4XU2A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 87 with a 3'deoxy ribose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
264
structure length
262
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
molecule keywords Bifunctional ligase/repressor BirA
total genus 90
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu2A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu2A01
1X55A 4CS2A 2E5AA 2CJAA 2ZIMA 3A5YA 1USYA 2PMFA 4M77C 2HNIA 5C52B 1EOVA 4M78C 2DTHA 1LOJA 2ZGWA 3BY7A 4F7UE 4C8QA 4XEMA 2ZZFA 4M75B 2DJZA 1JJCB 5LJ3e 4M75D 3REXA 2C8MA 4YRGA 1EIYB 2RA2A 3NENA 4XTUA 2DKGA 4M77F 4TQFA 4DQ2A 2ARSA 4YRQA 4H2WA 1EVKA 1NJ8A 1U1SA 5GANe 3V8KA 1EQRA 3QUIA 3JCMf 3JCMd 3RL6A 4M78G 1HK9A 1B7YB 2ZT6A 4RQFA 2XGTA 3HFVA 5KNNA 4CS4A 4UP8A 1ADJA 1H4VB 3FB9A 4M75A 1BIBA 5CAIA 3MF1A 4M7AC 3HFNA 2AKWB 3HXYA 5GMKl 4M78B 3E9IA 4F7UF 4M7DE 3JCMh 4J6XA 3A7UA 11ASA 1JRIA 5HGQA 4M77A 4RCCA 1HC7A 1KMMA 3QO8A 4CS3A 4TVAB 2ZIOA 1YCYA 1BBWA 5GMKh 4P71C 3EFRA 3DSQA 3QSUA 4G84A 1NJ6A 4CH5A 3HXUA 2Q5IA 4PJOF 1B34A 4ZTZB 1KQ1A 3M4PA 3JCMQ 4YRRA 4YRPA 4MMKA 5C53B 1SRYA 2DU7A 2ZTGA 4F7UG 4MMLA 4TQDA 4YRCA 3PZCA 4V2SA 4CH3A 4E51A 3UGQA 3V7RA 2AMCB 4NCXA 4P3NA 1NJ2A 2QTXA 4M7AF 1ASYA 3NELA 1NYRA 4XTZA 2DU5A 2FB7A 4P73A 1E24A 1KMNA 4M77B 4KR2A 3V7SA 3JB9D 3SB2A 2ALYB 4C92A 1WNLA 2ZR2A 3MEYA 4P71A 5GAN2 1G5IA 3TUPA 3JCMg 2ZR3A 3RUXA 3JCMV 1WYDA 4L87A 3QNEA 4Q6GA 5LJ5j 4EMKA 3SWNB 2I4LA 2ZT7A 5ELNA 2RD1A 2IY5B 4YROA 5GAMf 4YDQA 2ODRC 4P74A 2DDZA 3GIBA 5GAOp 4TVWA 3JCMb 4EMKC 1N9WA 1X2GA 2EAYA 2ZT5A 2DQ3A 4DPGA 4M78D 4CH4A 4F7UB 1L0WA 2Q7HA 4M78F 4P72C 3W3SA 1SESA 3VQVA 1NNHA 4PJOD 4NL2A 2EJ9A 4XU0A 4M7AG 4P73C 2CJBA 3FIFA 2DVEA 5GAOl 4UP9A 4YRLA 4PNOA 4YP0A 1LJOA 3HY1A 2YLCA 1B7YA 5LJ3j 1WQWA 5GAN4 4XTXA 4YREA 3JCMX 5GANh 1I5LA 4M7DA 3QHSA 3RACA 1I8FA 2E64A 3RKWA 5DY9A 3RERA 3IALA 1B70B 4G85A 4JRKA 1LYLA 5LJ3f 3HXXA 3L2ZA 2DZ9A 3HSBA 1EIYA 1Z7MA 3FJPA 4YRMA 1B76A 2E10A 5F5WA 3L4GB 4UP7A 3NETA 4C8QG 5GAOn 1B34B 4PJOC 4Y91A 2C7IA 3QO5A 1TH7A 2ODRD 1HXDA 1NJ5A 5GMKe 1H4SA 5GAMe 2ZCEA 1I81A 5LJ3h 4YRKA 4RDXA 4YRFA 4EMKB 4TTVA 1MGQA 4YYEA 1YGBA 2DQ0A 3JCMJ 1JJCA 4XEOA 1G51A 2ZINA 4M7DC 1B8AA 4UPAA 1H641 1G5HA 4YRNA 1QF6A 3ERRA 3I7FA 3A7AA 3JCMW 12ASA 3HXWA 2RB6A 1RIQA 4CH6A 2YHTA 4EMGA 4C8QE 3A32A 4PJOE 4WF2A 2QHSA 5GAN5 1M8VA 2RHQB 4J6WA 5GMKj 1FYFA 3A5ZA 3HFZA 2YLBA 3JCMc 4HA8A 3TEHA 4M75G 4YRTA 3VQYA 4WI1A 4K88A 2DXUA 3IKLA 4PJOA 4AH6A 1NJ1A 3E9HA 1N9RA 2EJFA 3KFUA 2JN0A 4C92C 1WU7A 4PG3A 4M75F 1WPYA 4H2UA 3P8YA 3V8JA 5LJ5h 4H2TA 1Y96A 2FYKA 4H2YA 2ZZEA 5GAMg 4C8QB 2I4NA 4WJ4A 4M7DD 1YFRA 1VQZA 2G4CA 2E41A 4EMHA 5GANf 5K1XA 5GAMj 5GANj 4JLIA 3RKXA 3A74A 1H4TA 3NEMA 3CMQA 3VU3C 2DZCA 4YCUA 4X5OA 3G1ZA 5GAMd 4J15A 4EO4A 3JB9I 2ARUA 3R07A 4YPFA 4PJOG 3V7CA 4XTYA 4PHCA 3QO7A 2IY5A 2EJGA 4WJ3M 3JB9H 4NOYA 4A54A 4M75E 1HTTA 3UH0A 3HXZA 1E1OA 2QHVA 3RGLA 3PGGA 5GAOm 1PYSB 4K86A 1X01A 4JRIA 4KQEA 4H02A 1IL2A 4P75C 4RMFA 2DTOA 1SERA 1LNXA 2XTIA 5LJ3d 3V8LA 4ZIBA 3BW1A 4RCBA 3HXVA 2I4MA 3RKYA 2K57A 1QE0A 2ZXFA 4C8QC 4M75C 5GAN7 1W66A 1JBMA 2PMEA 4M7AA 4H2XB 4M7DF 5C51B 4XU1A 3JB9J 4M7AE 3L4GA 4JUVA 1ATIA 1PYSA 4RQEA 1H4QA 3QO3A 1E22A 4J6YA 1WLEA 3TEHB 4BW9A 1YFTA 1X2HA 2Y90A 3HRIA 3BDUA 2DTIA 3MF2A 4OP0A 1D3BA 5GAOr 5LJ5f 4P72A 1E1TA 3LSSA 1EFWA 4BWAA 4C8QF 1D3BB 4J5YA 4M77E 2Q7GA 3LSQA 1M5Q1 4YRJA 1ASZA 4M77D 4K87A 4C92D 2E1HA 4LNSA 2P5IA 4C92B 4QVCA 1USYC 5K1PA 3RIRA 4X9DA 4QVDA 1GGMA 3REUA 4PJOB 5ELOA 3QTCA 3SWNC 5GAMh 3JCMe 1YB3A 2RHSB 2ZNJA 3VBBA 3BFMA 5LJ5e 4YRSA 2CIMA 2I2LA 4XTVA 4M77G 2J3LA 3HRKA 5I21A 3AHUA 4NL3A 3EFSA 4P3PA 2RM4A 3WQZA 3JCMP 1X56A 3RESA 2EL9A 2AKWA 2J3MA 4M7DB 2ZT8A 4XTWA 3ICAA 3IG2A 2P0LA 4C92E 2VXFA 3A31A 4XU2A 4HVCA 3TEGA 4F7UA 5GAN6 4YRIA 1BBUA 3INZA 1ADYA 4TVAA 1I4K1 2RHQA 5E3IA 3HTZA 2ALYA 2VXEA 1KQ2A 1Z7NA 2DEQA 5GMKm 3OD1A 2RHSA 3BJUA 1SETA 4HWPA 3PCOB 2I4OA 1WQ7A 4HWTA 2Q7EA 4H2VA 1YFSA 5LJ5d 4N0AA 2AMCA 4C92G 4OLFA 3SWNA 5GANd 2EWNA 2E65A 2CJ9A 1B70A 3UGTA 4XQ3A 3HFOA 3HFZB 1J5WA 4M7AB 2E3CA 2QHUA 4H2XA 3JB9G 4HWRA 2ARTA 3VQXA 2ZNIA 4C8QD 3M4GA 2DXTA 4YCWA 4N0AC 4HWOA 2Q5HA 2ZZGA 4EX5A 4C92F 5GAOq 1Y96B 2CGHA 5GANg 4HT9A 3PCOA 4H2SA 2QHTA 3IKMB 3LC0A 5GMKi 4YCVA 2VC8A 3P8TA 4TWAA 4A53A 4O2DA 4Q15A 5GAN3 3HY0A 1KOGA 3M4QA 5LJ3g 4HT8A 4HWSA 4KR3A 1C0AA 4M78E 1N9SA 1U1TA 3L1AA 1NYQA 3VQWA 4M7AD 4XU3A 3P8VA 5GAN8 1EVLA 4P3OA 1X54A 4P74C 4TVYA 3UFGA 4M78A 4M7DG 3JB9F 3A7RA 3RF1A 4P75A 5LJ5g 4ZTUB 4X9CA 1BIAA
chains in the Genus database with same CATH superfamily
1WHMA 2DRKA 1N8RR 3A98A 4DBQA 2DEUA 3ZL7C 2RI5A 2NWMA 4M77C 2HNIA 1EOVA 4M78C 1W4SA 1QLYA 2ZGWA 1ZLMA 1B3QA 4LVJA 2DJZA 1JJCB 2QI2A 5LJ3e 1WX6A 1TUGB 4M75D 3S3NA 3X20B 2RA2A 4RUGA 3RDVA 5FLXE 1YI2Q 3M59A 2ESWA 4B6MA 3OYLA 5CQXA 1H3HA 2JTEA 1U1SA 5GANe 1NJ8A 3V8KA 3G6EA 2KRNA 1QP3A 2PVGB 3H9NA 2H3JA 3NFCA 5IT9E 2CSIA 1WHJA 4UP8A 1ZBJA 5I22A 3OW2A 3I55A 3VS3A 1NYFA 4QVZA 3SDZA 3QKJA 1FMKA 4F7UF 3CCMT 4M7DE 3EHQA 3QXEB 2P0QA 5CKDA 4J9DA 1VQ7T 1GFDA 2F1LA 2JNGA 2QXFA 1K1ZA 3M0TA 4J7FA 1M9SA 1NJ6A 3L2VA 2QK0A 1B34A 2HSEB 1KQ1A 2ECZA 3MEUA 1MUZA 2YUPA 3M4PA 2BKDN 1OX9A 2PVDB 4MMKA 4YRCA 4F7UG 2Z0WA 4V2SA 2E5QA 3UGQA 2KDSA 3QBYA 1Q82C 2DIGA 1NJ2A 2LQWA 1ASYA 3META 3VUZA 3NELA 1BU1A 2O9VA 5KCHA 1NYRA 2DU5A 4P73A 1E24A 2LQ8A 3EGDB 1YJ9Q 3CC7T 2ALYB 3F70A 2MAMA 3M9QA 3M0SA 2ZPGB 3M5AA 2HDAA 1PM3A 1UJ0A 4RTZA 4XK8E 3JCMV 1NEBA 4EMKA 4BI8B 4O5VA 2KGTA 4YROA 4B9XA 1YFNA 4ZGEB 1BKBA 4TVWA 3R6NA 5EG2A 1VQMA 1RAAB 4M78D 4K11A 2RN8A 3PE0A 2Q7HA 2LDMA 3VQVA 4PJOD 3E9GA 3HTRA 2EJ9A 3PVQA 4OGEA 4KUIA 4A4KA 2CJBA 3O5ZA 1UECA 1LJOA 3HY1A 4LDUA 1B7YA 1QCNA 3KFVA 5GAN4 2M51A 4YREA 4C5GA 3S6WA 4M7DA 1JU5C 2LCSA 3REBB 1OYXA 1BYMA 4ZGDB 3RNJA 3CMAQ 2E64A 3RERA 4RTYA 3HXXA 2XU8A 3OYBA 3VUBA 1EIYA 2A28A 1Y7XA 2FZKB 2RMOA 1VQ7A 3VJPA 5KE3A 3NETA 4KT0E 1FX7A 2V8IA 2YRVA 2RH2A 5GAOn 1B34B 3QDRB 1BCMA 2MOXA 4PJOC 4Y91A 2X4YA 4LXCA 3OY9A 3MPUB 5FROA 1BCOA 5GMKe 4YRKA 4YRFA 3CBMA 4EMKB 1IXDA 3CPWP 1YGBA 2DQ0A 1JJCA 1G51A 3H0IA 4UPAA 1OZ3A 4BDYA 4YRNA 3A7AA 3JCMW 3HXWA 5CQYA 3CCQT 2ATCB 2LNVA 4PJOE 4WF2A 3NPFA 5GAN5 2RHQB 4J6WA 1WJQA 1RI0A 3VQYA 4A4GA 4TVRA 4LVKA 1M3CA 4K88A 2DXUA 3CCMA 1OI1A 4C0DC 2BTTA 1UGSB 1RL2A 1AWJA 1K9AA 1PRLC 1XJWB 3KFUA 3LWIA 4ZTJA 3A8OB 4M75F 1WLPB 4H2UA 2K7AA 2M0YA 5D6XA 2LX9A 4II1A 2ZZEA 2PTKA 4BE1A 3MQZA 2EGCA 2XDPA 1VQ4Q 1VQZA 5K1XA 3EGDA 3CBPA 5AYFA 5GANj 1R77A 1OPLA 4JLIA 2DVJA 3GF5A 3LWHA 1M90U 2QGFB 1H4TA 4MZTA 2R5AA 3VS6A 1Y0MA 2ZAEA 1OPKA 2KVQG 2ARUA 4J9FA 3R07A 4YPFA 1G83A 3FRNA 2R5MA 4JJNK 2IY5A 3JB9H 4MZPA 4M75E 3EGUA 2HEQA 2FPFA 3C0CA 1E1OA 3ZFJA 3PGGA 4JRIA 4H02A 1IL2A 1KK7A 2XTIA 4GY5A 2DL5A 3BW1A 2KT1A 2K2VA 4RCBA 9ATCB 1IZ6A 4Y92A 1MV3A 1Y07A 4ORZA 4PJMA 4C5HA 2NUPB 2PNIA 1G3YA 4M75C 1WIEA 2CS7A 3UA6A 2PMEA 4Y28E 4LDXA 3E1SA 1T0HA 1X43A 5C51B 2LTOA 4XU1A 3A8LB 4M7AE 2L3PA 3S3MA 1ATIA 4PFOA 4HXJA 2M02A 3NTIA 4HCKA 1T0JA 3MO8A 4CC7A 1QWEA 4BD3A 4MDWA 3DLMA 4WTOB 4J5YA 3FJ5A 4M77E 1SHGA 3JAME 3GNGA 2JTFA 4M77D 1VQPT 2NLUA 3VYHB 4C92D 3TQ7P 3CCRA 1USYC 4BY6B 2NUTB 5IN1A 4DEXA 1AT1B 2KY9A 4FSXA 2C0OA 4X9DA 4A4FA 3OW2P 2HL3A 1M1KU 5GAMh 5FU6C 1JXOA 1D0YA 1YB3A 2A37A 3FEOA 2OTLQ 1G5VA 4PL6A 1UTIA 1WFWA 2LQKA 4P3PA 1HYOA 2EKOA 1QVFP 3CCEA 2EL9A 3U23A 1Q81R 2CKKA 3CCET 3C94A 2ZT8A 4BACA 5D6WA 3IG2A 2VXFA 4XU2A 1FMWA 1VQLQ 4YRIA 4UC4A 4PJJA 1Q7YU 3L2RA 5E3IA 5KCOA 3DB4A 3CQTA 2QAZA 2ALYA 1Z7NA 2DEQA 5GMKm 2FL7A 3M57A 4DBHA 2KRSA 1KD1C 4HWPA 2XDBA 3OS2A 3LH0A 2F2VA 1OV3A 4CI0C 1YFSA 1PD1A 5LJ5d 1NLOC 4IIOA 2P0PA 1IHWA 4FYXB 1YJ9A 2EQKA 2E65A 2QQAA 1YP5A 2VASA 4D6WA 1VQ6A 4J9GA 1EIFA 1UHFA 1F1BB 1VIFA 1VQNA 3CCJT 4H2XA 2QHUA 2E12A 3VQXA 2VGNA 2AKLA 1K0SA 4IIMA 2HL5C 2F2XA 1OU9A 4N0AC 4EX5A 4KGVB 3GP8A 4C0FA 2C0IA 2NYSA 5GANg 3OS0A 1VQ8T 2DNUA 4YCVA 2XI9A 3P8TA 3EG0A 1VQ9Q 1RI9A 1BI0A 1QKWA 3HY0A 4Q15A 3QYGB 5LJ3g 3RBBB 2YUQA 1YWPA 1JJ2P 5HK0A 1GBRA 1YITA 3G1JA 2LJ0A 3P8VA 1SRLA 1VYVA 1NLPC 1EVLA 4A4EA 4TVYA 3H6ZA 4E2FB 4M78A 2EGAA 2Y4YA 2YRCA 2KYBA 5A0LA 2O9SA 5LJ5g 4Z88A 3G4SQ 4ZTUB 4X9CA 3CC4T 4C5IA 1YJNQ 3A5YA 2XKOC 2PMFA 1XTDA 2MIOA 5DLOA 2DTHA 4F7UE 3MP6A 4C8QA 4XEMA 5DM7R 4M75B 4QW2A 4BE0A 4KH0B 2C8MA 4YRGA 1NG2A 2VVKA 4XTUA 2DKGA 2EVRA 2OTLT 4YRQA 2QQRA 2EBPA 3PFSA 1QVPA 2JTMA 2ROTA 3QUIA 1M2OA 3JCMf 2DL7A 1FYNA 3JCMd 5KYWA 5KYXA 4JRPA 1B7YB 4HKEA 2ZT6A 4RQFA 4ELZC 5KNNA 4CS4A 4J7IA 1Q82R 2RHIA 1YN8A 1BB9A 2SEMA 1YIJT 2GFAA 5D7UA 4QKUA 3HXYA 2V1QA 1PWTA 4J6XA 1JRIA 2BZ8A 2DO3A 3REAB 5HGQA 2F69A 2EYYA 4PFPA 4P5NA 1YCYA 2AIRB 3H41A 2OTJT 3N5BB 1KD1R 2AHJB 1VQKQ 2V26A 2MK5A 2ED0A 3HXUA 1AEYA 4PJOF 1Y71A 4YRRA 2EW3A 2DU7A 2ZTGA 4LD6A 1VYTA 2IVWA 2AMCB 2V8JA 1X75C 4NCXA 1KHIA 4X1VA 3J80E 1KC8U 2A3LA 3G4SA 5IH2A 2FB7A 4KULA 2EQUA 3UT1A 2GTJA 3L2QA 3NGPA 4QT7A 4JS4A 4OB1B 1QVFA 1ZQ1A 1G5IA 3JCMg 2FO0A 3SD4A 2A0FB 3CCRT 4Q6GA 3M0RA 1BI2A 2K3YA 2I4LA 2ZT7A 2RI3A 3OSSC 1YNZA 2LJ3A 2SRCA 4YDQA 3A8GB 1KD1U 1BBZA 5GAOp 2L3RA 3HL8A 2JM8A 2OTJA 2E5KA 4EMKC 4B9WA 2P0KA 3CCSA 1N9WA 1MNDA 1X2GA 2DQ3A 2J05A 4EDUA 4ZN3A 3VS7A 1ZSZB 4CH4A 2LC4A 1VQ6Q 4Z02A 1ABQA 4XU0A 4M7AG 3OYDA 4P73C 4LVIA 2E3IA 1N8RC 2K4YA 3CCMQ 4ZTFA 2ZPFB 3VYGA 4XTXA 4IKFA 1N5ZA 1K9MU 1D0XA 2A08A 3RACA 2RQWA 1I8FA 1R8OB 3O8VA 2QTVA 2VB6A 2QA4T 2BE9B 3EFOB 3IALA 1G3TA 1VQPA 1VQ9A 2AZVA 2RK2A 5LJ3f 2DZ9A 1OOTA 1Z7MA 4YRMA 4F17A 5CR2A 1YHQT 1K8AU 4OMFB 5F5WA 1B07A 1VIEA 1UFFA 2J6OA 4UP7A 2QASA 4C8QG 2KRMA 2MI6A 3QO5A 1TH7A 3CC4A 3NHNA 1NJ5A 5IHIA 1VQ5A 1H4SA 2FEIA 2DE0X 3A8MB 2JOYA 4BY6C 3OYGA 2D0QB 3ME9A 1MGQA 4YYEA 2X3WD 3JCMJ 2VKNA 2CP0A 1B8AA 7AT1B 1PKSA 1QF6A 2COYA 2K79A 3RR6A 2RB6A 1NYGA 1RIQA 1YITT 2YHTA 3A32A 1XNIA 3CCLT 1TS9A 3A5ZA 2YLBA 4HA8A 2RHUA 1QP2A 2RQTA 2XDDA 4O6JA 3A5ZB 4AH6A 3SEMA 3G71A 1OZ2A 1PKTA 2E6NA 2K5FA 2JN0A 5IXFA 1AWOA 1WU7A 4N4HA 3CCVT 1GBQA 2D6FA 3HKSA 1Y57A 2DYBA 2CZ0B 2O4XA 3QZ9B 4AG2C 1SSHA 4FYVB 5GAMg 2I4NA 4WJ4A 1WYXA 2E41A 2JMAA 4PJLA 2KSSA 3M53A 2RF0A 2GF7A 1X69A 2X4WA 3VKIA 2HBWA 3A74A 4FIBA 3NEMA 4E7IA 1M27C 3X26B 2PQWA 2RHYA 2FZCB 1UJYA 1OEBA 3CCJQ 3G1ZA 1GCQC 1VQKA 3G71T 3JB9I 4PJOG 2GBQA 3QO7A 2WACA 2LCCA 4JDSA 4WJ3M 4NOYA 4L5GA 2LZ6B 3HXZA 2JW4A 2WSFE 1Q82U 5IXBA 4KQEA 3A1PA 2DTOA 2AKKA 1QVFS 4MDXA 4Z89A 1KC8C 4RKUE 3HXVA 1RUWA 2K57A 1VQLT 3M0PA 2RHXA 1Q86R 1M2VA 2EGEA 1YI2T 1KJWA 5CK9A 1CKAA 3I56T 3OS5A 1S1NA 2DL8A 2CP5A 1UDLA 3TSZA 2WSCE 2DL3A 4M7AA 2HQHA 2MWOA 2J6KA 4Z8AA 3HRUA 3L4GA 4JUVA 1BI3A 5IAYA 1M4ZA 4L59A 3VS5A 1UGPB 3QIIA 3TCJA 1V29B 4BDZA 3I55Q 3LW5E 2EQJA 1YFTA 2Y90A 2JVVA 5DLQE 2O88A 2KBTA 2DTIA 1VQ7Q 1SHFA 1WHLA 1XOVA 5GAOr 2RK1A 3LSSA 1OU8A 4C8QF 4C0GA 2VV5A 1WZOA 1U06A 3G6EQ 1M5Q1 2KAFA 3OYCA 4OB3B 1U3OA 2EKHA 1ASZA 2EQMA 3D7SB 2E1HA 3CCUT 2P5IA 1W70A 5K1PA 2X51A 3RIRA 1N27A 1GXIE 3REUA 4PJOB 1WA7A 4LE9A 3JCMe 4E7JA 1ACMB 5KYNA 3CCST 3EG9A 3TVTA 3AHUA 1VQOQ 5FWBA 2XICA 1KSWA 2EYZA 3CXCP 3WQZA 1X56A 4A4HA 3X25B 2LT4A 4PLLA 1YWOA 2AKWA 2J3MA 3UATA 1YCSB 1EFNA 2P0LA 4LDYA 2FVUA 1C6VX 2CSQA 2FHDA 4IUQA 3INZA 2L2PA 2LMJA 2RHQA 1M30A 3HTZA 1KQ2A 3HRTA 2HKQB 2YUOA 4RTUA 4OMQA 4KGXB 2X4XA 3GBQA 3PCOB 5J3BA 4IUPA 2K6DA 4ATOA 4FT4A 3I55T 4FU6A 5HCKA 4C92G 4OLFA 2EWNA 4ANJA 3UGTA 2AZSA 2KXCA 1BI1A 3HFZB 4HWRA 2ZNIA 3M4GA 2EYQA 4HWOA 2Q5HA 1SRMA 2ZZGA 4C92F 3Q1JA 1ZBXA 2KNBB 2QHTA 4OMNA 2R57A 2BUDA 1RAEB 2I0NA 2VUBA 2XMFA 4N4IA 4E6RA 4A53A 2JMCA 1E7OA 3LH5A 3M4QA 4HT8A 2FG0A 3DKMA 1C0AA 4M78E 5EC7A 3OYYA 1WJSA 1N9SA 2OAUA 3L1AA 3GOXA 2F5TX 2EQIA 1MHNA 4PJNA 3CCQA 2RQVA 2CDTA 3QDFA 2K5LA 4XU3A 1YIJA 5GAN8 4QQ6A 1X54A 1QCOA 3LYIA 3UFGA 3DLLA 3A7RA 1VQ8Q 3RF1A 1FXXA 1X55A 4LVLA 4CS2A 4ESRA 2CJAA 2ZIMA 1VQMQ 3CCVA 3PMIA 3OMGA 1X6GA 2OTLA 5C52B 3T9NA 2JZ2A 4RG8A 3H0HA 3CPFA 5J26A 2O01E 2XK0A 4KRTA 2M1HA 3NENA 4J8OA 1ARKA 2ARSA 2CH4W 1RAFB 1Q95G 1KC8R 3ASKA 4H2WA 1WJRA 1EVKA 3CCLA 2LNHB 5CO7A 1UGRB 2J06A 2XHCA 1S72T 2ZPBB 1HK9A 1TXQA 5J39A 2QGGA 3QWYA 3HFVA 3CCLQ 1RLPC 3CMEA 2DYIA 2M16A 1X6OA 1YITQ 1RADB 1PSEA 1BIBA 5CAIA 4M78B 3E9IA 1AHJB 3JCMh 11ASA 1H92A 1HC7A 3CC2T 1KMMA 1QCFA 4ELYC 3QO8A 4TVAB 4P71C 4CS3A 3I56A 1M1GA 3WVDB 4G84A 4OMOA 4CH5A 2Q5IA 3AT1B 1RAGB 2P4TA 1VQNT 2JM9A 3JCMQ 4YRPA 5C53B 1B7TA 1SRYA 2GCXA 4MMLA 2ZCFB 3PZCA 4CH3A 4E51A 1VQ5Q 4EIKA 2JT4A 3CCVQ 1VQ4A 4HT4A 2KI7A 1K73U 2ROLA 1TSFA 3PIOA 2EIFA 2MPXC 2CUDA 1K0XA 2QQ9A 3J7AF 2KQWA 1IREB 5FW9A 4C92A 1WNLA 1QVGS 3MEYA 2OJ2A 5A0DA 4P71A 5GAN2 3C12A 4D8DA 2D0NA 3RUXA 1WYDA 2CP2A 3CC7Q 3QNEA 2KEAA 5LJ5j 1W2BP 3SWNB 2DM1A 2RD1A 3H0FA 2CH4A 5LL6S 1NPRA 2IY5B 1EX4A 5GAMf 2ODRC 4DOWA 1H8KA 2CZ7B 3GIBA 1SF9A 1CKBA 2DK3A 3CD6Q 2ZT5A 2EAYA 3RMQA 1WXTA 4MZMA 2KXDA 4F7UB 1L0WA 4M78F 3PTAA 1VQOA 3KXTA 4DBFA 3FIFA 2DVEA 5GAOl 4YRLA 3OBYA 4PNOA 1K76A 2YLCA 1C1AA 1QWFA 2QA4Q 3M0QA 4Q5WA 1GCQA 2XG8D 5CVIA 1ZSGA 2MMPA 1I5LA 1PRMC 1OULA 1G3WA 3RKWA 4EPCA 2E4HA 1MMDA 2FRYA 2HCKA 4JRKA 1LYLA 4G85A 1WGSA 3L2ZA 2IG0A 3MHXA 3HSBA 2D9TA 2PU9B 1B76A 2E10A 1PCXA 3CC2A 1HSQA 3OS1A 2QG9B 3HRSA 4BB7A 2ODRD 1ZX6A 5CIUA 4JJBA 2ENMA 1TOVA 4RTWA 5GAMe 2OTJQ 5LJ3h 1C0MA 1K8AC 1GRIA 2ZCEA 2L89A 4RDXA 4TTVA 2DBMA 1VQ4T 3E2UA 5M9OA 4IUVA 4E7KA 2J6FA 3CC2Q 4XEOA 2DFUA 3E19A 3CD6T 1G5HA 4KH1B 2Y4XA 3I7FA 12ASA 4CH6A 1KQSA 1V76A 3I56Q 1IHVA 2QHSA 1R0CB 3MEWA 2YXYA 4FYWB 1FYFA 3HFZA 5IHKA 2LVMA 2RJFA 4CC3A 3FLGA 3IKLA 4PFZA 4DOVA 1Q81C 1AWWA 3QWXX 5I11A 1NJ1A 2VYTA 1RAIB 1N9RA 4LNPA 2EJFA 4QQDA 4LUDA 1RLQC 5FWCA 4OMLA 1D1BA 1U5SA 4R56A 1Y96A 1SPKA 3M54A 1MNEA 2X4JA 5FU7B 3G7ZA 2LCLA 1YFRA 3CCJA 2G4CA 4EMHA 2EFIA 4J83A 1WHHA 1YJNT 5CKBA 2K2MA 2C0TA 2KT8A 2RNAA 1VQKT 1IB8A 3CMQA 1SG5A 2EYXA 3VU3C 2DZCA 2G6FX 3VV0A 1NBEB 3OYJA 4YCUA 1ZUUA 2JJ9A 3CPWS 2RJEA 5GAMd 4CC4B 4J15A 4AFUC 5FRMA 2FZGB 2K5IA 3LX7A 3V7CA 3PMTA 4PHCA 2QEXQ 4J9BA 4A54A 5I2SA 3UH0A 1I0CA 1OX8A 3JSCA 3RGLA 5GAOm 4K86A 4LVMA 1Z9QA 2FPDA 3C95A 3ZEHA 2GGRA 4RMFA 5FU6B 2M0OA 5LJ3d 4ZIBA 2ZPIB 3RKYA 4VUBA 1PC0A 2RHZA 1QE0A 4LDVA 8AT1B 2ZXFA 4C8QC 4DA4A 1K4US 1M3BA 5GAN7 1W66A 3I9QA 1UUEA 1JBMA 1M1KC 1HJDA 1QQJA 1PYSA 1ZUYA 3OYEA 5KH6A 4GLKA 3CXCS 3NTHA 4RQEA 1H4QA 3QO3A 2X35A 5KYUB 1WLEA 3TEHB 1S72A 1X2HA 3HRIA 4IUTA 3MF2A 1D3BA 4P72A 1VQ8A 1E1TA 2COZA 2RPNA 3MP8A 1Q7YC 1D3BB 4E7HA 3LSQA 4GBQA 3G71Q 4YRJA 3EH2A 4K87A 2E6ZA 4QVCA 1YJWT 1JO8A 1WI7A 3KUFA 4AG1C 2QA4A 2KYMA 3CPWA 2ZPHB 4QVDA 1GGMA 3MEAA 2OAWA 1ABOA 1H3ZA 4LDWA 2ZNJA 5LJ5e 4YRSA 2CIMA 1K9MR 4FM4B 4M77G 3CCUA 2J3LA 3HRKA 3LGLA 1IGQA 2LJ1A 2QDLA 5I21A 4PKCC 2RM4A 4DEYA 4OMMA 4IUUA 4E7ZA 3CCUQ 3OW2S 3M0UA 1IO6A 1VQPQ 4F7UA 3OYHA 1YIJQ 2A7YA 1I4K1 3NTKA 1EZZB 1UGVA 2VXEA 2B86A 1M3AA 2J7IA 2VGMA 3C4SA 4BE2A 1GCPA 2W10A 1J3TA 1WQ7A 2I4OA 1W1FA 2HQEA 4H2VA 3OA6A 2LX7A 2X3XD 2E3HA 4GLMA 3SWNA 2DF6A 2QDYB 4JS5A 2BE7D 4XQ3A 1QW1A 1WHGA 2LP5A 1MMGA 1ZHIA 3URGA 1VQLA 1M8MA 4M7AB 1W2BA 2E3CA 2ARTA 4C8QD 8ATCB 4JJDA 3OBWA 1X27A 3OYNA 2YT6A 3J81E 3OQ5A 5CKEA 3TSWA 4AFQC 5GAOq 1Y96B 3EFOA 2CGHA 4JZ4A 2DXCA 5KYUA 4HT9A 4H2SA 3P8BB 4HCCA 3IKMB 1MV0B 3CCSQ 2DIQA 2P4RA 4HVWA 1CSKA 3LC0A 5GMKi 4TWAA 2GQVA 3HPWA 1VUBA 4BI3A 2DMOA 1RABB 1KOGA 4HWSA 1M1KR 3QYHB 3MJXA 1UE9A 1U1TA 2L3QA 1NYQA 1V1CA 3BE3A 2AK5A 3G6ET 4M7AD 4RTXA 1PSFA 3R6OA 1ZA2B 1I07A 1SEMA 2AT1B 4P74C 2YRDA 2IIMA 1KG1A 3JB9F 2JS2A 4HCZA 3CXCA 3ER0A 3VRYA 1M2VB 4CRIA 4QQGA 2E5AA 2K9GA 1USYA 1E6HA 5KYYB 4J9CA 1UHCA 1LOJA 2CYZB 3BY7A 2RJDA 1VYUA 2O4XB 2ZZFA 2MWPA 3WXMB 3REXA 5L8RE 4ZGJB 2HD0A 2XD0A 1EIYB 1QKXA 4FW1A 2LT1A 3EG9B 2COWA 4M77F 4TQFA 4DQ2A 3CCRQ 1TWBA 4AFSC 1UB4A 1EQRA 3G4ST 4RG2A 3RL6A 2RJCA 4KGZB 4M78G 1YJWQ 2XGTA 1GFCA 4C0ZA 2PUKB 1ADJA 1H4VB 3FB9A 5D6YA 3CBOA 4M75A 3SHWA 1YBYA 3CCQQ 3MEVA 1M90R 2ED1A 1AOJA 3X24B 2HSPA 2F2WA 3MF1A 4M7AC 3HFNA 1VQ5T 2AKWB 2PVOB 2RQRA 4LUEA 5GMKl 1AWXA 3FC3A 2BZYA 2RQUA 2GNCA 3A7UA 4M77A 4RCCA 3EAEA 1ZUKA 4J9IA 2QQSA 2DXBA 2ZIOA 1BBWA 5GMKh 1TG0A 3EFRA 3DSQA 4JRQA 2YDLA 3QSUA 4WCIA 2G3RA 5CKFA 4AT1B 3I5SA 2DJQA 5CCAA 4ZTZB 2HQXA 4OGCA 1ZSZC 4TQDA 2WSEE 1IGUA 2O2OA 2M9UA 5FU7C 1WDXA 1NJIU 3TU4K 2KR3A 4R0KA 3V7RA 1M90C 4P3NA 2QTXA 2DD5A 5A0GA 4M7AF 3CMAT 3P8DA 4R55A 4XTZA 1KMNA 2YUNA 4M77B 5HK3A 4KR2A 3V7SA 1JEGA 3JB9D 2BZXA 3SB2A 2PZ1A 3M55A 5KE2A 1NEGA 2HZYA 1K73C 2ZR2A 1D0ZA 4FYYB 1K9MC 2CZ1B 1AD5A 3TUPA 2R58A 2ZR3A 3OB9A 4L87A 5ELNA 2OI3A 4RTVA 4J9EA 1KQSS 1D09B 3ULRB 2QEXT 2KROA 3UA7A 3M58A 3SFMA 4P74A 5CKHA 4L6V5 2IPOB 2DDZA 4PLIA 3JCMb 1VQMT 1VA7A 4DPGA 3MCAB 1VQNQ 2CREA 4P72C 3W3SA 1SESA 1NNHA 1I1JA 1QMCA 3VRZA 1VQOT 4NL2A 3NMZC 1YHQQ 1Q86C 2L0AA 1PHTA 2E70A 1MMNA 3PNWC 4UP9A 4YP0A 3L2WA 3E9FA 5LJ3j 4FCYA 1WQWA 1K8AR 3EH1A 4HVVA 3GLXA 3JCMX 1PG5B 5GANh 3QHSA 3CC7A 2CP6A 1JXMA 2CT3A 5DY9A 2XIDA 4OB2B 1B70B 1X6BA 1LPLA 4C5EA 2O31A 2DL4A 3CEYA 1Q81U 3QJYA 2V1RA 3FJPA 5KYXB 1BK2A 1NZ9A 3EGXA 2HMAA 3L4GB 4RTTA 1Q7YR 2C7IA 5L23A 1KIKA 3I35A 1IRXA 3L2UA 1HXDA 1UGQB 1VQ6T 3CD6A 2GFUA 1JJ2A 2W0ZA 1I81A 4FW2A 1OQKA 1Z9ZA 4FL6A 6AT1B 3OYFA 1TUCA 4FSSA 1P92A 3OYMA 4FT2A 4M7DC 2ZINA 1DJ7B 1H641 2RI2A 2C06A 3ERRA 1NJIR 2X9HA 4EMGA 3TREA 4C8QE 1Q86U 2JXBA 2D1XA 3UWNA 2YWWA 1M8VA 5FRNA 4ME7A 5GMKj 5A2QE 3MKDA 4CC2A 3M4YA 3JCMc 5HKCA 3TEHA 4M75G 4YRTA 1JQQA 1QVGA 4WI1A 4IURA 2D8HA 4PJOA 2EYWA 4OVAA 3THKA 3E9HA 2DILA 3HP9A 2CT4A 4C92C 4PG3A 1PNJA 1AVZC 1WPYA 3OSVA 3P8YA 3V8JA 5LJ5h 2D8JA 4H2TA 2FYKA 4H2YA 2NUPA 2DRMA 4E47A 4C8QB 1JJ2S 1NJIC 1D1CA 2K3XA 4M7DD 3QZ5B 4RMOA 1U8RA 5I2MA 5GANf 5GAMj 1G2BA 3RMSA 2DPPB 3RKXA 2DLPA 2DAQA 1TU0B 3QPHA 1M1FA 3LLRA 4F16A 1SSFA 4X5OA 1XQHA 1UEBA 1AZEA 1N6AA 2F5KA 2H8HA 5KYWB 2PUOB 1YJNA 4EO4A 3UDCA 2MYSA 3VS2A 2GQIA 4HVUA 1W2BS 4XTYA 2EPDA 2KK4A 2EJGA 2RO0A 1TTHB 1YJWA 1KFZA 1HTTA 2QHVA 2P84A 4X34A 1PYSB 1X01A 4BI4A 4DBRA 4P75C 1S72Q 2ZPEB 3HHTB 1SERA 1LNXA 2FPEA 3V8LA 2CP3A 1WXBA 2H3EB 4BUGA 4M4ZA 4KUDK 1FWZA 2I4MA 1GL5A 3ZBDA 1FMVA 2CZ6B 5IHNA 2L3SA 1YI2A 3JV3A 3DB3A 1G8XA 1T3SA 2VWFA 5HY6A 4H2XB 4JJCA 3WVEB 4M7DF 3P8HA 1LVKA 3UPUA 3JB9J 1W6XA 2DX1A 3FDRA 2DD4A 1G3SA 1RAHB 4KBMB 1E22A 3CC4Q 1PD0A 2MF2A 4J6YA 4E7LA 3X28B 4BW9A 4YTLA 2HBPA 3CMEQ 1NPPA 2A36A 3BDUA 4LN2A 2LRQA 4OP0A 5GJWB 5LJ5f 4N4GA 4F04B 1D1AA 2NUZA 3VS1A 2OX7A 1EFWA 5C0MA 4BWAA 1E6GA 4J9HA 3KBGA 3OYAA 2QEXA 3BDLA 4E7SA 1KQSP 2Q7GA 4ZNXA 3EG2A 4LNSA 4JLGA 4C92B 1VQ9T 3LGFA 1TUDA 4AFZC 1ZSZA 2GTOA 2V8KA 1JB0E 5ELOA 3QTCA 3SWNC 2HKNA 2RHSB 3VBBA 4OF1A 3BFMA 1K73R 3GNFB 2I2LA 3I5RA 4XTVA 3GPLA 2BIVA 2DERA 4NL3A 3EFSA 4JZ3A 3JCMP 3RESA 3UF4A 4HCBA 2MCNA 3JRZA 3S3OA 3PVLA 1T3LA 5KYYA 4LD9K 3H8ZA 4M7DB 4XTWA 3ICAA 3OYIA 4AMCA 4C92E 2HAXA 3A31A 4HVCA 3TEGA 1NM7A 5GAN6 3VS4A 1ADYA 1BBUA 4TVAA 1RACB 2L8DA 2QQBA 2QYZA 5ECAA 3VS0A 3IQLA 3OD1A 2RHSA 3BJUA 1HD3A 1SETA 4F14A 5C6SA 3A8HB 5GJVB 4HWTA 3CMAA 2Q7EA 3EGXB 2DETA 2KE9A 4N0AA 2AMCA 4NS5A 2CP7A 5GANd 3MP1A 1YJ9T 2CJ9A 1B70A 3CCEQ 3M56A 2B8AA 3QG1A 3HFOA 1O9SA 1J5WA 3JB9G 1KHCA 3OYKA 3PIPA 1UG1A 2K3BA 1AZGB 1YHQA 1N8RU 2DXTA 4YCWA 4A63B 4OMPA 4ZN1A 4D8KA 2ZZDA 3EG3A 1SKUB 3PCOA 1NE8A 2LQNA 1A0NB 1O75A 1X2QA 2A8EA 1X2KA 4XAXB 2NS6A 2VC8A 4JPBW 2JUFA 1WHKA 4O2DA 4OB0B 1QVGP 2ABLA 5GAN3 3EHRA 4KR3A 2L5QA 2DA9A 3QJ6A 1ZA1B 4PK4A 2KMTA 2DBKA 3L42A 2YSQA 1LCKA 2FRWA 3VQWA 1MMAA 2JS0A 4C0DB 3TEEA 1VOMA 3OMCA 4P3OA 2NUTA 5AT1B 3CMET 1R0BG 4M7DG 2CUBA 1I5OB 3PT9A 4P75A 1WXUA 3EG1A 1BIAA
chains in the Genus database with same CATH topology
2RI5A 4M77C 2HNIA 1EOVA 4M78C 1W4SA 2ZGWA 4LVJA 2DJZA 1JJCB 2QI2A 5LJ3e 4M75D 3S3NA 3X20B 2RA2A 5FLXE 3M59A 3OYLA 5CQXA 1NJ8A 1U1SA 5GANe 3V8KA 3G6EA 1QP3A 2PVGB 2H3JA 3NFCA 5IT9E 4UP8A 3OW2A 3I55A 4QVZA 3SDZA 3QKJA 4F7UF 3CCMT 4M7DE 3QXEB 2P0QA 5CKDA 1VQ7T 2JNGA 2QXFA 4J7FA 1M9SA 1NJ6A 3L2VA 1B34A 1KQ1A 3MEUA 3M4PA 2BKDN 2PVDB 4MMKA 4YRCA 4F7UG 4V2SA 2E5QA 3UGQA 2KDSA 3QBYA 1Q82C 2DIGA 1NJ2A 1ASYA 3META 3VUZA 3NELA 5KCHA 1NYRA 2DU5A 4P73A 1E24A 2LQ8A 3CC7T 2ALYB 3F70A 2MAMA 3M9QA 2ZPGB 3M5AA 4XK8E 3JCMV 4EMKA 4BI8B 4O5VA 4YROA 4B9XA 4ZGEB 1BKBA 4TVWA 5EG2A 1VQMA 4M78D 2Q7HA 2LDMA 3VQVA 4PJOD 3E9GA 2EJ9A 4OGEA 4KUIA 4A4KA 2CJBA 1LJOA 3HY1A 4LDUA 1B7YA 5GAN4 4YREA 4C5GA 3S6WA 4M7DA 1OYXA 1BYMA 4ZGDB 2E64A 3RERA 3HXXA 2XU8A 3OYBA 3VUBA 1EIYA 1Y7XA 1VQ7A 3VJPA 5KE3A 3NETA 4KT0E 1FX7A 2V8IA 2YRVA 2RH2A 5GAOn 1B34B 3QDRB 4PJOC 4Y91A 2X4YA 3OY9A 5FROA 5GMKe 4YRKA 4YRFA 3CBMA 4EMKB 1YGBA 2DQ0A 1JJCA 1G51A 4UPAA 1OZ3A 4BDYA 4YRNA 3A7AA 3JCMW 3HXWA 5CQYA 3CCQT 2LNVA 4PJOE 4WF2A 5GAN5 2RHQB 4J6WA 1WJQA 1RI0A 3VQYA 4A4GA 4TVRA 4LVKA 4K88A 2DXUA 3CCMA 1OI1A 4C0DC 1UGSB 1RL2A 3KFUA 3LWIA 4ZTJA 3A8OB 4M75F 4H2UA 2LX9A 5D6XA 4II1A 2ZZEA 4BE1A 3MQZA 2XDPA 1VQZA 5K1XA 3CBPA 5AYFA 5GANj 4JLIA 3GF5A 3LWHA 1M90U 1H4TA 4MZTA 2R5AA 2KVQG 2ARUA 3R07A 4YPFA 3FRNA 2R5MA 4JJNK 2IY5A 3JB9H 4MZPA 4M75E 1E1OA 3ZFJA 3PGGA 4JRIA 4H02A 1IL2A 2XTIA 4GY5A 3BW1A 2K2VA 4RCBA 1IZ6A 1Y07A 4C5HA 1G3YA 4M75C 2CS7A 2PMEA 4Y28E 4LDXA 3E1SA 5C51B 2LTOA 4XU1A 3A8LB 4M7AE 3S3MA 1ATIA 3NTIA 3MO8A 4BD3A 4MDWA 3DLMA 4J5YA 4M77E 3JAME 3GNGA 2JTFA 4M77D 1VQPT 2NLUA 3VYHB 4C92D 3CCRA 1USYC 4BY6B 5IN1A 2KY9A 4FSXA 4X9DA 4A4FA 1M1KU 5GAMh 5FU6C 1YB3A 3FEOA 1G5VA 4PL6A 2LQKA 4P3PA 2EKOA 3CCEA 2EL9A 2CKKA 3CCET 3C94A 2ZT8A 4BACA 5D6WA 3IG2A 2VXFA 4XU2A 4YRIA 4UC4A 1Q7YU 3L2RA 5E3IA 5KCOA 3DB4A 2ALYA 1Z7NA 2DEQA 5GMKm 2FL7A 3M57A 1KD1C 4HWPA 2XDBA 3OS2A 3LH0A 4CI0C 1YFSA 5LJ5d 2P0PA 1YJ9A 2EQKA 2E65A 2QQAA 4D6WA 1VQ6A 1EIFA 1VIFA 1VQNA 4H2XA 3CCJT 2QHUA 2E12A 3VQXA 2VGNA 4N0AC 4EX5A 3GP8A 4C0FA 5GANg 3OS0A 1VQ8T 4YCVA 2XI9A 3P8TA 1BI0A 3HY0A 4Q15A 3QYGB 5LJ3g 5HK0A 1YITA 3P8VA 1EVLA 4A4EA 4TVYA 3H6ZA 4M78A 2Y4YA 5A0LA 5LJ5g 4ZTUB 4X9CA 3CC4T 4C5IA 3A5YA 2XKOC 2PMFA 1XTDA 5DLOA 2DTHA 4F7UE 3MP6A 4C8QA 4XEMA 5DM7R 4M75B 4QW2A 4BE0A 2C8MA 4YRGA 4XTUA 2DKGA 2OTLT 4YRQA 2QQRA 3PFSA 1QVPA 2JTMA 3QUIA 3JCMf 3JCMd 4JRPA 1B7YB 4HKEA 2ZT6A 4RQFA 4ELZC 5KNNA 4CS4A 4J7IA 2RHIA 1YIJT 2GFAA 3HXYA 4J6XA 1JRIA 2DO3A 5HGQA 2F69A 4P5NA 1YCYA 2OTJT 3N5BB 2AHJB 3HXUA 4PJOF 1Y71A 4YRRA 2DU7A 2ZTGA 4LD6A 2IVWA 2AMCB 2V8JA 1X75C 4NCXA 1KHIA 3J80E 1KC8U 2A3LA 3G4SA 2FB7A 4KULA 2EQUA 3UT1A 3L2QA 4JS4A 4OB1B 1QVFA 1ZQ1A 1G5IA 3JCMg 3SD4A 3CCRT 4Q6GA 1BI2A 2K3YA 2I4LA 2ZT7A 2RI3A 3OSSC 4YDQA 3A8GB 1KD1U 5GAOp 2L3RA 3HL8A 2OTJA 4EMKC 4B9WA 2P0KA 3CCSA 1N9WA 1X2GA 2DQ3A 4EDUA 4ZN3A 4CH4A 2LC4A 4Z02A 4XU0A 4M7AG 3OYDA 4P73C 4LVIA 1N8RC 2K4YA 4ZTFA 2ZPFB 3VYGA 4XTXA 4IKFA 1K9MU 3RACA 1I8FA 1R8OB 3O8VA 2QA4T 3IALA 1G3TA 1VQPA 1VQ9A 2RK2A 5LJ3f 2DZ9A 1Z7MA 4YRMA 5CR2A 1YHQT 1K8AU 4OMFB 5F5WA 1VIEA 4UP7A 4C8QG 2MI6A 3QO5A 1TH7A 3CC4A 1NJ5A 1VQ5A 1H4SA 3A8MB 4BY6C 2JOYA 3OYGA 2D0QB 3ME9A 1MGQA 4YYEA 3JCMJ 1B8AA 1QF6A 2RB6A 1RIQA 1YITT 2YHTA 3A32A 1XNIA 3CCLT 3A5ZA 2YLBA 4HA8A 2RHUA 1QP2A 2XDDA 4O6JA 3A5ZB 4AH6A 3G71A 1OZ2A 2E6NA 2K5FA 2JN0A 1WU7A 4N4HA 3CCVT 2D6FA 3HKSA 2CZ0B 2O4XA 3QZ9B 5GAMg 2I4NA 4WJ4A 2E41A 2KSSA 3M53A 2GF7A 2X4WA 3VKIA 3A74A 4FIBA 3NEMA 4E7IA 3X26B 2PQWA 2RHYA 3G1ZA 1VQKA 3G71T 3JB9I 4PJOG 3QO7A 2WACA 2LCCA 4JDSA 4WJ3M 4NOYA 4L5GA 3HXZA 2WSFE 1Q82U 4KQEA 2DTOA 1QVFS 4MDXA 1KC8C 4RKUE 3HXVA 2K57A 1VQLT 2RHXA 1YI2T 5CK9A 3I56T 3OS5A 2WSCE 4M7AA 2MWOA 3HRUA 3L4GA 4JUVA 1BI3A 5IAYA 1M4ZA 4L59A 1UGPB 3QIIA 3TCJA 1V29B 4BDZA 3LW5E 2EQJA 1YFTA 2Y90A 2JVVA 5DLQE 2DTIA 1XOVA 5GAOr 2RK1A 3LSSA 4C8QF 4C0GA 2VV5A 1M5Q1 2KAFA 3OYCA 4OB3B 1ASZA 2EQMA 2E1HA 3CCUT 2P5IA 5K1PA 3RIRA 1N27A 1GXIE 3REUA 4PJOB 3JCMe 4E7JA 3CCST 3AHUA 2XICA 3WQZA 1X56A 4A4HA 3X25B 2LT4A 4PLLA 2AKWA 2J3MA 2P0LA 4LDYA 2FVUA 2FHDA 4IUQA 3INZA 2RHQA 3HTZA 1KQ2A 3HRTA 2X4XA 3PCOB 5J3BA 4IUPA 4ATOA 4FT4A 3I55T 4FU6A 4C92G 4OLFA 2EWNA 3UGTA 1BI1A 3HFZB 4HWRA 2ZNIA 3M4GA 2EYQA 4HWOA 2Q5HA 2ZZGA 4C92F 3Q1JA 1ZBXA 2QHTA 2R57A 2BUDA 2VUBA 4N4IA 4A53A 3M4QA 4HT8A 3DKMA 1C0AA 4M78E 1WJSA 3OYYA 1N9SA 2OAUA 3L1AA 3GOXA 2F5TX 1MHNA 3CCQA 2K5LA 4XU3A 1YIJA 5GAN8 4QQ6A 1X54A 3LYIA 3UFGA 3DLLA 3A7RA 3RF1A 1FXXA 1X55A 4LVLA 4CS2A 2CJAA 2ZIMA 3CCVA 3PMIA 3OMGA 2OTLA 5C52B 3T9NA 2JZ2A 4RG8A 3CPFA 5J26A 2O01E 2XK0A 2M1HA 3NENA 4J8OA 2ARSA 3ASKA 4H2WA 1WJRA 1EVKA 3CCLA 5CO7A 1UGRB 2XHCA 1S72T 2ZPBB 1HK9A 5J39A 3HFVA 3CMEA 2M16A 1X6OA 1PSEA 1BIBA 5CAIA 4M78B 3E9IA 1AHJB 3JCMh 11ASA 1HC7A 3CC2T 1KMMA 4ELYC 3QO8A 4TVAB 4P71C 4CS3A 3I56A 1M1GA 3WVDB 4G84A 4CH5A 2Q5IA 2P4TA 1VQNT 3JCMQ 4YRPA 5C53B 1SRYA 2GCXA 4MMLA 2ZCFB 3PZCA 4CH3A 4E51A 1VQ4A 4HT4A 1K73U 3PIOA 2EIFA 2QQ9A 3J7AF 2KQWA 1IREB 4C92A 1WNLA 1QVGS 3MEYA 5A0DA 4P71A 5GAN2 3C12A 3RUXA 1WYDA 3QNEA 5LJ5j 3SWNB 2RD1A 5LL6S 1NPRA 2IY5B 5GAMf 2ODRC 4DOWA 2CZ7B 3GIBA 2DK3A 2ZT5A 2EAYA 3RMQA 4MZMA 4F7UB 1L0WA 4M78F 3PTAA 1VQOA 3KXTA 3FIFA 2DVEA 5GAOl 4YRLA 3OBYA 4PNOA 2YLCA 4Q5WA 2XG8D 1I5LA 5CVIA 2MMPA 1G3WA 3RKWA 4EPCA 4G85A 4JRKA 1LYLA 1WGSA 3L2ZA 2IG0A 3MHXA 3HSBA 2D9TA 2PU9B 1B76A 2E10A 3CC2A 3OS1A 3HRSA 4BB7A 2ODRD 5CIUA 5GAMe 2ZCEA 1K8AC 5LJ3h 4RDXA 2L89A 4TTVA 1VQ4T 5M9OA 4IUVA 4E7KA 4XEOA 3E19A 3CD6T 1G5HA 2Y4XA 3I7FA 12ASA 4CH6A 1KQSA 2QHSA 3MEWA 1FYFA 3HFZA 2LVMA 2RJFA 3FLGA 3IKLA 4DOVA 1Q81C 1NJ1A 2VYTA 1N9RA 2EJFA 4QQDA 4R56A 1Y96A 3M54A 2X4JA 5FU7B 3G7ZA 2LCLA 1YFRA 3CCJA 2G4CA 4EMHA 2EFIA 4J83A 1YJNT 5CKBA 1VQKT 3CMQA 3VU3C 2DZCA 3VV0A 4YCUA 3OYJA 3CPWS 2RJEA 5GAMd 4J15A 5FRMA 2K5IA 3LX7A 3V7CA 3PMTA 4PHCA 4A54A 5I2SA 3UH0A 3JSCA 3RGLA 5GAOm 4K86A 4LVMA 3C95A 3ZEHA 4RMFA 5FU6B 2M0OA 5LJ3d 4ZIBA 2ZPIB 3RKYA 4VUBA 2RHZA 1QE0A 4LDVA 2ZXFA 4C8QC 4DA4A 5GAN7 1W66A 1JBMA 1M1KC 1PYSA 3OYEA 5KH6A 4GLKA 3CXCS 3NTHA 4RQEA 1H4QA 3QO3A 2X35A 1WLEA 3TEHB 1S72A 1X2HA 3HRIA 4IUTA 3MF2A 1D3BA 4P72A 1VQ8A 1E1TA 3MP8A 1Q7YC 1D3BB 4E7HA 3LSQA 4YRJA 4K87A 2E6ZA 4QVCA 1YJWT 3KUFA 2QA4A 3CPWA 2ZPHB 4QVDA 1GGMA 3MEAA 1H3ZA 4LDWA 2ZNJA 5LJ5e 4YRSA 2CIMA 4FM4B 4M77G 3CCUA 2J3LA 3HRKA 3LGLA 5I21A 4PKCC 2RM4A 4IUUA 3OW2S 4F7UA 3OYHA 2A7YA 1I4K1 3NTKA 2VXEA 2VGMA 3C4SA 4BE2A 2I4OA 1WQ7A 2HQEA 4H2VA 3OA6A 3SWNA 2QDYB 4JS5A 4XQ3A 1QW1A 1ZHIA 3URGA 1VQLA 2E3CA 4M7AB 1W2BA 2ARTA 4C8QD 3OBWA 3OYNA 3J81E 3OQ5A 5CKEA 5GAOq 1Y96B 2CGHA 2DXCA 4HT9A 4H2SA 3P8BB 4HCCA 3IKMB 2DIQA 3LC0A 5GMKi 4TWAA 2GQVA 3HPWA 1VUBA 4BI3A 1KOGA 4HWSA 3QYHB 1U1TA 1NYQA 3G6ET 4M7AD 1PSFA 3R6OA 4P74C 1KG1A 3JB9F 4HCZA 3CXCA 3ER0A 4CRIA 4QQGA 2E5AA 1USYA 1LOJA 2CYZB 3BY7A 2RJDA 2O4XB 2ZZFA 2MWPA 3WXMB 3REXA 5L8RE 4ZGJB 2HD0A 2XD0A 1EIYB 2LT1A 4M77F 4TQFA 4DQ2A 1UB4A 1EQRA 3G4ST 4RG2A 3RL6A 2RJCA 4M78G 2XGTA 4C0ZA 2PUKB 1ADJA 1H4VB 3FB9A 5D6YA 3CBOA 4M75A 1YBYA 3MEVA 3X24B 3MF1A 4M7AC 3HFNA 1VQ5T 2AKWB 2PVOB 5GMKl 3FC3A 3A7UA 4M77A 4RCCA 3EAEA 2QQSA 2DXBA 2ZIOA 1BBWA 5GMKh 3EFRA 3DSQA 4JRQA 3QSUA 2G3RA 5CKFA 5CCAA 4ZTZB 2HQXA 4OGCA 4TQDA 2WSEE 2M9UA 5FU7C 1NJIU 3TU4K 3V7RA 1M90C 4P3NA 2QTXA 2DD5A 5A0GA 4M7AF 3CMAT 3P8DA 4R55A 4XTZA 1KMNA 4M77B 5HK3A 4KR2A 3V7SA 3JB9D 3SB2A 3M55A 5KE2A 1K73C 2ZR2A 1K9MC 2CZ1B 3TUPA 2R58A 2ZR3A 3OB9A 4L87A 5ELNA 1KQSS 2QEXT 3M58A 3SFMA 4P74A 5CKHA 4L6V5 2DDZA 4PLIA 3JCMb 1VQMT 4DPGA 3MCAB 4P72C 3W3SA 1SESA 1NNHA 1VQOT 4NL2A 1Q86C 2E70A 4UP9A 3PNWC 4YP0A 3L2WA 3E9FA 5LJ3j 1WQWA 3GLXA 3JCMX 5GANh 3QHSA 3CC7A 5DY9A 2XIDA 4OB2B 1B70B 4C5EA 3CEYA 1Q81U 3QJYA 3FJPA 1NZ9A 3L4GB 2C7IA 3L2UA 1HXDA 1UGQB 1VQ6T 3CD6A 2GFUA 1JJ2A 1I81A 4FL6A 3OYFA 1P92A 3OYMA 4FT2A 4M7DC 2ZINA 1DJ7B 1H641 2RI2A 2C06A 3ERRA 4EMGA 3TREA 4C8QE 1Q86U 3UWNA 1M8VA 5FRNA 4ME7A 5GMKj 5A2QE 3M4YA 3JCMc 5HKCA 3TEHA 4M75G 4YRTA 1QVGA 4WI1A 4IURA 4PJOA 4OVAA 3E9HA 3HP9A 4C92C 4PG3A 1WPYA 3OSVA 3P8YA 3V8JA 5LJ5h 4H2TA 2FYKA 4H2YA 4E47A 4C8QB 1JJ2S 1NJIC 2K3XA 4M7DD 3QZ5B 4RMOA 1U8RA 5I2MA 5GANf 5GAMj 3RMSA 2DPPB 3RKXA 2DAQA 3QPHA 1M1FA 3LLRA 1SSFA 4X5OA 1XQHA 1UEBA 1N6AA 2F5KA 2PUOB 1YJNA 4EO4A 3UDCA 1W2BS 4XTYA 2KK4A 2EJGA 2RO0A 1YJWA 1HTTA 2QHVA 4X34A 1PYSB 1X01A 4BI4A 4P75C 2ZPEB 3HHTB 1SERA 1LNXA 3V8LA 4BUGA 4KUDK 1FWZA 2I4MA 3ZBDA 2CZ6B 1YI2A 3DB3A 5HY6A 4H2XB 3WVEB 4M7DF 3P8HA 3UPUA 3JB9J 3FDRA 2DD4A 1G3SA 4KBMB 1E22A 2MF2A 4J6YA 4E7LA 3X28B 4BW9A 4YTLA 2HBPA 1NPPA 3BDUA 2LRQA 4OP0A 5LJ5f 4N4GA 1EFWA 5C0MA 4BWAA 3KBGA 3OYAA 2QEXA 3BDLA 2Q7GA 4LNSA 4JLGA 4C92B 1VQ9T 3LGFA 2V8KA 1JB0E 5ELOA 3QTCA 3SWNC 2RHSB 3VBBA 4OF1A 3BFMA 3GNFB 2I2LA 4XTVA 3GPLA 2BIVA 4NL3A 3EFSA 3JCMP 3RESA 4HCBA 3JRZA 3S3OA 4LD9K 3H8ZA 4M7DB 4XTWA 3ICAA 3OYIA 4C92E 2HAXA 3A31A 4HVCA 3TEGA 5GAN6 1ADYA 1BBUA 4TVAA 2L8DA 2QQBA 3OD1A 2RHSA 3BJUA 1SETA 5C6SA 3A8HB 4HWTA 3CMAA 2Q7EA 4N0AA 2AMCA 4NS5A 5GANd 3MP1A 1YJ9T 2CJ9A 1B70A 3M56A 2B8AA 3QG1A 3HFOA 1O9SA 1J5WA 3JB9G 1KHCA 3OYKA 3PIPA 1YHQA 1N8RU 2DXTA 4YCWA 4ZN1A 2ZZDA 3PCOA 1NE8A 1O75A 2A8EA 4XAXB 2NS6A 2VC8A 2JUFA 4O2DA 4OB0B 5GAN3 4KR3A 2L5QA 3QJ6A 2KMTA 3L42A 3VQWA 4C0DB 3OMCA 3TEEA 4P3OA 3CMET 4M7DG 3PT9A 4P75A 1BIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X55 A;  4CS2 A;  2E5A A;  2CJA A;  2ZIM A;  3A5Y A;  1USY A;  2PMF A;  4M77 C;  2HNI A;  5C52 B;  1EOV A;  4M78 C;  2DTH A;  1LOJ A;  2ZGW A;  3BY7 A;  4F7U E;  4C8Q A;  4XEM A;  2ZZF A;  4M75 B;  2DJZ A;  1JJC B;  5LJ3 e;  4M75 D;  3REX A;  2C8M A;  4YRG A;  1EIY B;  2RA2 A;  3NEN A;  4XTU A;  2DKG A;  4M77 F;  4TQF A;  4DQ2 A;  2ARS A;  4YRQ A;  4H2W A;  1EVK A;  1NJ8 A;  1U1S A;  5GAN e;  3V8K A;  1EQR A;  3QUI A;  3JCM f;  3JCM d;  3RL6 A;  4M78 G;  1HK9 A;  1B7Y B;  2ZT6 A;  4RQF A;  2XGT A;  3HFV A;  5KNN A;  4CS4 A;  4UP8 A;  1ADJ A;  1H4V B;  3FB9 A;  4M75 A;  1BIB A;  5CAI A;  3MF1 A;  4M7A C;  3HFN A;  2AKW B;  3HXY A;  5GMK l;  4M78 B;  3E9I A;  4F7U F;  4M7D E;  3JCM h;  4J6X A;  3A7U A;  11AS A;  1JRI A;  5HGQ A;  4M77 A;  4RCC A;  1HC7 A;  1KMM A;  3QO8 A;  4CS3 A;  4TVA B;  2ZIO A;  1YCY A;  1BBW A;  5GMK h;  4P71 C;  3EFR A;  3DSQ A;  3QSU A;  4G84 A;  1NJ6 A;  4CH5 A;  3HXU A;  2Q5I A;  4PJO F;  1B34 A;  4ZTZ B;  1KQ1 A;  3M4P A;  3JCM Q;  4YRR A;  4YRP A;  4MMK A;  5C53 B;  1SRY A;  2DU7 A;  2ZTG A;  4F7U G;  4MML A;  4TQD A;  4YRC A;  3PZC A;  4V2S A;  4CH3 A;  4E51 A;  3UGQ A;  3V7R A;  2AMC B;  4NCX A;  4P3N A;  1NJ2 A;  2QTX A;  4M7A F;  1ASY A;  3NEL A;  1NYR A;  4XTZ A;  2DU5 A;  2FB7 A;  4P73 A;  1E24 A;  1KMN A;  4M77 B;  4KR2 A;  3V7S A;  3JB9 D;  3SB2 A;  2ALY B;  4C92 A;  1WNL A;  2ZR2 A;  3MEY A;  4P71 A;  5GAN 2;  1G5I A;  3TUP A;  3JCM g;  2ZR3 A;  3RUX A;  3JCM V;  1WYD A;  4L87 A;  3QNE A;  4Q6G A;  5LJ5 j;  4EMK A;  3SWN B;  2I4L A;  2ZT7 A;  5ELN A;  2RD1 A;  2IY5 B;  4YRO A;  5GAM f;  4YDQ A;  2ODR C;  4P74 A;  2DDZ A;  3GIB A;  5GAO p;  4TVW A;  3JCM b;  4EMK C;  1N9W A;  1X2G A;  2EAY A;  2ZT5 A;  2DQ3 A;  4DPG A;  4M78 D;  4CH4 A;  4F7U B;  1L0W A;  2Q7H A;  4M78 F;  4P72 C;  3W3S A;  1SES A;  3VQV A;  1NNH A;  4PJO D;  4NL2 A;  2EJ9 A;  4XU0 A;  4M7A G;  4P73 C;  2CJB A;  3FIF A;  2DVE A;  5GAO l;  4UP9 A;  4YRL A;  4PNO A;  4YP0 A;  1LJO A;  3HY1 A;  2YLC A;  1B7Y A;  5LJ3 j;  1WQW A;  5GAN 4;  4XTX A;  4YRE A;  3JCM X;  5GAN h;  1I5L A;  4M7D A;  3QHS A;  3RAC A;  1I8F A;  2E64 A;  3RKW A;  5DY9 A;  3RER A;  3IAL A;  1B70 B;  4G85 A;  4JRK A;  1LYL A;  5LJ3 f;  3HXX A;  3L2Z A;  2DZ9 A;  3HSB A;  1EIY A;  1Z7M A;  3FJP A;  4YRM A;  1B76 A;  2E10 A;  5F5W A;  3L4G B;  4UP7 A;  3NET A;  4C8Q G;  5GAO n;  1B34 B;  4PJO C;  4Y91 A;  2C7I A;  3QO5 A;  1TH7 A;  2ODR D;  1HXD A;  1NJ5 A;  5GMK e;  1H4S A;  5GAM e;  2ZCE A;  1I81 A;  5LJ3 h;  4YRK A;  4RDX A;  4YRF A;  4EMK B;  4TTV A;  1MGQ A;  4YYE A;  1YGB A;  2DQ0 A;  3JCM J;  1JJC A;  4XEO A;  1G51 A;  2ZIN A;  4M7D C;  1B8A A;  4UPA A;  1H64 1;  1G5H A;  4YRN A;  1QF6 A;  3ERR A;  3I7F A;  3A7A A;  3JCM W;  12AS A;  3HXW A;  2RB6 A;  1RIQ A;  4CH6 A;  2YHT A;  4EMG A;  4C8Q E;  3A32 A;  4PJO E;  4WF2 A;  2QHS A;  5GAN 5;  1M8V A;  2RHQ B;  4J6W A;  5GMK j;  1FYF A;  3A5Z A;  3HFZ A;  2YLB A;  3JCM c;  4HA8 A;  3TEH A;  4M75 G;  4YRT A;  3VQY A;  4WI1 A;  4K88 A;  2DXU A;  3IKL A;  4PJO A;  4AH6 A;  1NJ1 A;  3E9H A;  1N9R A;  2EJF A;  3KFU A;  2JN0 A;  4C92 C;  1WU7 A;  4PG3 A;  4M75 F;  1WPY A;  4H2U A;  3P8Y A;  3V8J A;  5LJ5 h;  4H2T A;  1Y96 A;  2FYK A;  4H2Y A;  2ZZE A;  5GAM g;  4C8Q B;  2I4N A;  4WJ4 A;  4M7D D;  1YFR A;  1VQZ A;  2G4C A;  2E41 A;  4EMH A;  5GAN f;  5K1X A;  5GAM j;  5GAN j;  4JLI A;  3RKX A;  3A74 A;  1H4T A;  3NEM A;  3CMQ A;  3VU3 C;  2DZC A;  4YCU A;  4X5O A;  3G1Z A;  5GAM d;  4J15 A;  4EO4 A;  3JB9 I;  2ARU A;  3R07 A;  4YPF A;  4PJO G;  3V7C A;  4XTY A;  4PHC A;  3QO7 A;  2IY5 A;  2EJG A;  4WJ3 M;  3JB9 H;  4NOY A;  4A54 A;  4M75 E;  1HTT A;  3UH0 A;  3HXZ A;  1E1O A;  2QHV A;  3RGL A;  3PGG A;  5GAO m;  1PYS B;  4K86 A;  1X01 A;  4JRI A;  4KQE A;  4H02 A;  1IL2 A;  4P75 C;  4RMF A;  2DTO A;  1SER A;  1LNX A;  2XTI A;  5LJ3 d;  3V8L A;  4ZIB A;  3BW1 A;  4RCB A;  3HXV A;  2I4M A;  3RKY A;  2K57 A;  1QE0 A;  2ZXF A;  4C8Q C;  4M75 C;  5GAN 7;  1W66 A;  1JBM A;  2PME A;  4M7A A;  4H2X B;  4M7D F;  5C51 B;  4XU1 A;  3JB9 J;  4M7A E;  3L4G A;  4JUV A;  1ATI A;  1PYS A;  4RQE A;  1H4Q A;  3QO3 A;  1E22 A;  4J6Y A;  1WLE A;  3TEH B;  4BW9 A;  1YFT A;  1X2H A;  2Y90 A;  3HRI A;  3BDU A;  2DTI A;  3MF2 A;  4OP0 A;  1D3B A;  5GAO r;  5LJ5 f;  4P72 A;  1E1T A;  3LSS A;  1EFW A;  4BWA A;  4C8Q F;  1D3B B;  4J5Y A;  4M77 E;  2Q7G A;  3LSQ A;  1M5Q 1;  4YRJ A;  1ASZ A;  4M77 D;  4K87 A;  4C92 D;  2E1H A;  4LNS A;  2P5I A;  4C92 B;  4QVC A;  1USY C;  5K1P A;  3RIR A;  4X9D A;  4QVD A;  1GGM A;  3REU A;  4PJO B;  5ELO A;  3QTC A;  3SWN C;  5GAM h;  3JCM e;  1YB3 A;  2RHS B;  2ZNJ A;  3VBB A;  3BFM A;  5LJ5 e;  4YRS A;  2CIM A;  2I2L A;  4XTV A;  4M77 G;  2J3L A;  3HRK A;  5I21 A;  3AHU A;  4NL3 A;  3EFS A;  4P3P A;  2RM4 A;  3WQZ A;  3JCM P;  1X56 A;  3RES A;  2EL9 A;  2AKW A;  2J3M A;  4M7D B;  2ZT8 A;  4XTW A;  3ICA A;  3IG2 A;  2P0L A;  4C92 E;  2VXF A;  3A31 A;  4XU2 A;  4HVC A;  3TEG A;  4F7U A;  5GAN 6;  4YRI A;  1BBU A;  3INZ A;  1ADY A;  4TVA A;  1I4K 1;  2RHQ A;  5E3I A;  3HTZ A;  2ALY A;  2VXE A;  1KQ2 A;  1Z7N A;  2DEQ A;  5GMK m;  3OD1 A;  2RHS A;  3BJU A;  1SET A;  4HWP A;  3PCO B;  2I4O A;  1WQ7 A;  4HWT A;  2Q7E A;  4H2V A;  1YFS A;  5LJ5 d;  4N0A A;  2AMC A;  4C92 G;  4OLF A;  3SWN A;  5GAN d;  2EWN A;  2E65 A;  2CJ9 A;  1B70 A;  3UGT A;  4XQ3 A;  3HFO A;  3HFZ B;  1J5W A;  4M7A B;  2E3C A;  2QHU A;  4H2X A;  3JB9 G;  4HWR A;  2ART A;  3VQX A;  2ZNI A;  4C8Q D;  3M4G A;  2DXT A;  4YCW A;  4N0A C;  4HWO A;  2Q5H A;  2ZZG A;  4EX5 A;  4C92 F;  5GAO q;  1Y96 B;  2CGH A;  5GAN g;  4HT9 A;  3PCO A;  4H2S A;  2QHT A;  3IKM B;  3LC0 A;  5GMK i;  4YCV A;  2VC8 A;  3P8T A;  4TWA A;  4A53 A;  4O2D A;  4Q15 A;  5GAN 3;  3HY0 A;  1KOG A;  3M4Q A;  5LJ3 g;  4HT8 A;  4HWS A;  4KR3 A;  1C0A A;  4M78 E;  1N9S A;  1U1T A;  3L1A A;  1NYQ A;  3VQW A;  4M7A D;  4XU3 A;  3P8V A;  5GAN 8;  1EVL A;  4P3O A;  1X54 A;  4P74 C;  4TVY A;  3UFG A;  4M78 A;  4M7D G;  3JB9 F;  3A7R A;  3RF1 A;  4P75 A;  5LJ5 g;  4ZTU B;  4X9C A;  1BIA A; 
#chains in the Genus database with same CATH topology
 1WHM A;  2DRK A;  1N8R R;  3A98 A;  4DBQ A;  2DEU A;  3ZL7 C;  2RI5 A;  2NWM A;  4M77 C;  2HNI A;  1EOV A;  4M78 C;  1W4S A;  1QLY A;  2ZGW A;  1ZLM A;  1B3Q A;  4LVJ A;  2DJZ A;  1JJC B;  2QI2 A;  5LJ3 e;  1WX6 A;  1TUG B;  4M75 D;  3S3N A;  3X20 B;  2RA2 A;  4RUG A;  3RDV A;  5FLX E;  1YI2 Q;  3M59 A;  2ESW A;  4B6M A;  3OYL A;  5CQX A;  1H3H A;  2JTE A;  1U1S A;  5GAN e;  1NJ8 A;  3V8K A;  3G6E A;  2KRN A;  1QP3 A;  2PVG B;  3H9N A;  2H3J A;  3NFC A;  5IT9 E;  2CSI A;  1WHJ A;  4UP8 A;  1ZBJ A;  5I22 A;  3OW2 A;  3I55 A;  3VS3 A;  1NYF A;  4QVZ A;  3SDZ A;  3QKJ A;  1FMK A;  4F7U F;  3CCM T;  4M7D E;  3EHQ A;  3QXE B;  2P0Q A;  5CKD A;  4J9D A;  1VQ7 T;  1GFD A;  2F1L A;  2JNG A;  2QXF A;  1K1Z A;  3M0T A;  4J7F A;  1M9S A;  1NJ6 A;  3L2V A;  2QK0 A;  1B34 A;  2HSE B;  1KQ1 A;  2ECZ A;  3MEU A;  1MUZ A;  2YUP A;  3M4P A;  2BKD N;  1OX9 A;  2PVD B;  4MMK A;  4YRC A;  4F7U G;  2Z0W A;  4V2S A;  2E5Q A;  3UGQ A;  2KDS A;  3QBY A;  1Q82 C;  2DIG A;  1NJ2 A;  2LQW A;  1ASY A;  3MET A;  3VUZ A;  3NEL A;  1BU1 A;  2O9V A;  5KCH A;  1NYR A;  2DU5 A;  4P73 A;  1E24 A;  2LQ8 A;  3EGD B;  1YJ9 Q;  3CC7 T;  2ALY B;  3F70 A;  2MAM A;  3M9Q A;  3M0S A;  2ZPG B;  3M5A A;  2HDA A;  1PM3 A;  1UJ0 A;  4RTZ A;  4XK8 E;  3JCM V;  1NEB A;  4EMK A;  4BI8 B;  4O5V A;  2KGT A;  4YRO A;  4B9X A;  1YFN A;  4ZGE B;  1BKB A;  4TVW A;  3R6N A;  5EG2 A;  1VQM A;  1RAA B;  4M78 D;  4K11 A;  2RN8 A;  3PE0 A;  2Q7H A;  2LDM A;  3VQV A;  4PJO D;  3E9G A;  3HTR A;  2EJ9 A;  3PVQ A;  4OGE A;  4KUI A;  4A4K A;  2CJB A;  3O5Z A;  1UEC A;  1LJO A;  3HY1 A;  4LDU A;  1B7Y A;  1QCN A;  3KFV A;  5GAN 4;  2M51 A;  4YRE A;  4C5G A;  3S6W A;  4M7D A;  1JU5 C;  2LCS A;  3REB B;  1OYX A;  1BYM A;  4ZGD B;  3RNJ A;  3CMA Q;  2E64 A;  3RER A;  4RTY A;  3HXX A;  2XU8 A;  3OYB A;  3VUB A;  1EIY A;  2A28 A;  1Y7X A;  2FZK B;  2RMO A;  1VQ7 A;  3VJP A;  5KE3 A;  3NET A;  4KT0 E;  1FX7 A;  2V8I A;  2YRV A;  2RH2 A;  5GAO n;  1B34 B;  3QDR B;  1BCM A;  2MOX A;  4PJO C;  4Y91 A;  2X4Y A;  4LXC A;  3OY9 A;  3MPU B;  5FRO A;  1BCO A;  5GMK e;  4YRK A;  4YRF A;  3CBM A;  4EMK B;  1IXD A;  3CPW P;  1YGB A;  2DQ0 A;  1JJC A;  1G51 A;  3H0I A;  4UPA A;  1OZ3 A;  4BDY A;  4YRN A;  3A7A A;  3JCM W;  3HXW A;  5CQY A;  3CCQ T;  2ATC B;  2LNV A;  4PJO E;  4WF2 A;  3NPF A;  5GAN 5;  2RHQ B;  4J6W A;  1WJQ A;  1RI0 A;  3VQY A;  4A4G A;  4TVR A;  4LVK A;  1M3C A;  4K88 A;  2DXU A;  3CCM A;  1OI1 A;  4C0D C;  2BTT A;  1UGS B;  1RL2 A;  1AWJ A;  1K9A A;  1PRL C;  1XJW B;  3KFU A;  3LWI A;  4ZTJ A;  3A8O B;  4M75 F;  1WLP B;  4H2U A;  2K7A A;  2M0Y A;  5D6X A;  2LX9 A;  4II1 A;  2ZZE A;  2PTK A;  4BE1 A;  3MQZ A;  2EGC A;  2XDP A;  1VQ4 Q;  1VQZ A;  5K1X A;  3EGD A;  3CBP A;  5AYF A;  5GAN j;  1R77 A;  1OPL A;  4JLI A;  2DVJ A;  3GF5 A;  3LWH A;  1M90 U;  2QGF B;  1H4T A;  4MZT A;  2R5A A;  3VS6 A;  1Y0M A;  2ZAE A;  1OPK A;  2KVQ G;  2ARU A;  4J9F A;  3R07 A;  4YPF A;  1G83 A;  3FRN A;  2R5M A;  4JJN K;  2IY5 A;  3JB9 H;  4MZP A;  4M75 E;  3EGU A;  2HEQ A;  2FPF A;  3C0C A;  1E1O A;  3ZFJ A;  3PGG A;  4JRI A;  4H02 A;  1IL2 A;  1KK7 A;  2XTI A;  4GY5 A;  2DL5 A;  3BW1 A;  2KT1 A;  2K2V A;  4RCB A;  9ATC B;  1IZ6 A;  4Y92 A;  1MV3 A;  1Y07 A;  4ORZ A;  4PJM A;  4C5H A;  2NUP B;  2PNI A;  1G3Y A;  4M75 C;  1WIE A;  2CS7 A;  3UA6 A;  2PME A;  4Y28 E;  4LDX A;  3E1S A;  1T0H A;  1X43 A;  5C51 B;  2LTO A;  4XU1 A;  3A8L B;  4M7A E;  2L3P A;  3S3M A;  1ATI A;  4PFO A;  4HXJ A;  2M02 A;  3NTI A;  4HCK A;  1T0J A;  3MO8 A;  4CC7 A;  1QWE A;  4BD3 A;  4MDW A;  3DLM A;  4WTO B;  4J5Y A;  3FJ5 A;  4M77 E;  1SHG A;  3JAM E;  3GNG A;  2JTF A;  4M77 D;  1VQP T;  2NLU A;  3VYH B;  4C92 D;  3TQ7 P;  3CCR A;  1USY C;  4BY6 B;  2NUT B;  5IN1 A;  4DEX A;  1AT1 B;  2KY9 A;  4FSX A;  2C0O A;  4X9D A;  4A4F A;  3OW2 P;  2HL3 A;  1M1K U;  5GAM h;  5FU6 C;  1JXO A;  1D0Y A;  1YB3 A;  2A37 A;  3FEO A;  2OTL Q;  1G5V A;  4PL6 A;  1UTI A;  1WFW A;  2LQK A;  4P3P A;  1HYO A;  2EKO A;  1QVF P;  3CCE A;  2EL9 A;  3U23 A;  1Q81 R;  2CKK A;  3CCE T;  3C94 A;  2ZT8 A;  4BAC A;  5D6W A;  3IG2 A;  2VXF A;  4XU2 A;  1FMW A;  1VQL Q;  4YRI A;  4UC4 A;  4PJJ A;  1Q7Y U;  3L2R A;  5E3I A;  5KCO A;  3DB4 A;  3CQT A;  2QAZ A;  2ALY A;  1Z7N A;  2DEQ A;  5GMK m;  2FL7 A;  3M57 A;  4DBH A;  2KRS A;  1KD1 C;  4HWP A;  2XDB A;  3OS2 A;  3LH0 A;  2F2V A;  1OV3 A;  4CI0 C;  1YFS A;  1PD1 A;  5LJ5 d;  1NLO C;  4IIO A;  2P0P A;  1IHW A;  4FYX B;  1YJ9 A;  2EQK A;  2E65 A;  2QQA A;  1YP5 A;  2VAS A;  4D6W A;  1VQ6 A;  4J9G A;  1EIF A;  1UHF A;  1F1B B;  1VIF A;  1VQN A;  3CCJ T;  4H2X A;  2QHU A;  2E12 A;  3VQX A;  2VGN A;  2AKL A;  1K0S A;  4IIM A;  2HL5 C;  2F2X A;  1OU9 A;  4N0A C;  4EX5 A;  4KGV B;  3GP8 A;  4C0F A;  2C0I A;  2NYS A;  5GAN g;  3OS0 A;  1VQ8 T;  2DNU A;  4YCV A;  2XI9 A;  3P8T A;  3EG0 A;  1VQ9 Q;  1RI9 A;  1BI0 A;  1QKW A;  3HY0 A;  4Q15 A;  3QYG B;  5LJ3 g;  3RBB B;  2YUQ A;  1YWP A;  1JJ2 P;  5HK0 A;  1GBR A;  1YIT A;  3G1J A;  2LJ0 A;  3P8V A;  1SRL A;  1VYV A;  1NLP C;  1EVL A;  4A4E A;  4TVY A;  3H6Z A;  4E2F B;  4M78 A;  2EGA A;  2Y4Y A;  2YRC A;  2KYB A;  5A0L A;  2O9S A;  5LJ5 g;  4Z88 A;  3G4S Q;  4ZTU B;  4X9C A;  3CC4 T;  4C5I A;  1YJN Q;  3A5Y A;  2XKO C;  2PMF A;  1XTD A;  2MIO A;  5DLO A;  2DTH A;  4F7U E;  3MP6 A;  4C8Q A;  4XEM A;  5DM7 R;  4M75 B;  4QW2 A;  4BE0 A;  4KH0 B;  2C8M A;  4YRG A;  1NG2 A;  2VVK A;  4XTU A;  2DKG A;  2EVR A;  2OTL T;  4YRQ A;  2QQR A;  2EBP A;  3PFS A;  1QVP A;  2JTM A;  2ROT A;  3QUI A;  1M2O A;  3JCM f;  2DL7 A;  1FYN A;  3JCM d;  5KYW A;  5KYX A;  4JRP A;  1B7Y B;  4HKE A;  2ZT6 A;  4RQF A;  4ELZ C;  5KNN A;  4CS4 A;  4J7I A;  1Q82 R;  2RHI A;  1YN8 A;  1BB9 A;  2SEM A;  1YIJ T;  2GFA A;  5D7U A;  4QKU A;  3HXY A;  2V1Q A;  1PWT A;  4J6X A;  1JRI A;  2BZ8 A;  2DO3 A;  3REA B;  5HGQ A;  2F69 A;  2EYY A;  4PFP A;  4P5N A;  1YCY A;  2AIR B;  3H41 A;  2OTJ T;  3N5B B;  1KD1 R;  2AHJ B;  1VQK Q;  2V26 A;  2MK5 A;  2ED0 A;  3HXU A;  1AEY A;  4PJO F;  1Y71 A;  4YRR A;  2EW3 A;  2DU7 A;  2ZTG A;  4LD6 A;  1VYT A;  2IVW A;  2AMC B;  2V8J A;  1X75 C;  4NCX A;  1KHI A;  4X1V A;  3J80 E;  1KC8 U;  2A3L A;  3G4S A;  5IH2 A;  2FB7 A;  4KUL A;  2EQU A;  3UT1 A;  2GTJ A;  3L2Q A;  3NGP A;  4QT7 A;  4JS4 A;  4OB1 B;  1QVF A;  1ZQ1 A;  1G5I A;  3JCM g;  2FO0 A;  3SD4 A;  2A0F B;  3CCR T;  4Q6G A;  3M0R A;  1BI2 A;  2K3Y A;  2I4L A;  2ZT7 A;  2RI3 A;  3OSS C;  1YNZ A;  2LJ3 A;  2SRC A;  4YDQ A;  3A8G B;  1KD1 U;  1BBZ A;  5GAO p;  2L3R A;  3HL8 A;  2JM8 A;  2OTJ A;  2E5K A;  4EMK C;  4B9W A;  2P0K A;  3CCS A;  1N9W A;  1MND A;  1X2G A;  2DQ3 A;  2J05 A;  4EDU A;  4ZN3 A;  3VS7 A;  1ZSZ B;  4CH4 A;  2LC4 A;  1VQ6 Q;  4Z02 A;  1ABQ A;  4XU0 A;  4M7A G;  3OYD A;  4P73 C;  4LVI A;  2E3I A;  1N8R C;  2K4Y A;  3CCM Q;  4ZTF A;  2ZPF B;  3VYG A;  4XTX A;  4IKF A;  1N5Z A;  1K9M U;  1D0X A;  2A08 A;  3RAC A;  2RQW A;  1I8F A;  1R8O B;  3O8V A;  2QTV A;  2VB6 A;  2QA4 T;  2BE9 B;  3EFO B;  3IAL A;  1G3T A;  1VQP A;  1VQ9 A;  2AZV A;  2RK2 A;  5LJ3 f;  2DZ9 A;  1OOT A;  1Z7M A;  4YRM A;  4F17 A;  5CR2 A;  1YHQ T;  1K8A U;  4OMF B;  5F5W A;  1B07 A;  1VIE A;  1UFF A;  2J6O A;  4UP7 A;  2QAS A;  4C8Q G;  2KRM A;  2MI6 A;  3QO5 A;  1TH7 A;  3CC4 A;  3NHN A;  1NJ5 A;  5IHI A;  1VQ5 A;  1H4S A;  2FEI A;  2DE0 X;  3A8M B;  2JOY A;  4BY6 C;  3OYG A;  2D0Q B;  3ME9 A;  1MGQ A;  4YYE A;  2X3W D;  3JCM J;  2VKN A;  2CP0 A;  1B8A A;  7AT1 B;  1PKS A;  1QF6 A;  2COY A;  2K79 A;  3RR6 A;  2RB6 A;  1NYG A;  1RIQ A;  1YIT T;  2YHT A;  3A32 A;  1XNI A;  3CCL T;  1TS9 A;  3A5Z A;  2YLB A;  4HA8 A;  2RHU A;  1QP2 A;  2RQT A;  2XDD A;  4O6J A;  3A5Z B;  4AH6 A;  3SEM A;  3G71 A;  1OZ2 A;  1PKT A;  2E6N A;  2K5F A;  2JN0 A;  5IXF A;  1AWO A;  1WU7 A;  4N4H A;  3CCV T;  1GBQ A;  2D6F A;  3HKS A;  1Y57 A;  2DYB A;  2CZ0 B;  2O4X A;  3QZ9 B;  4AG2 C;  1SSH A;  4FYV B;  5GAM g;  2I4N A;  4WJ4 A;  1WYX A;  2E41 A;  2JMA A;  4PJL A;  2KSS A;  3M53 A;  2RF0 A;  2GF7 A;  1X69 A;  2X4W A;  3VKI A;  2HBW A;  3A74 A;  4FIB A;  3NEM A;  4E7I A;  1M27 C;  3X26 B;  2PQW A;  2RHY A;  2FZC B;  1UJY A;  1OEB A;  3CCJ Q;  3G1Z A;  1GCQ C;  1VQK A;  3G71 T;  3JB9 I;  4PJO G;  2GBQ A;  3QO7 A;  2WAC A;  2LCC A;  4JDS A;  4WJ3 M;  4NOY A;  4L5G A;  2LZ6 B;  3HXZ A;  2JW4 A;  2WSF E;  1Q82 U;  5IXB A;  4KQE A;  3A1P A;  2DTO A;  2AKK A;  1QVF S;  4MDX A;  4Z89 A;  1KC8 C;  4RKU E;  3HXV A;  1RUW A;  2K57 A;  1VQL T;  3M0P A;  2RHX A;  1Q86 R;  1M2V A;  2EGE A;  1YI2 T;  1KJW A;  5CK9 A;  1CKA A;  3I56 T;  3OS5 A;  1S1N A;  2DL8 A;  2CP5 A;  1UDL A;  3TSZ A;  2WSC E;  2DL3 A;  4M7A A;  2HQH A;  2MWO A;  2J6K A;  4Z8A A;  3HRU A;  3L4G A;  4JUV A;  1BI3 A;  5IAY A;  1M4Z A;  4L59 A;  3VS5 A;  1UGP B;  3QII A;  3TCJ A;  1V29 B;  4BDZ A;  3I55 Q;  3LW5 E;  2EQJ A;  1YFT A;  2Y90 A;  2JVV A;  5DLQ E;  2O88 A;  2KBT A;  2DTI A;  1VQ7 Q;  1SHF A;  1WHL A;  1XOV A;  5GAO r;  2RK1 A;  3LSS A;  1OU8 A;  4C8Q F;  4C0G A;  2VV5 A;  1WZO A;  1U06 A;  3G6E Q;  1M5Q 1;  2KAF A;  3OYC A;  4OB3 B;  1U3O A;  2EKH A;  1ASZ A;  2EQM A;  3D7S B;  2E1H A;  3CCU T;  2P5I A;  1W70 A;  5K1P A;  2X51 A;  3RIR A;  1N27 A;  1GXI E;  3REU A;  4PJO B;  1WA7 A;  4LE9 A;  3JCM e;  4E7J A;  1ACM B;  5KYN A;  3CCS T;  3EG9 A;  3TVT A;  3AHU A;  1VQO Q;  5FWB A;  2XIC A;  1KSW A;  2EYZ A;  3CXC P;  3WQZ A;  1X56 A;  4A4H A;  3X25 B;  2LT4 A;  4PLL A;  1YWO A;  2AKW A;  2J3M A;  3UAT A;  1YCS B;  1EFN A;  2P0L A;  4LDY A;  2FVU A;  1C6V X;  2CSQ A;  2FHD A;  4IUQ A;  3INZ A;  2L2P A;  2LMJ A;  2RHQ A;  1M30 A;  3HTZ A;  1KQ2 A;  3HRT A;  2HKQ B;  2YUO A;  4RTU A;  4OMQ A;  4KGX B;  2X4X A;  3GBQ A;  3PCO B;  5J3B A;  4IUP A;  2K6D A;  4ATO A;  4FT4 A;  3I55 T;  4FU6 A;  5HCK A;  4C92 G;  4OLF A;  2EWN A;  4ANJ A;  3UGT A;  2AZS A;  2KXC A;  1BI1 A;  3HFZ B;  4HWR A;  2ZNI A;  3M4G A;  2EYQ A;  4HWO A;  2Q5H A;  1SRM A;  2ZZG A;  4C92 F;  3Q1J A;  1ZBX A;  2KNB B;  2QHT A;  4OMN A;  2R57 A;  2BUD A;  1RAE B;  2I0N A;  2VUB A;  2XMF A;  4N4I A;  4E6R A;  4A53 A;  2JMC A;  1E7O A;  3LH5 A;  3M4Q A;  4HT8 A;  2FG0 A;  3DKM A;  1C0A A;  4M78 E;  5EC7 A;  3OYY A;  1WJS A;  1N9S A;  2OAU A;  3L1A A;  3GOX A;  2F5T X;  2EQI A;  1MHN A;  4PJN A;  3CCQ A;  2RQV A;  2CDT A;  3QDF A;  2K5L A;  4XU3 A;  1YIJ A;  5GAN 8;  4QQ6 A;  1X54 A;  1QCO A;  3LYI A;  3UFG A;  3DLL A;  3A7R A;  1VQ8 Q;  3RF1 A;  1FXX A;  1X55 A;  4LVL A;  4CS2 A;  4ESR A;  2CJA A;  2ZIM A;  1VQM Q;  3CCV A;  3PMI A;  3OMG A;  1X6G A;  2OTL A;  5C52 B;  3T9N A;  2JZ2 A;  4RG8 A;  3H0H A;  3CPF A;  5J26 A;  2O01 E;  2XK0 A;  4KRT A;  2M1H A;  3NEN A;  4J8O A;  1ARK A;  2ARS A;  2CH4 W;  1RAF B;  1Q95 G;  1KC8 R;  3ASK A;  4H2W A;  1WJR A;  1EVK A;  3CCL A;  2LNH B;  5CO7 A;  1UGR B;  2J06 A;  2XHC A;  1S72 T;  2ZPB B;  1HK9 A;  1TXQ A;  5J39 A;  2QGG A;  3QWY A;  3HFV A;  3CCL Q;  1RLP C;  3CME A;  2DYI A;  2M16 A;  1X6O A;  1YIT Q;  1RAD B;  1PSE A;  1BIB A;  5CAI A;  4M78 B;  3E9I A;  1AHJ B;  3JCM h;  11AS A;  1H92 A;  1HC7 A;  3CC2 T;  1KMM A;  1QCF A;  4ELY C;  3QO8 A;  4TVA B;  4P71 C;  4CS3 A;  3I56 A;  1M1G A;  3WVD B;  4G84 A;  4OMO A;  4CH5 A;  2Q5I A;  3AT1 B;  1RAG B;  2P4T A;  1VQN T;  2JM9 A;  3JCM Q;  4YRP A;  5C53 B;  1B7T A;  1SRY A;  2GCX A;  4MML A;  2ZCF B;  3PZC A;  4CH3 A;  4E51 A;  1VQ5 Q;  4EIK A;  2JT4 A;  3CCV Q;  1VQ4 A;  4HT4 A;  2KI7 A;  1K73 U;  2ROL A;  1TSF A;  3PIO A;  2EIF A;  2MPX C;  2CUD A;  1K0X A;  2QQ9 A;  3J7A F;  2KQW A;  1IRE B;  5FW9 A;  4C92 A;  1WNL A;  1QVG S;  3MEY A;  2OJ2 A;  5A0D A;  4P71 A;  5GAN 2;  3C12 A;  4D8D A;  2D0N A;  3RUX A;  1WYD A;  2CP2 A;  3CC7 Q;  3QNE A;  2KEA A;  5LJ5 j;  1W2B P;  3SWN B;  2DM1 A;  2RD1 A;  3H0F A;  2CH4 A;  5LL6 S;  1NPR A;  2IY5 B;  1EX4 A;  5GAM f;  2ODR C;  4DOW A;  1H8K A;  2CZ7 B;  3GIB A;  1SF9 A;  1CKB A;  2DK3 A;  3CD6 Q;  2ZT5 A;  2EAY A;  3RMQ A;  1WXT A;  4MZM A;  2KXD A;  4F7U B;  1L0W A;  4M78 F;  3PTA A;  1VQO A;  3KXT A;  4DBF A;  3FIF A;  2DVE A;  5GAO l;  4YRL A;  3OBY A;  4PNO A;  1K76 A;  2YLC A;  1C1A A;  1QWF A;  2QA4 Q;  3M0Q A;  4Q5W A;  1GCQ A;  2XG8 D;  5CVI A;  1ZSG A;  2MMP A;  1I5L A;  1PRM C;  1OUL A;  1G3W A;  3RKW A;  4EPC A;  2E4H A;  1MMD A;  2FRY A;  2HCK A;  4JRK A;  1LYL A;  4G85 A;  1WGS A;  3L2Z A;  2IG0 A;  3MHX A;  3HSB A;  2D9T A;  2PU9 B;  1B76 A;  2E10 A;  1PCX A;  3CC2 A;  1HSQ A;  3OS1 A;  2QG9 B;  3HRS A;  4BB7 A;  2ODR D;  1ZX6 A;  5CIU A;  4JJB A;  2ENM A;  1TOV A;  4RTW A;  5GAM e;  2OTJ Q;  5LJ3 h;  1C0M A;  1K8A C;  1GRI A;  2ZCE A;  2L89 A;  4RDX A;  4TTV A;  2DBM A;  1VQ4 T;  3E2U A;  5M9O A;  4IUV A;  4E7K A;  2J6F A;  3CC2 Q;  4XEO A;  2DFU A;  3E19 A;  3CD6 T;  1G5H A;  4KH1 B;  2Y4X A;  3I7F A;  12AS A;  4CH6 A;  1KQS A;  1V76 A;  3I56 Q;  1IHV A;  2QHS A;  1R0C B;  3MEW A;  2YXY A;  4FYW B;  1FYF A;  3HFZ A;  5IHK A;  2LVM A;  2RJF A;  4CC3 A;  3FLG A;  3IKL A;  4PFZ A;  4DOV A;  1Q81 C;  1AWW A;  3QWX X;  5I11 A;  1NJ1 A;  2VYT A;  1RAI B;  1N9R A;  4LNP A;  2EJF A;  4QQD A;  4LUD A;  1RLQ C;  5FWC A;  4OML A;  1D1B A;  1U5S A;  4R56 A;  1Y96 A;  1SPK A;  3M54 A;  1MNE A;  2X4J A;  5FU7 B;  3G7Z A;  2LCL A;  1YFR A;  3CCJ A;  2G4C A;  4EMH A;  2EFI A;  4J83 A;  1WHH A;  1YJN T;  5CKB A;  2K2M A;  2C0T A;  2KT8 A;  2RNA A;  1VQK T;  1IB8 A;  3CMQ A;  1SG5 A;  2EYX A;  3VU3 C;  2DZC A;  2G6F X;  3VV0 A;  1NBE B;  3OYJ A;  4YCU A;  1ZUU A;  2JJ9 A;  3CPW S;  2RJE A;  5GAM d;  4CC4 B;  4J15 A;  4AFU C;  5FRM A;  2FZG B;  2K5I A;  3LX7 A;  3V7C A;  3PMT A;  4PHC A;  2QEX Q;  4J9B A;  4A54 A;  5I2S A;  3UH0 A;  1I0C A;  1OX8 A;  3JSC A;  3RGL A;  5GAO m;  4K86 A;  4LVM A;  1Z9Q A;  2FPD A;  3C95 A;  3ZEH A;  2GGR A;  4RMF A;  5FU6 B;  2M0O A;  5LJ3 d;  4ZIB A;  2ZPI B;  3RKY A;  4VUB A;  1PC0 A;  2RHZ A;  1QE0 A;  4LDV A;  8AT1 B;  2ZXF A;  4C8Q C;  4DA4 A;  1K4U S;  1M3B A;  5GAN 7;  1W66 A;  3I9Q A;  1UUE A;  1JBM A;  1M1K C;  1HJD A;  1QQJ A;  1PYS A;  1ZUY A;  3OYE A;  5KH6 A;  4GLK A;  3CXC S;  3NTH A;  4RQE A;  1H4Q A;  3QO3 A;  2X35 A;  5KYU B;  1WLE A;  3TEH B;  1S72 A;  1X2H A;  3HRI A;  4IUT A;  3MF2 A;  1D3B A;  4P72 A;  1VQ8 A;  1E1T A;  2COZ A;  2RPN A;  3MP8 A;  1Q7Y C;  1D3B B;  4E7H A;  3LSQ A;  4GBQ A;  3G71 Q;  4YRJ A;  3EH2 A;  4K87 A;  2E6Z A;  4QVC A;  1YJW T;  1JO8 A;  1WI7 A;  3KUF A;  4AG1 C;  2QA4 A;  2KYM A;  3CPW A;  2ZPH B;  4QVD A;  1GGM A;  3MEA A;  2OAW A;  1ABO A;  1H3Z A;  4LDW A;  2ZNJ A;  5LJ5 e;  4YRS A;  2CIM A;  1K9M R;  4FM4 B;  4M77 G;  3CCU A;  2J3L A;  3HRK A;  3LGL A;  1IGQ A;  2LJ1 A;  2QDL A;  5I21 A;  4PKC C;  2RM4 A;  4DEY A;  4OMM A;  4IUU A;  4E7Z A;  3CCU Q;  3OW2 S;  3M0U A;  1IO6 A;  1VQP Q;  4F7U A;  3OYH A;  1YIJ Q;  2A7Y A;  1I4K 1;  3NTK A;  1EZZ B;  1UGV A;  2VXE A;  2B86 A;  1M3A A;  2J7I A;  2VGM A;  3C4S A;  4BE2 A;  1GCP A;  2W10 A;  1J3T A;  1WQ7 A;  2I4O A;  1W1F A;  2HQE A;  4H2V A;  3OA6 A;  2LX7 A;  2X3X D;  2E3H A;  4GLM A;  3SWN A;  2DF6 A;  2QDY B;  4JS5 A;  2BE7 D;  4XQ3 A;  1QW1 A;  1WHG A;  2LP5 A;  1MMG A;  1ZHI A;  3URG A;  1VQL A;  1M8M A;  4M7A B;  1W2B A;  2E3C A;  2ART A;  4C8Q D;  8ATC B;  4JJD A;  3OBW A;  1X27 A;  3OYN A;  2YT6 A;  3J81 E;  3OQ5 A;  5CKE A;  3TSW A;  4AFQ C;  5GAO q;  1Y96 B;  3EFO A;  2CGH A;  4JZ4 A;  2DXC A;  5KYU A;  4HT9 A;  4H2S A;  3P8B B;  4HCC A;  3IKM B;  1MV0 B;  3CCS Q;  2DIQ A;  2P4R A;  4HVW A;  1CSK A;  3LC0 A;  5GMK i;  4TWA A;  2GQV A;  3HPW A;  1VUB A;  4BI3 A;  2DMO A;  1RAB B;  1KOG A;  4HWS A;  1M1K R;  3QYH B;  3MJX A;  1UE9 A;  1U1T A;  2L3Q A;  1NYQ A;  1V1C A;  3BE3 A;  2AK5 A;  3G6E T;  4M7A D;  4RTX A;  1PSF A;  3R6O A;  1ZA2 B;  1I07 A;  1SEM A;  2AT1 B;  4P74 C;  2YRD A;  2IIM A;  1KG1 A;  3JB9 F;  2JS2 A;  4HCZ A;  3CXC A;  3ER0 A;  3VRY A;  1M2V B;  4CRI A;  4QQG A;  2E5A A;  2K9G A;  1USY A;  1E6H A;  5KYY B;  4J9C A;  1UHC A;  1LOJ A;  2CYZ B;  3BY7 A;  2RJD A;  1VYU A;  2O4X B;  2ZZF A;  2MWP A;  3WXM B;  3REX A;  5L8R E;  4ZGJ B;  2HD0 A;  2XD0 A;  1EIY B;  1QKX A;  4FW1 A;  2LT1 A;  3EG9 B;  2COW A;  4M77 F;  4TQF A;  4DQ2 A;  3CCR Q;  1TWB A;  4AFS C;  1UB4 A;  1EQR A;  3G4S T;  4RG2 A;  3RL6 A;  2RJC A;  4KGZ B;  4M78 G;  1YJW Q;  2XGT A;  1GFC A;  4C0Z A;  2PUK B;  1ADJ A;  1H4V B;  3FB9 A;  5D6Y A;  3CBO A;  4M75 A;  3SHW A;  1YBY A;  3CCQ Q;  3MEV A;  1M90 R;  2ED1 A;  1AOJ A;  3X24 B;  2HSP A;  2F2W A;  3MF1 A;  4M7A C;  3HFN A;  1VQ5 T;  2AKW B;  2PVO B;  2RQR A;  4LUE A;  5GMK l;  1AWX A;  3FC3 A;  2BZY A;  2RQU A;  2GNC A;  3A7U A;  4M77 A;  4RCC A;  3EAE A;  1ZUK A;  4J9I A;  2QQS A;  2DXB A;  2ZIO A;  1BBW A;  5GMK h;  1TG0 A;  3EFR A;  3DSQ A;  4JRQ A;  2YDL A;  3QSU A;  4WCI A;  2G3R A;  5CKF A;  4AT1 B;  3I5S A;  2DJQ A;  5CCA A;  4ZTZ B;  2HQX A;  4OGC A;  1ZSZ C;  4TQD A;  2WSE E;  1IGU A;  2O2O A;  2M9U A;  5FU7 C;  1WDX A;  1NJI U;  3TU4 K;  2KR3 A;  4R0K A;  3V7R A;  1M90 C;  4P3N A;  2QTX A;  2DD5 A;  5A0G A;  4M7A F;  3CMA T;  3P8D A;  4R55 A;  4XTZ A;  1KMN A;  2YUN A;  4M77 B;  5HK3 A;  4KR2 A;  3V7S A;  1JEG A;  3JB9 D;  2BZX A;  3SB2 A;  2PZ1 A;  3M55 A;  5KE2 A;  1NEG A;  2HZY A;  1K73 C;  2ZR2 A;  1D0Z A;  4FYY B;  1K9M C;  2CZ1 B;  1AD5 A;  3TUP A;  2R58 A;  2ZR3 A;  3OB9 A;  4L87 A;  5ELN A;  2OI3 A;  4RTV A;  4J9E A;  1KQS S;  1D09 B;  3ULR B;  2QEX T;  2KRO A;  3UA7 A;  3M58 A;  3SFM A;  4P74 A;  5CKH A;  4L6V 5;  2IPO B;  2DDZ A;  4PLI A;  3JCM b;  1VQM T;  1VA7 A;  4DPG A;  3MCA B;  1VQN Q;  2CRE A;  4P72 C;  3W3S A;  1SES A;  1NNH A;  1I1J A;  1QMC A;  3VRZ A;  1VQO T;  4NL2 A;  3NMZ C;  1YHQ Q;  1Q86 C;  2L0A A;  1PHT A;  2E70 A;  1MMN A;  3PNW C;  4UP9 A;  4YP0 A;  3L2W A;  3E9F A;  5LJ3 j;  4FCY A;  1WQW A;  1K8A R;  3EH1 A;  4HVV A;  3GLX A;  3JCM X;  1PG5 B;  5GAN h;  3QHS A;  3CC7 A;  2CP6 A;  1JXM A;  2CT3 A;  5DY9 A;  2XID A;  4OB2 B;  1B70 B;  1X6B A;  1LPL A;  4C5E A;  2O31 A;  2DL4 A;  3CEY A;  1Q81 U;  3QJY A;  2V1R A;  3FJP A;  5KYX B;  1BK2 A;  1NZ9 A;  3EGX A;  2HMA A;  3L4G B;  4RTT A;  1Q7Y R;  2C7I A;  5L23 A;  1KIK A;  3I35 A;  1IRX A;  3L2U A;  1HXD A;  1UGQ B;  1VQ6 T;  3CD6 A;  2GFU A;  1JJ2 A;  2W0Z A;  1I81 A;  4FW2 A;  1OQK A;  1Z9Z A;  4FL6 A;  6AT1 B;  3OYF A;  1TUC A;  4FSS A;  1P92 A;  3OYM A;  4FT2 A;  4M7D C;  2ZIN A;  1DJ7 B;  1H64 1;  2RI2 A;  2C06 A;  3ERR A;  1NJI R;  2X9H A;  4EMG A;  3TRE A;  4C8Q E;  1Q86 U;  2JXB A;  2D1X A;  3UWN A;  2YWW A;  1M8V A;  5FRN A;  4ME7 A;  5GMK j;  5A2Q E;  3MKD A;  4CC2 A;  3M4Y A;  3JCM c;  5HKC A;  3TEH A;  4M75 G;  4YRT A;  1JQQ A;  1QVG A;  4WI1 A;  4IUR A;  2D8H A;  4PJO A;  2EYW A;  4OVA A;  3THK A;  3E9H A;  2DIL A;  3HP9 A;  2CT4 A;  4C92 C;  4PG3 A;  1PNJ A;  1AVZ C;  1WPY A;  3OSV A;  3P8Y A;  3V8J A;  5LJ5 h;  2D8J A;  4H2T A;  2FYK A;  4H2Y A;  2NUP A;  2DRM A;  4E47 A;  4C8Q B;  1JJ2 S;  1NJI C;  1D1C A;  2K3X A;  4M7D D;  3QZ5 B;  4RMO A;  1U8R A;  5I2M A;  5GAN f;  5GAM j;  1G2B A;  3RMS A;  2DPP B;  3RKX A;  2DLP A;  2DAQ A;  1TU0 B;  3QPH A;  1M1F A;  3LLR A;  4F16 A;  1SSF A;  4X5O A;  1XQH A;  1UEB A;  1AZE A;  1N6A A;  2F5K A;  2H8H A;  5KYW B;  2PUO B;  1YJN A;  4EO4 A;  3UDC A;  2MYS A;  3VS2 A;  2GQI A;  4HVU A;  1W2B S;  4XTY A;  2EPD A;  2KK4 A;  2EJG A;  2RO0 A;  1TTH B;  1YJW A;  1KFZ A;  1HTT A;  2QHV A;  2P84 A;  4X34 A;  1PYS B;  1X01 A;  4BI4 A;  4DBR A;  4P75 C;  1S72 Q;  2ZPE B;  3HHT B;  1SER A;  1LNX A;  2FPE A;  3V8L A;  2CP3 A;  1WXB A;  2H3E B;  4BUG A;  4M4Z A;  4KUD K;  1FWZ A;  2I4M A;  1GL5 A;  3ZBD A;  1FMV A;  2CZ6 B;  5IHN A;  2L3S A;  1YI2 A;  3JV3 A;  3DB3 A;  1G8X A;  1T3S A;  2VWF A;  5HY6 A;  4H2X B;  4JJC A;  3WVE B;  4M7D F;  3P8H A;  1LVK A;  3UPU A;  3JB9 J;  1W6X A;  2DX1 A;  3FDR A;  2DD4 A;  1G3S A;  1RAH B;  4KBM B;  1E22 A;  3CC4 Q;  1PD0 A;  2MF2 A;  4J6Y A;  4E7L A;  3X28 B;  4BW9 A;  4YTL A;  2HBP A;  3CME Q;  1NPP A;  2A36 A;  3BDU A;  4LN2 A;  2LRQ A;  4OP0 A;  5GJW B;  5LJ5 f;  4N4G A;  4F04 B;  1D1A A;  2NUZ A;  3VS1 A;  2OX7 A;  1EFW A;  5C0M A;  4BWA A;  1E6G A;  4J9H A;  3KBG A;  3OYA A;  2QEX A;  3BDL A;  4E7S A;  1KQS P;  2Q7G A;  4ZNX A;  3EG2 A;  4LNS A;  4JLG A;  4C92 B;  1VQ9 T;  3LGF A;  1TUD A;  4AFZ C;  1ZSZ A;  2GTO A;  2V8K A;  1JB0 E;  5ELO A;  3QTC A;  3SWN C;  2HKN A;  2RHS B;  3VBB A;  4OF1 A;  3BFM A;  1K73 R;  3GNF B;  2I2L A;  3I5R A;  4XTV A;  3GPL A;  2BIV A;  2DER A;  4NL3 A;  3EFS A;  4JZ3 A;  3JCM P;  3RES A;  3UF4 A;  4HCB A;  2MCN A;  3JRZ A;  3S3O A;  3PVL A;  1T3L A;  5KYY A;  4LD9 K;  3H8Z A;  4M7D B;  4XTW A;  3ICA A;  3OYI A;  4AMC A;  4C92 E;  2HAX A;  3A31 A;  4HVC A;  3TEG A;  1NM7 A;  5GAN 6;  3VS4 A;  1ADY A;  1BBU A;  4TVA A;  1RAC B;  2L8D A;  2QQB A;  2QYZ A;  5ECA A;  3VS0 A;  3IQL A;  3OD1 A;  2RHS A;  3BJU A;  1HD3 A;  1SET A;  4F14 A;  5C6S A;  3A8H B;  5GJV B;  4HWT A;  3CMA A;  2Q7E A;  3EGX B;  2DET A;  2KE9 A;  4N0A A;  2AMC A;  4NS5 A;  2CP7 A;  5GAN d;  3MP1 A;  1YJ9 T;  2CJ9 A;  1B70 A;  3CCE Q;  3M56 A;  2B8A A;  3QG1 A;  3HFO A;  1O9S A;  1J5W A;  3JB9 G;  1KHC A;  3OYK A;  3PIP A;  1UG1 A;  2K3B A;  1AZG B;  1YHQ A;  1N8R U;  2DXT A;  4YCW A;  4A63 B;  4OMP A;  4ZN1 A;  4D8K A;  2ZZD A;  3EG3 A;  1SKU B;  3PCO A;  1NE8 A;  2LQN A;  1A0N B;  1O75 A;  1X2Q A;  2A8E A;  1X2K A;  4XAX B;  2NS6 A;  2VC8 A;  4JPB W;  2JUF A;  1WHK A;  4O2D A;  4OB0 B;  1QVG P;  2ABL A;  5GAN 3;  3EHR A;  4KR3 A;  2L5Q A;  2DA9 A;  3QJ6 A;  1ZA1 B;  4PK4 A;  2KMT A;  2DBK A;  3L42 A;  2YSQ A;  1LCK A;  2FRW A;  3VQW A;  1MMA A;  2JS0 A;  4C0D B;  3TEE A;  1VOM A;  3OMC A;  4P3O A;  2NUT A;  5AT1 B;  3CME T;  1R0B G;  4M7D G;  2CUB A;  1I5O B;  3PT9 A;  4P75 A;  1WXU A;  3EG1 A;  1BIA A; 
#chains in the Genus database with same CATH homology
 2RI5 A;  4M77 C;  2HNI A;  1EOV A;  4M78 C;  1W4S A;  2ZGW A;  4LVJ A;  2DJZ A;  1JJC B;  2QI2 A;  5LJ3 e;  4M75 D;  3S3N A;  3X20 B;  2RA2 A;  5FLX E;  3M59 A;  3OYL A;  5CQX A;  1NJ8 A;  1U1S A;  5GAN e;  3V8K A;  3G6E A;  1QP3 A;  2PVG B;  2H3J A;  3NFC A;  5IT9 E;  4UP8 A;  3OW2 A;  3I55 A;  4QVZ A;  3SDZ A;  3QKJ A;  4F7U F;  3CCM T;  4M7D E;  3QXE B;  2P0Q A;  5CKD A;  1VQ7 T;  2JNG A;  2QXF A;  4J7F A;  1M9S A;  1NJ6 A;  3L2V A;  1B34 A;  1KQ1 A;  3MEU A;  3M4P A;  2BKD N;  2PVD B;  4MMK A;  4YRC A;  4F7U G;  4V2S A;  2E5Q A;  3UGQ A;  2KDS A;  3QBY A;  1Q82 C;  2DIG A;  1NJ2 A;  1ASY A;  3MET A;  3VUZ A;  3NEL A;  5KCH A;  1NYR A;  2DU5 A;  4P73 A;  1E24 A;  2LQ8 A;  3CC7 T;  2ALY B;  3F70 A;  2MAM A;  3M9Q A;  2ZPG B;  3M5A A;  4XK8 E;  3JCM V;  4EMK A;  4BI8 B;  4O5V A;  4YRO A;  4B9X A;  4ZGE B;  1BKB A;  4TVW A;  5EG2 A;  1VQM A;  4M78 D;  2Q7H A;  2LDM A;  3VQV A;  4PJO D;  3E9G A;  2EJ9 A;  4OGE A;  4KUI A;  4A4K A;  2CJB A;  1LJO A;  3HY1 A;  4LDU A;  1B7Y A;  5GAN 4;  4YRE A;  4C5G A;  3S6W A;  4M7D A;  1OYX A;  1BYM A;  4ZGD B;  2E64 A;  3RER A;  3HXX A;  2XU8 A;  3OYB A;  3VUB A;  1EIY A;  1Y7X A;  1VQ7 A;  3VJP A;  5KE3 A;  3NET A;  4KT0 E;  1FX7 A;  2V8I A;  2YRV A;  2RH2 A;  5GAO n;  1B34 B;  3QDR B;  4PJO C;  4Y91 A;  2X4Y A;  3OY9 A;  5FRO A;  5GMK e;  4YRK A;  4YRF A;  3CBM A;  4EMK B;  1YGB A;  2DQ0 A;  1JJC A;  1G51 A;  4UPA A;  1OZ3 A;  4BDY A;  4YRN A;  3A7A A;  3JCM W;  3HXW A;  5CQY A;  3CCQ T;  2LNV A;  4PJO E;  4WF2 A;  5GAN 5;  2RHQ B;  4J6W A;  1WJQ A;  1RI0 A;  3VQY A;  4A4G A;  4TVR A;  4LVK A;  4K88 A;  2DXU A;  3CCM A;  1OI1 A;  4C0D C;  1UGS B;  1RL2 A;  3KFU A;  3LWI A;  4ZTJ A;  3A8O B;  4M75 F;  4H2U A;  2LX9 A;  5D6X A;  4II1 A;  2ZZE A;  4BE1 A;  3MQZ A;  2XDP A;  1VQZ A;  5K1X A;  3CBP A;  5AYF A;  5GAN j;  4JLI A;  3GF5 A;  3LWH A;  1M90 U;  1H4T A;  4MZT A;  2R5A A;  2KVQ G;  2ARU A;  3R07 A;  4YPF A;  3FRN A;  2R5M A;  4JJN K;  2IY5 A;  3JB9 H;  4MZP A;  4M75 E;  1E1O A;  3ZFJ A;  3PGG A;  4JRI A;  4H02 A;  1IL2 A;  2XTI A;  4GY5 A;  3BW1 A;  2K2V A;  4RCB A;  1IZ6 A;  1Y07 A;  4C5H A;  1G3Y A;  4M75 C;  2CS7 A;  2PME A;  4Y28 E;  4LDX A;  3E1S A;  5C51 B;  2LTO A;  4XU1 A;  3A8L B;  4M7A E;  3S3M A;  1ATI A;  3NTI A;  3MO8 A;  4BD3 A;  4MDW A;  3DLM A;  4J5Y A;  4M77 E;  3JAM E;  3GNG A;  2JTF A;  4M77 D;  1VQP T;  2NLU A;  3VYH B;  4C92 D;  3CCR A;  1USY C;  4BY6 B;  5IN1 A;  2KY9 A;  4FSX A;  4X9D A;  4A4F A;  1M1K U;  5GAM h;  5FU6 C;  1YB3 A;  3FEO A;  1G5V A;  4PL6 A;  2LQK A;  4P3P A;  2EKO A;  3CCE A;  2EL9 A;  2CKK A;  3CCE T;  3C94 A;  2ZT8 A;  4BAC A;  5D6W A;  3IG2 A;  2VXF A;  4XU2 A;  4YRI A;  4UC4 A;  1Q7Y U;  3L2R A;  5E3I A;  5KCO A;  3DB4 A;  2ALY A;  1Z7N A;  2DEQ A;  5GMK m;  2FL7 A;  3M57 A;  1KD1 C;  4HWP A;  2XDB A;  3OS2 A;  3LH0 A;  4CI0 C;  1YFS A;  5LJ5 d;  2P0P A;  1YJ9 A;  2EQK A;  2E65 A;  2QQA A;  4D6W A;  1VQ6 A;  1EIF A;  1VIF A;  1VQN A;  4H2X A;  3CCJ T;  2QHU A;  2E12 A;  3VQX A;  2VGN A;  4N0A C;  4EX5 A;  3GP8 A;  4C0F A;  5GAN g;  3OS0 A;  1VQ8 T;  4YCV A;  2XI9 A;  3P8T A;  1BI0 A;  3HY0 A;  4Q15 A;  3QYG B;  5LJ3 g;  5HK0 A;  1YIT A;  3P8V A;  1EVL A;  4A4E A;  4TVY A;  3H6Z A;  4M78 A;  2Y4Y A;  5A0L A;  5LJ5 g;  4ZTU B;  4X9C A;  3CC4 T;  4C5I A;  3A5Y A;  2XKO C;  2PMF A;  1XTD A;  5DLO A;  2DTH A;  4F7U E;  3MP6 A;  4C8Q A;  4XEM A;  5DM7 R;  4M75 B;  4QW2 A;  4BE0 A;  2C8M A;  4YRG A;  4XTU A;  2DKG A;  2OTL T;  4YRQ A;  2QQR A;  3PFS A;  1QVP A;  2JTM A;  3QUI A;  3JCM f;  3JCM d;  4JRP A;  1B7Y B;  4HKE A;  2ZT6 A;  4RQF A;  4ELZ C;  5KNN A;  4CS4 A;  4J7I A;  2RHI A;  1YIJ T;  2GFA A;  3HXY A;  4J6X A;  1JRI A;  2DO3 A;  5HGQ A;  2F69 A;  4P5N A;  1YCY A;  2OTJ T;  3N5B B;  2AHJ B;  3HXU A;  4PJO F;  1Y71 A;  4YRR A;  2DU7 A;  2ZTG A;  4LD6 A;  2IVW A;  2AMC B;  2V8J A;  1X75 C;  4NCX A;  1KHI A;  3J80 E;  1KC8 U;  2A3L A;  3G4S A;  2FB7 A;  4KUL A;  2EQU A;  3UT1 A;  3L2Q A;  4JS4 A;  4OB1 B;  1QVF A;  1ZQ1 A;  1G5I A;  3JCM g;  3SD4 A;  3CCR T;  4Q6G A;  1BI2 A;  2K3Y A;  2I4L A;  2ZT7 A;  2RI3 A;  3OSS C;  4YDQ A;  3A8G B;  1KD1 U;  5GAO p;  2L3R A;  3HL8 A;  2OTJ A;  4EMK C;  4B9W A;  2P0K A;  3CCS A;  1N9W A;  1X2G A;  2DQ3 A;  4EDU A;  4ZN3 A;  4CH4 A;  2LC4 A;  4Z02 A;  4XU0 A;  4M7A G;  3OYD A;  4P73 C;  4LVI A;  1N8R C;  2K4Y A;  4ZTF A;  2ZPF B;  3VYG A;  4XTX A;  4IKF A;  1K9M U;  3RAC A;  1I8F A;  1R8O B;  3O8V A;  2QA4 T;  3IAL A;  1G3T A;  1VQP A;  1VQ9 A;  2RK2 A;  5LJ3 f;  2DZ9 A;  1Z7M A;  4YRM A;  5CR2 A;  1YHQ T;  1K8A U;  4OMF B;  5F5W A;  1VIE A;  4UP7 A;  4C8Q G;  2MI6 A;  3QO5 A;  1TH7 A;  3CC4 A;  1NJ5 A;  1VQ5 A;  1H4S A;  3A8M B;  4BY6 C;  2JOY A;  3OYG A;  2D0Q B;  3ME9 A;  1MGQ A;  4YYE A;  3JCM J;  1B8A A;  1QF6 A;  2RB6 A;  1RIQ A;  1YIT T;  2YHT A;  3A32 A;  1XNI A;  3CCL T;  3A5Z A;  2YLB A;  4HA8 A;  2RHU A;  1QP2 A;  2XDD A;  4O6J A;  3A5Z B;  4AH6 A;  3G71 A;  1OZ2 A;  2E6N A;  2K5F A;  2JN0 A;  1WU7 A;  4N4H A;  3CCV T;  2D6F A;  3HKS A;  2CZ0 B;  2O4X A;  3QZ9 B;  5GAM g;  2I4N A;  4WJ4 A;  2E41 A;  2KSS A;  3M53 A;  2GF7 A;  2X4W A;  3VKI A;  3A74 A;  4FIB A;  3NEM A;  4E7I A;  3X26 B;  2PQW A;  2RHY A;  3G1Z A;  1VQK A;  3G71 T;  3JB9 I;  4PJO G;  3QO7 A;  2WAC A;  2LCC A;  4JDS A;  4WJ3 M;  4NOY A;  4L5G A;  3HXZ A;  2WSF E;  1Q82 U;  4KQE A;  2DTO A;  1QVF S;  4MDX A;  1KC8 C;  4RKU E;  3HXV A;  2K57 A;  1VQL T;  2RHX A;  1YI2 T;  5CK9 A;  3I56 T;  3OS5 A;  2WSC E;  4M7A A;  2MWO A;  3HRU A;  3L4G A;  4JUV A;  1BI3 A;  5IAY A;  1M4Z A;  4L59 A;  1UGP B;  3QII A;  3TCJ A;  1V29 B;  4BDZ A;  3LW5 E;  2EQJ A;  1YFT A;  2Y90 A;  2JVV A;  5DLQ E;  2DTI A;  1XOV A;  5GAO r;  2RK1 A;  3LSS A;  4C8Q F;  4C0G A;  2VV5 A;  1M5Q 1;  2KAF A;  3OYC A;  4OB3 B;  1ASZ A;  2EQM A;  2E1H A;  3CCU T;  2P5I A;  5K1P A;  3RIR A;  1N27 A;  1GXI E;  3REU A;  4PJO B;  3JCM e;  4E7J A;  3CCS T;  3AHU A;  2XIC A;  3WQZ A;  1X56 A;  4A4H A;  3X25 B;  2LT4 A;  4PLL A;  2AKW A;  2J3M A;  2P0L A;  4LDY A;  2FVU A;  2FHD A;  4IUQ A;  3INZ A;  2RHQ A;  3HTZ A;  1KQ2 A;  3HRT A;  2X4X A;  3PCO B;  5J3B A;  4IUP A;  4ATO A;  4FT4 A;  3I55 T;  4FU6 A;  4C92 G;  4OLF A;  2EWN A;  3UGT A;  1BI1 A;  3HFZ B;  4HWR A;  2ZNI A;  3M4G A;  2EYQ A;  4HWO A;  2Q5H A;  2ZZG A;  4C92 F;  3Q1J A;  1ZBX A;  2QHT A;  2R57 A;  2BUD A;  2VUB A;  4N4I A;  4A53 A;  3M4Q A;  4HT8 A;  3DKM A;  1C0A A;  4M78 E;  1WJS A;  3OYY A;  1N9S A;  2OAU A;  3L1A A;  3GOX A;  2F5T X;  1MHN A;  3CCQ A;  2K5L A;  4XU3 A;  1YIJ A;  5GAN 8;  4QQ6 A;  1X54 A;  3LYI A;  3UFG A;  3DLL A;  3A7R A;  3RF1 A;  1FXX A;  1X55 A;  4LVL A;  4CS2 A;  2CJA A;  2ZIM A;  3CCV A;  3PMI A;  3OMG A;  2OTL A;  5C52 B;  3T9N A;  2JZ2 A;  4RG8 A;  3CPF A;  5J26 A;  2O01 E;  2XK0 A;  2M1H A;  3NEN A;  4J8O A;  2ARS A;  3ASK A;  4H2W A;  1WJR A;  1EVK A;  3CCL A;  5CO7 A;  1UGR B;  2XHC A;  1S72 T;  2ZPB B;  1HK9 A;  5J39 A;  3HFV A;  3CME A;  2M16 A;  1X6O A;  1PSE A;  1BIB A;  5CAI A;  4M78 B;  3E9I A;  1AHJ B;  3JCM h;  11AS A;  1HC7 A;  3CC2 T;  1KMM A;  4ELY C;  3QO8 A;  4TVA B;  4P71 C;  4CS3 A;  3I56 A;  1M1G A;  3WVD B;  4G84 A;  4CH5 A;  2Q5I A;  2P4T A;  1VQN T;  3JCM Q;  4YRP A;  5C53 B;  1SRY A;  2GCX A;  4MML A;  2ZCF B;  3PZC A;  4CH3 A;  4E51 A;  1VQ4 A;  4HT4 A;  1K73 U;  3PIO A;  2EIF A;  2QQ9 A;  3J7A F;  2KQW A;  1IRE B;  4C92 A;  1WNL A;  1QVG S;  3MEY A;  5A0D A;  4P71 A;  5GAN 2;  3C12 A;  3RUX A;  1WYD A;  3QNE A;  5LJ5 j;  3SWN B;  2RD1 A;  5LL6 S;  1NPR A;  2IY5 B;  5GAM f;  2ODR C;  4DOW A;  2CZ7 B;  3GIB A;  2DK3 A;  2ZT5 A;  2EAY A;  3RMQ A;  4MZM A;  4F7U B;  1L0W A;  4M78 F;  3PTA A;  1VQO A;  3KXT A;  3FIF A;  2DVE A;  5GAO l;  4YRL A;  3OBY A;  4PNO A;  2YLC A;  4Q5W A;  2XG8 D;  1I5L A;  5CVI A;  2MMP A;  1G3W A;  3RKW A;  4EPC A;  4G85 A;  4JRK A;  1LYL A;  1WGS A;  3L2Z A;  2IG0 A;  3MHX A;  3HSB A;  2D9T A;  2PU9 B;  1B76 A;  2E10 A;  3CC2 A;  3OS1 A;  3HRS A;  4BB7 A;  2ODR D;  5CIU A;  5GAM e;  2ZCE A;  1K8A C;  5LJ3 h;  4RDX A;  2L89 A;  4TTV A;  1VQ4 T;  5M9O A;  4IUV A;  4E7K A;  4XEO A;  3E19 A;  3CD6 T;  1G5H A;  2Y4X A;  3I7F A;  12AS A;  4CH6 A;  1KQS A;  2QHS A;  3MEW A;  1FYF A;  3HFZ A;  2LVM A;  2RJF A;  3FLG A;  3IKL A;  4DOV A;  1Q81 C;  1NJ1 A;  2VYT A;  1N9R A;  2EJF A;  4QQD A;  4R56 A;  1Y96 A;  3M54 A;  2X4J A;  5FU7 B;  3G7Z A;  2LCL A;  1YFR A;  3CCJ A;  2G4C A;  4EMH A;  2EFI A;  4J83 A;  1YJN T;  5CKB A;  1VQK T;  3CMQ A;  3VU3 C;  2DZC A;  3VV0 A;  4YCU A;  3OYJ A;  3CPW S;  2RJE A;  5GAM d;  4J15 A;  5FRM A;  2K5I A;  3LX7 A;  3V7C A;  3PMT A;  4PHC A;  4A54 A;  5I2S A;  3UH0 A;  3JSC A;  3RGL A;  5GAO m;  4K86 A;  4LVM A;  3C95 A;  3ZEH A;  4RMF A;  5FU6 B;  2M0O A;  5LJ3 d;  4ZIB A;  2ZPI B;  3RKY A;  4VUB A;  2RHZ A;  1QE0 A;  4LDV A;  2ZXF A;  4C8Q C;  4DA4 A;  5GAN 7;  1W66 A;  1JBM A;  1M1K C;  1PYS A;  3OYE A;  5KH6 A;  4GLK A;  3CXC S;  3NTH A;  4RQE A;  1H4Q A;  3QO3 A;  2X35 A;  1WLE A;  3TEH B;  1S72 A;  1X2H A;  3HRI A;  4IUT A;  3MF2 A;  1D3B A;  4P72 A;  1VQ8 A;  1E1T A;  3MP8 A;  1Q7Y C;  1D3B B;  4E7H A;  3LSQ A;  4YRJ A;  4K87 A;  2E6Z A;  4QVC A;  1YJW T;  3KUF A;  2QA4 A;  3CPW A;  2ZPH B;  4QVD A;  1GGM A;  3MEA A;  1H3Z A;  4LDW A;  2ZNJ A;  5LJ5 e;  4YRS A;  2CIM A;  4FM4 B;  4M77 G;  3CCU A;  2J3L A;  3HRK A;  3LGL A;  5I21 A;  4PKC C;  2RM4 A;  4IUU A;  3OW2 S;  4F7U A;  3OYH A;  2A7Y A;  1I4K 1;  3NTK A;  2VXE A;  2VGM A;  3C4S A;  4BE2 A;  2I4O A;  1WQ7 A;  2HQE A;  4H2V A;  3OA6 A;  3SWN A;  2QDY B;  4JS5 A;  4XQ3 A;  1QW1 A;  1ZHI A;  3URG A;  1VQL A;  2E3C A;  4M7A B;  1W2B A;  2ART A;  4C8Q D;  3OBW A;  3OYN A;  3J81 E;  3OQ5 A;  5CKE A;  5GAO q;  1Y96 B;  2CGH A;  2DXC A;  4HT9 A;  4H2S A;  3P8B B;  4HCC A;  3IKM B;  2DIQ A;  3LC0 A;  5GMK i;  4TWA A;  2GQV A;  3HPW A;  1VUB A;  4BI3 A;  1KOG A;  4HWS A;  3QYH B;  1U1T A;  1NYQ A;  3G6E T;  4M7A D;  1PSF A;  3R6O A;  4P74 C;  1KG1 A;  3JB9 F;  4HCZ A;  3CXC A;  3ER0 A;  4CRI A;  4QQG A;  2E5A A;  1USY A;  1LOJ A;  2CYZ B;  3BY7 A;  2RJD A;  2O4X B;  2ZZF A;  2MWP A;  3WXM B;  3REX A;  5L8R E;  4ZGJ B;  2HD0 A;  2XD0 A;  1EIY B;  2LT1 A;  4M77 F;  4TQF A;  4DQ2 A;  1UB4 A;  1EQR A;  3G4S T;  4RG2 A;  3RL6 A;  2RJC A;  4M78 G;  2XGT A;  4C0Z A;  2PUK B;  1ADJ A;  1H4V B;  3FB9 A;  5D6Y A;  3CBO A;  4M75 A;  1YBY A;  3MEV A;  3X24 B;  3MF1 A;  4M7A C;  3HFN A;  1VQ5 T;  2AKW B;  2PVO B;  5GMK l;  3FC3 A;  3A7U A;  4M77 A;  4RCC A;  3EAE A;  2QQS A;  2DXB A;  2ZIO A;  1BBW A;  5GMK h;  3EFR A;  3DSQ A;  4JRQ A;  3QSU A;  2G3R A;  5CKF A;  5CCA A;  4ZTZ B;  2HQX A;  4OGC A;  4TQD A;  2WSE E;  2M9U A;  5FU7 C;  1NJI U;  3TU4 K;  3V7R A;  1M90 C;  4P3N A;  2QTX A;  2DD5 A;  5A0G A;  4M7A F;  3CMA T;  3P8D A;  4R55 A;  4XTZ A;  1KMN A;  4M77 B;  5HK3 A;  4KR2 A;  3V7S A;  3JB9 D;  3SB2 A;  3M55 A;  5KE2 A;  1K73 C;  2ZR2 A;  1K9M C;  2CZ1 B;  3TUP A;  2R58 A;  2ZR3 A;  3OB9 A;  4L87 A;  5ELN A;  1KQS S;  2QEX T;  3M58 A;  3SFM A;  4P74 A;  5CKH A;  4L6V 5;  2DDZ A;  4PLI A;  3JCM b;  1VQM T;  4DPG A;  3MCA B;  4P72 C;  3W3S A;  1SES A;  1NNH A;  1VQO T;  4NL2 A;  1Q86 C;  2E70 A;  4UP9 A;  3PNW C;  4YP0 A;  3L2W A;  3E9F A;  5LJ3 j;  1WQW A;  3GLX A;  3JCM X;  5GAN h;  3QHS A;  3CC7 A;  5DY9 A;  2XID A;  4OB2 B;  1B70 B;  4C5E A;  3CEY A;  1Q81 U;  3QJY A;  3FJP A;  1NZ9 A;  3L4G B;  2C7I A;  3L2U A;  1HXD A;  1UGQ B;  1VQ6 T;  3CD6 A;  2GFU A;  1JJ2 A;  1I81 A;  4FL6 A;  3OYF A;  1P92 A;  3OYM A;  4FT2 A;  4M7D C;  2ZIN A;  1DJ7 B;  1H64 1;  2RI2 A;  2C06 A;  3ERR A;  4EMG A;  3TRE A;  4C8Q E;  1Q86 U;  3UWN A;  1M8V A;  5FRN A;  4ME7 A;  5GMK j;  5A2Q E;  3M4Y A;  3JCM c;  5HKC A;  3TEH A;  4M75 G;  4YRT A;  1QVG A;  4WI1 A;  4IUR A;  4PJO A;  4OVA A;  3E9H A;  3HP9 A;  4C92 C;  4PG3 A;  1WPY A;  3OSV A;  3P8Y A;  3V8J A;  5LJ5 h;  4H2T A;  2FYK A;  4H2Y A;  4E47 A;  4C8Q B;  1JJ2 S;  1NJI C;  2K3X A;  4M7D D;  3QZ5 B;  4RMO A;  1U8R A;  5I2M A;  5GAN f;  5GAM j;  3RMS A;  2DPP B;  3RKX A;  2DAQ A;  3QPH A;  1M1F A;  3LLR A;  1SSF A;  4X5O A;  1XQH A;  1UEB A;  1N6A A;  2F5K A;  2PUO B;  1YJN A;  4EO4 A;  3UDC A;  1W2B S;  4XTY A;  2KK4 A;  2EJG A;  2RO0 A;  1YJW A;  1HTT A;  2QHV A;  4X34 A;  1PYS B;  1X01 A;  4BI4 A;  4P75 C;  2ZPE B;  3HHT B;  1SER A;  1LNX A;  3V8L A;  4BUG A;  4KUD K;  1FWZ A;  2I4M A;  3ZBD A;  2CZ6 B;  1YI2 A;  3DB3 A;  5HY6 A;  4H2X B;  3WVE B;  4M7D F;  3P8H A;  3UPU A;  3JB9 J;  3FDR A;  2DD4 A;  1G3S A;  4KBM B;  1E22 A;  2MF2 A;  4J6Y A;  4E7L A;  3X28 B;  4BW9 A;  4YTL A;  2HBP A;  1NPP A;  3BDU A;  2LRQ A;  4OP0 A;  5LJ5 f;  4N4G A;  1EFW A;  5C0M A;  4BWA A;  3KBG A;  3OYA A;  2QEX A;  3BDL A;  2Q7G A;  4LNS A;  4JLG A;  4C92 B;  1VQ9 T;  3LGF A;  2V8K A;  1JB0 E;  5ELO A;  3QTC A;  3SWN C;  2RHS B;  3VBB A;  4OF1 A;  3BFM A;  3GNF B;  2I2L A;  4XTV A;  3GPL A;  2BIV A;  4NL3 A;  3EFS A;  3JCM P;  3RES A;  4HCB A;  3JRZ A;  3S3O A;  4LD9 K;  3H8Z A;  4M7D B;  4XTW A;  3ICA A;  3OYI A;  4C92 E;  2HAX A;  3A31 A;  4HVC A;  3TEG A;  5GAN 6;  1ADY A;  1BBU A;  4TVA A;  2L8D A;  2QQB A;  3OD1 A;  2RHS A;  3BJU A;  1SET A;  5C6S A;  3A8H B;  4HWT A;  3CMA A;  2Q7E A;  4N0A A;  2AMC A;  4NS5 A;  5GAN d;  3MP1 A;  1YJ9 T;  2CJ9 A;  1B70 A;  3M56 A;  2B8A A;  3QG1 A;  3HFO A;  1O9S A;  1J5W A;  3JB9 G;  1KHC A;  3OYK A;  3PIP A;  1YHQ A;  1N8R U;  2DXT A;  4YCW A;  4ZN1 A;  2ZZD A;  3PCO A;  1NE8 A;  1O75 A;  2A8E A;  4XAX B;  2NS6 A;  2VC8 A;  2JUF A;  4O2D A;  4OB0 B;  5GAN 3;  4KR3 A;  2L5Q A;  3QJ6 A;  2KMT A;  3L42 A;  3VQW A;  4C0D B;  3OMC A;  3TEE A;  4P3O A;  3CME T;  4M7D G;  3PT9 A;  4P75 A;  1BIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...