;  3DSQ A;  1VQ7 A;  3HPW A;  4KT0 E;  3OYN A;  2QHU A;  1WQ7 A;  1H4Q A;  2RHU A;  2R5M A;  1X2H A;  1G3Y A;  4JLI A;  1XNI A;  4YRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...