4XU2A

Mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 87 with a 3'deoxy ribose
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
264
structure length
262
Chain Sequence
b'DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional ligase/repressor BirA
publication title Targeting Mycobacterium tuberculosis Biotin Protein Ligase (MtBPL) with Nucleoside-Based Bisubstrate Adenylation Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase/ligase inhibitor
total genus 90
structure length 262
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2015-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4xu2A02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4xu2A01
4A54A 4HWOA 4EMKA 2DVEA 3V8LA 4YRQA 4MMKA 5GMKj 3IKMB 3A32A 4H2YA 4H2VA 2DTOA 4NL3A 4XU2A 4M78C 2DU7A 1E22A 4DQ2A 4E51A 1E1TA 2EWNA 2C8MA 1X2HA 1B34B 4C8QC 4C92F 4C92D 3HXUA 3LC0A 4M7AB 3JB9J 5GANg 4M7AE 1YFRA 1EQRA 3RESA 3REXA 2RHQB 2DTHA 4KR3A 4JRKA 2HNIA 1Z7MA 4YRKA 4M75F 1Y96A 3JCMJ 1NNHA 4Q6GA 1D3BA 4PJOD 5LJ5j 3V8KA 1KQ2A 4P71A 4PJOA 2E3CA 1NYRA 3HY0A 3RIRA 4KQEA 1EOVA 1HTTA 1ADJA 4J5YA 5GANd 1WQWA 4M78B 3HFZB 3M4GA 4CS4A 4M78E 1H4TA 4K86A 3QO5A 4YRSA 3OD1A 4C8QB 4RCCA 5GAN5 4C92C 2E64A 1LYLA 5GAMj 3EFRA 4XTXA 4LNSA 4TQFA 5GAN8 2QHVA 3JCMb 4M7DF 3MEYA 2QHSA 5GMKm 4YRNA 5LJ5g 2ZR3A 4M75C 2J3MA 4G85A 3REUA 1B7YB 1G51A 4TVAB 5GAOr 2ALYA 2AMCB 1C0AA 2G4CA 5F5WA 1GGMA 1N9WA 2ZR2A 2EAYA 4WI1A 3JCMV 3FJPA 4P3PA 1W66A 4PJOG 4F7UA 2AKWA 1H4VB 2FB7A 2VC8A 2Y90A 3NEMA 4PNOA 1BBWA 5GAMg 4XU0A 3AHUA 3PCOB 2QHUA 4AH6A 3BFMA 3JCMd 5LJ5d 3GIBA 4J6XA 2QTXA 1EVLA 3VU3C 2DTIA 1USYA 4M7DC 2E1HA 4M75B 4M75E 4M7AA 2E65A 3V8JA 4P73C 2ZXFA 4YCWA 2RM4A 3RKXA 5GAOq 3A5ZA 2I4LA 4XEMA 5KNNA 2DQ0A 4HWSA 1J5WA 1EFWA 5DY9A 4Y91A 4ZTZB 3HFVA 3R07A 2VXFA 2ZTGA 5GAMd 3JCMe 5LJ5e 2YHTA 3SWNC 5GANj 1YCYA 1G5HA 3UH0A 5GMKh 2ZZGA 4Q15A 5GMKi 1E1OA 3JB9G 4P72A 4YRPA 4YRJA 2ODRD 3SB2A 5GMKl 2Q7HA 3EFSA 4M77D 4TWAA 1NJ1A 3VBBA 2E5AA 3HY1A 2I2LA 4M78A 3E9IA 1X01A 4YRRA 4HWRA 3L4GB 4UP7A 3UGQA 4M7DB 4M77A 4YDQA 2ARUA 4H2XB 2DEQA 1SESA 1YGBA 4UP9A 5GAN3 1KQ1A 3HFOA 1ADYA 1KMMA 3HXZA 4XTVA 4H02A 1ASZA 1LJOA 4M7AG 3A7UA 3JCMh 4X9DA 5LJ5h 2YLCA 3MF1A 2EJGA 1X54A 4H2UA 1Z7NA 3NENA 1JBMA 2RHSB 3SWNB 1B8AA 1X56A 3V7SA 4TQDA 4XU3A 2DZ9A 1B7YA 1MGQA 4TVAA 4EMKC 3JCMX 2ODRC 2ZT8A 1HXDA 4PJOF 1JJCB 1EIYB 2QHTA 1QF6A 3L1AA 1B70A 2JN0A 4XTWA 5GAMh 4K88A 4JRIA 2ZNIA 2Q7GA 3QO3A 4X9CA 4EX5A 3LSQA 1NJ5A 4M78G 2RB6A 3A7RA 4TVWA 3HRKA 4P74A 3NETA 4M77G 5GAOm 2P0LA 3RL6A 4ZTUB 2CIMA 1H641 4C8QE 4YRIA 4H2SA 4HWPA 4J6YA 3FIFA 4CS3A 4YRGA 3PZCA 4DPGA 2VXEA 2EJ9A 1BIAA 3JCMc 4YYEA 2IY5B 1NJ8A 4NOYA 4EMKB 3TEGA 4P71C 2I4NA 1NJ6A 1M8VA 5GANe 1KMNA 3P8YA 4J15A 4PJOC 5ELOA 5ELNA 4RQEA 4O2DA 3L2ZA 3M4PA 1WPYA 2ZZFA 1I81A 3JB9D 4F7UF 4MMLA 4A53A 5LJ3j 4WF2A 4P75A 4X5OA 3QSUA 3P8TA 3TEHB 3JCMf 5LJ5f 3QTCA 3RF1A 2DU5A 5GMKe 1B76A 3RKYA 3P8VA 2CJAA 2YLBA 4JLIA 4C92B 1RIQA 4C92E 2DKGA 3HSBA 3IKLA 2CGHA 1Y96B 4M7AF 4M7AD 1WYDA 5GANh 3HXVA 4M75G 1KOGA 2E10A 1B34A 2PMFA 4PJOB 4EMHA 4PJOE 2RHSA 1BBUA 1IL2A 5HGQA 5LJ3g 2RHQA 2RA2A 1VQZA 1HC7A 4TVYA 4P3NA 2Q7EA 2ARTA 3IG2A 4NCXA 3JCMW 3HTZA 5E3IA 1YFTA 3NELA 1EIYA 4J6WA 2ZZEA 4M78D 4YREA 4HA8A 3INZA 5CAIA 1USYC 4M77F 4C8QD 2Q5HA 2XTIA 4TTVA 4YRMA 3RGLA 3HFZA 4M7AC 5LJ3d 1TH7A 2EL9A 2ALYB 4C8QA 5GAMe 4HT8A 4M7DE 4L87A 2ZINA 3QO8A 4CS2A 1QE0A 3A5YA 3G1ZA 2ZGWA 4N0AC 5GAN2 2E41A 4F7UB 2AKWB 5C51B 2IY5A 4F7UE 2DDZA 3IALA 4PHCA 4CH4A 2ZIMA 1H4SA 4JUVA 4P72C 2ZNJA 2EJFA 4P3OA 4RCBA 1ATIA 1M5Q1 3RUXA 2CJBA 5LJ3e 2ZIOA 3VQXA 1NYQA 1H4QA 4NL2A 1WLEA 2AMCA 2Q5IA 2I4OA 3M4QA 5K1XA 1U1SA 1YB3A 1SRYA 5GAN7 4UPAA 4M77C 5GAOn 3QNEA 4YCVA 5GANf 2I4MA 3TEHA 4RQFA 1L0WA 3RACA 3FB9A 3ICAA 3UFGA 4BW9A 4CH3A 1X55A 3WQZA 2DJZA 4H2TA 3W3SA 5I21A 2DZCA 3A74A 3PCOA 2J3LA 4C92A 1N9SA 4C8QG 2K57A 1LNXA 1E24A 1U1TA 2XGTA 2ZT6A 3A7AA 4XU1A 4M75D 4CH5A 1I5LA 12ASA 11ASA 1SETA 3VQYA 5C53B 2PMEA 4XTYA 4M75A 5LJ3h 1PYSB 3JCMQ 3DSQA 3QHSA 3E9HA 5GAN6 1I8FA 3QO7A 4YRFA 4YRLA 1NJ2A 3BY7A 4V2SA 1YFSA 4M77B 4M77E 4YP0A 4QVCA 3JB9F 4WJ3M 4P74C 3VQWA 3HXWA 3I7FA 4UP8A 1BIBA 3BJUA 3VQVA 4YRCA 3JCMP 4HWTA 4M7DD 1ASYA 1FYFA 3BW1A 4BWAA 4QVDA 3JCMg 4C92G 1EVKA 2ZT5A 3CMQA 3L4GA 5C52B 4KR2A 4M7DA 3KFUA 4H2XA 4OP0A 4YROA 2ZCEA 1WU7A 4XTUA 2C7IA 1D3BB 4P73A 2P5IA 2ZT7A 1B70B 5K1PA 3RERA 3JB9I 5GAMf 2RD1A 4P75C 2FYKA 5GAOl 3JB9H 3SWNA 4G84A 3ERRA 1I4K1 4YCUA 3V7RA 3HFNA 4HT9A 4RDXA 2DXUA 4H2WA 1JJCA 5GAOp 1JRIA 4OLFA 1X2GA 4YRTA 1G5IA 4CH6A 3RKWA 4M78F 3TUPA 4K87A 1WNLA 5LJ3f 3PGGA 4C8QF 3A31A 2ARSA 4PG3A 4HVCA 2DXTA 4EMGA 4XQ3A 1HK9A 4M7DG 5GAN4 3BDUA 2CJ9A 4RMFA 4XEOA 3V7CA 4N0AA 4EO4A 4XTZA 3UGTA 3HXXA 3MF2A 1N9RA 1SERA 3HRIA 2DQ3A 3HXYA 4F7UG 1LOJA 3QUIA 4WJ4A 1PYSA 4YPFA 3LSSA 4ZIBA 1WQ7A
chains in the Genus database with same CATH superfamily
2WSFE 4A54A 4HWOA 2RMOA 3SDZA 2MWPA 1N8RC 2IVWA 4FYXB 2HKQB 1WHHA 2CUBA 4R56A 4H2YA 1I0CA 4NL3A 2DU7A 4E51A 3CMET 2C8MA 4ORZA 1B34B 1X2HA 1JQQA 2WSEE 4JPBW 1G3YA 1AT1B 4M7AB 1OZ2A 2DLPA 3H8ZA 4M7AE 1KQSS 3RESA 1VYTA 2RHQB 1G3SA 3EAEA 2RQTA 2LJ1A 1Z7MA 1YN8A 2K9GA 1VQ6Q 1VQ4Q 2DNUA 3CCSQ 2EYXA 2CZ6B 4ELYC 2DFUA 3GLXA 2DIQA 1M1FA 4Z88A 1YIJA 2KYMA 2KI7A 1PM3A 2KDSA 1ADJA 2DF6A 4J5YA 2HEQA 1SPKA 1WQWA 4M78B 4Y28E 3ULRB 4M78E 4YRSA 3EG9A 1PC0A 4RCCA 3GPLA 3CC4Q 1WHKA 4C92C 1AZEA 2E64A 1VQ4T 1K76A 3CCST 4KGXB 2V1RA 4R0KA 1ZSZA 2FG0A 2NUZA 2QHVA 4M7DF 3MEYA 3NGPA 3UF4A 1UTIA 4BDZA 5I22A 1UEBA 5L8RE 2J3MA 2LDMA 3REUA 2J7IA 5GAOr 3CD6Q 1C0AA 2FZKB 3CC4T 5I2MA 2G4CA 3MP8A 3FC3A 2ROLA 5EG2A 3M54A 1E6HA 3JCMV 1HYOA 2C06A 1M3AA 1QCNA 1IXDA 3EHRA 4JS5A 3MEAA 2VC8A 2Y90A 4C0DC 2CH4W 3PVQA 2EW3A 4XU0A 3AHUA 4HCBA 2B8AA 1RACB 4QW2A 5A0GA 4DA4A 1D0ZA 2LC4A 3CD6T 2KVQG 1USYA 4VUBA 2ROTA 3PMTA 3QZ5B 4M75B 2ZPBB 1W2BA 4M75E 3V8JA 2JZ2A 2K3YA 3OYDA 6AT1B 3HTRA 4YCWA 4IIOA 2KSSA 2DQ0A 2R58A 4FL6A 3QWYA 1EFWA 3HFVA 2VXFA 3JCMe 2X4YA 2YHTA 3L2VA 4QQGA 3CCVA 2MIOA 3OYJA 5GMKh 3HP9A 3TREA 1E1OA 3NMZC 2MCNA 4P72A 1AHJB 4LUDA 4YRJA 1MMAA 3OS0A 1BI3A 1GRIA 5GMKl 4JZ3A 4E7JA 4M77D 5KYXA 2ED0A 4ZTJA 1E6GA 2ZPHB 3E9IA 1X01A 5HK3A 3M55A 1QWEA 3L4GB 4LVJA 4MDXA 1BCOA 2K5FA 5HCKA 2M02A 3THKA 1Y57A 3HFOA 3LWIA 4XTVA 1ASZA 1WHJA 3CBOA 5LJ5h 2EJGA 1Z7NA 3NENA 2V8IA 2V8JA 2RHSB 4JDSA 3GOXA 1QP3A 3SWNB 1B8AA 4AT1B 4TVAA 2LZ6B 3OYNA 2ZT8A 1QLYA 2CYZB 1K4US 2KT1A 2EQJA 2LQNA 2JN0A 3FRNA 2YT6A 1TG0A 2JMAA 2RJCA 2K3BA 3H0FA 2DYBA 4OMMA 2Y4XA 3I55Q 4P74A 1QVGP 1OPKA 4BB7A 3X26B 1QCFA 1H641 1PRLC 4H2SA 1SSFA 4HWPA 3CMAQ 2MYSA 3J7AF 2FPFA 4GLKA 4J9DA 1JEGA 2E12A 4NOYA 2K5LA 2P4RA 4EMKB 2RI2A 1FMKA 3TEGA 4P71C 1NPPA 1M8VA 1VQPA 1KMNA 3CC2A 3OYBA 3M0RA 4Q5WA 3CCLQ 4O2DA 1LVKA 1Q82C 3EG2A 2O31A 4RTYA 2J05A 2D9TA 4OMFB 4WF2A 3CMAT 2L2PA 3C95A 4ZTFA 4AFZC 2EYQA 1VQ6A 3SFMA 2KQWA 3RBBB 2DU5A 1B76A 2DILA 3EH1A 4JLIA 4A4GA 5J3BA 3HSBA 3CCLT 4E7LA 2JXBA 1SRLA 3M0QA 3IKLA 4IUUA 1Y96B 2JS0A 2M9UA 3E19A 1WYDA 1LPLA 1WIEA 5FW9A 1IO6A 1KOGA 2E10A 1B34A 2PVDB 4LE9A 1M2OA 5KYUB 4CC2A 1WJRA 1IL2A 5FWBA 1W1FA 2RHQA 3CCUA 2L89A 4CC4B 4TVYA 2R5MA 2Q7EA 3MEVA 4GLMA 2CP5A 3HTZA 5E3IA 2QASA 4O6JA 4FW2A 4A4EA 1U3OA 2HMAA 2ZPEB 3OW2S 4YREA 2LT4A 1WJQA 2DL3A 2RF0A 4C8QD 3EFOB 2XTIA 1M3CA 1X43A 3VS7A 3I56Q 2OTLQ 2D1XA 1KC8U 2KROA 4EPCA 2ALYB 5GAMe 4HT8A 4M7DE 1OX8A 3QO8A 4QT7A 3VUZA 2K4YA 1QE0A 5HY6A 1T3SA 5GAN2 3WXMB 4J83A 4JUVA 2ZNJA 4RTZA 2EJFA 2MK5A 3I56T 2OTLT 1IB8A 1M5Q1 4BY6B 1RAFB 2ZIOA 1NYQA 2Q5IA 5FRMA 3EGDA 1M8MA 4D6WA 5AT1B 5GAN7 2EIFA 4M77C 4PLIA 5GAOn 2LNHB 4YCVA 2YUNA 4F14A 3FB9A 3TSWA 4ESRA 3ICAA 1X55A 3WQZA 4H2TA 2BTTA 3CPWP 3M58A 2QTVA 3A5ZB 1RAAB 2J3LA 1H3HA 2K57A 1IGUA 1ZSGA 1TU0B 4XU1A 2PTKA 4ZGJB 3H41A 3G1JA 3FDRA 4M4ZA 4ZNXA 2O9VA 4M75A 3CCRQ 1QCOA 2GNCA 4KT0E 4FW1A 2QI2A 2F2WA 2RI5A 5IT9E 2FEIA 3QPHA 1VQLA 3FJ5A 2HQEA 1EZZB 2FZGB 3BDLA 4WJ3M 1UJ0A 1I5OB 4RTVA 4FYWB 1BIBA 3VYGA 2J6FA 2NWMA 2MOXA 4A4HA 1ASYA 2M16A 3CCRT 1SKUB 3UDCA 4BWAA 1UGPB 2GGRA 4E7IA 3L4GA 1WXUA 4OP0A 3G6EA 2C7IA 2MWOA 3I55A 1RUWA 5FU6B 3E9FA 2ZT7A 1FX7A 3RERA 1O75A 2RD1A 1F1BB 4P75C 3GNFB 3SWNA 4CC7A 1PCXA 4G84A 3UT1A 5KCOA 3OYMA 2R57A 5KH6A 1HJDA 4PJLA 2HAXA 3MP6A 2XD0A 4TVRA 2CP3A 4M78F 4Z89A 4L5GA 4K87A 3TUPA 1WNLA 1WHLA 1N8RU 3PIPA 4X1VA 5GAN4 3BDUA 4OVAA 2IIMA 4XEOA 1VQNA 3LLRA 1PKTA 2VGMA 4XTZA 4YTLA 1SERA 2E5KA 1BKBA 3QUIA 1UECA 1KIKA 4O5VA 4AG1C 3TVTA 4EMKA 2DVEA 2LX9A 1YCSB 5CK9A 1NLOC 2GBQA 2GQIA 2L5QA 3X20B 4C0GA 2OTJA 1U8RA 3IKMB 3HRTA 2RQUA 1TTHB 2VV5A 4H2VA 4LXCA 4BD3A 1VQ7A 1JU5C 4DQ2A 3VV0A 1E22A 1VQ8A 3G4SQ 4C8QC 1KD1R 2RQWA 4C92D 3JB9J 2OX7A 1C6VX 2VUBA 4OF1A 1EQRA 1PG5B 3OYYA 3E9GA 1Q95G 2FHDA 4JRKA 4LVIA 2OAWA 1NEBA 4M75F 1Y96A 2KGTA 1BB9A 1VQOQ 4Q6GA 3I56A 1Q86R 4PJOD 1WXTA 2D8JA 2KY9A 1VIEA 3G4ST 3AT1B 1OU9A 3VRZA 1RAEB 4Y92A 5FU7C 4E47A 1OI1A 3NHNA 2COYA 3RIRA 1HTTA 1BK2A 5GANd 3HFZB 1OZ3A 1MMDA 5I11A 1K73C 1WJSA 3A8LB 5FLXE 3O5ZA 2MF2A 1VQOT 2PVOB 3MKDA 1LYLA 2X51A 1OYXA 2D0QB 1QVFP 5CKBA 5CKDA 2DJQA 3JCMb 4BE1A 2K2VA 2DM1A 2KAFA 1U06A 2QHSA 1PNJA 3CBPA 2RJDA 5GMKm 4YRNA 1ABQA 2LP5A 2DBKA 1AVZC 1CSKA 2W10A 2H8HA 4Z02A 3KBGA 1PRMC 2CREA 1G51A 3OS5A 2ALYA 4TVAB 2EYWA 2AMCB 4LD6A 3CPFA 4MZMA 1GFCA 2RHZA 2EAYA 3FJPA 2ENMA 2RN8A 1QQJA 3NEMA 1X6OA 2M0YA 2D8HA 1WA7A 2NUTA 4LDXA 1K9MR 5LJ5d 2KR3A 5DM7R 1Y07A 3VU3C 2V1QA 4EDUA 5DLOA 1NJIC 2EKOA 3FEOA 1K8AR 1YI2A 4L59A 1Q7YC 2DL5A 2E1HA 3QZ9B 4KBMB 4FSXA 4P73C 1P92A 4OGCA 1IHWA 2ZXFA 1DJ7B 3RKXA 3A5ZA 3MPUB 4FM4B 2ZTGA 1Q86C 3TEEA 1BI2A 2RQRA 5CQXA 2DXBA 4C0DB 4RMOA 5GMKi 2NUPA 3L2QA 2Q7HA 4BE2A 2FVUA 3PNWC 4OB3B 2PU9B 2CDTA 2AT1B 3HKSA 2RHIA 2COZA 1NJ1A 1HD3A 3VBBA 5CKHA 3UPUA 1YITQ 3DKMA 2P84A 1TUGB 4YDQA 3QJ6A 3DB3A 2DEQA 1SESA 4UP9A 5GAN3 1KQ1A 1KMMA 4PL6A 3HXZA 5HKCA 4IIMA 2A36A 4C5IA 4H02A 1IREB 3MF1A 4F16A 2E6ZA 4OB0B 1S72A 4H2UA 4OMOA 4JJNK 2PUKB 4OMNA 1BCMA 2ZPGB 1YITT 2BKDN 3DLMA 1B7YA 1MGQA 4AFSC 3I9QA 4KGVB 5CKFA 3CC7A 2HCKA 1D09B 5HK0A 1W70A 3OYFA 2QHTA 1QF6A 4CI0C 5GAMh 2F5KA 5I2SA 2ZNIA 3QO3A 4EX5A 5IHIA 1RL2A 3REBB 1MNEA 1K9MC 3A7RA 3HRKA 8ATCB 4TVWA 5LL6S 1Z9ZA 2P0LA 4FT2A 4ZTUB 2QA4Q 1SHFA 3HHTB 3CCJQ 4YRIA 1BI1A 1S1NA 1K8AC 1UFFA 3CCQA 4YRGA 3M56A 3OYKA 2ECZA 4C5EA 1BYMA 1IRXA 2VXEA 2KBTA 1SSHA 4YYEA 1UHFA 4FSSA 3HPWA 4QVZA 3OA6A 1NJ6A 3CQTA 2DPPB 2RH2A 4PJOC 5ELOA 2RNAA 1QMCA 4ZN3A 2QA4T 3JB9D 3CCJT 2QQBA 1FYNA 2RHXA 4LVMA 3EGDB 5D6YA 2DETA 2DXCA 4PFOA 4C5GA 2MMPA 4HVUA 4X5OA 1ZBXA 1VQMA 3P8TA 2CSIA 5LJ5f 1YHQQ 2AHJB 1D1CA 2P0PA 1JJ2A 3P8VA 4OB1B 1RIQA 1W2BP 1MV3A 4J9GA 2JNGA 3RDVA 2GFUA 5M9OA 1TS9A 3VS4A 2QQAA 3QBYA 5GANh 1QVGS 4GY5A 2DERA 3EH2A 1YNZA 3VS1A 2PVGB 3UATA 3OY9A 1OU8A 1YHQT 5ECAA 2BE9B 1Y0MA 5D6XA 2QDYB 3I5RA 5IAYA 1UGQB 3F70A 2LRQA 4LN2A 2ARTA 1ZA1B 1Q82R 1YFTA 3R6OA 1M90R 2EQIA 3VRYA 5CAIA 1NZ9A 1X6GA 1OX9A 1KQSA 4TTVA 4YRMA 3HFZA 4M7AC 4LDUA 2EL9A 4L87A 2ZINA 2GCXA 2QEXQ 3CXCP 3A5YA 1ZUKA 2V26A 3EG0A 2ZGWA 3META 2AKWB 1O9SA 3LW5E 4PHCA 2ZIMA 3OYCA 1NE8A 2LCLA 1GBQA 5IXBA 2Y4YA 4RCBA 2COWA 1XJWB 3M0UA 1BU1A 3GF5A 1H4QA 1WLEA 2AMCA 3M4QA 2DBMA 2QEXT 1YB3A 4UPAA 3QKJA 2YDLA 3TEHA 4RTWA 3G71Q 4OMQA 4PKCC 2CP0A 3L2WA 1I1JA 3VKIA 3CMEA 2XDPA 5I21A 2DZCA 3EGXB 4C92A 2RI3A 3PFSA 1UJYA 4E7KA 2LNVA 4CH5A 2JTMA 4J9EA 2VWFA 2YUQA 12ASA 2X4JA 11ASA 1X75C 2ED1A 3ASKA 3VQYA 5LJ3h 2PZ1A 3G71T 2Z0WA 4PLLA 4MZTA 2H3JA 1I8FA 3EHQA 3BY7A 1M9SA 4M77B 1NPRA 4M77E 4QVCA 4JLGA 1M90C 4UC4A 1AWWA 2KK4A 2RK1A 4HWTA 4M7DD 2EFIA 1VQ4A 3PT9A 3CCSA 1FYFA 3BW1A 4C92G 4X34A 2ZT5A 4KR2A 5C52B 1KJWA 1WHGA 3KFUA 2I0NA 3CPWS 2GQVA 2QQRA 5A2QE 1I07A 4KULA 4PJJA 2K3XA 1B3QA 2P5IA 1B70B 5K1PA 2LQKA 5L23A 2CUDA 3CCJA 2DL8A 3CC4A 4HCZA 3X24B 2FYKA 3JB9H 3ERRA 2OAUA 1KK7A 3HFNA 4KGZB 2WACA 3PE0A 3R6NA 1JRIA 5C6SA 3OQ5A 1G5IA 3OSVA 2JTEA 3CD6A 1XNIA 4CC3A 4HVCA 2HD0A 3NTKA 4XQ3A 2L3QA 2MAMA 1GCQC 2F2VA 4IUQA 1NG2A 2O01E 4EO4A 2ZPFB 1YHQA 3UGTA 3M4YA 4E7HA 2HL3A 3HRIA 3ER0A 3HXYA 3LX7A 4DEXA 4F7UG 1LOJA 4A4KA 8AT1B 4YPFA 4ZIBA 1OULA 2EYYA 3M5AA 3V8LA 3CCEQ 5CR2A 1ZUUA 4YRQA 2NUTB 5GMKj 4PK4A 3A32A 1B07A 2A08A 1ZHIA 1T0JA 1ARKA 4XU2A 2DYIA 1UE9A 1E1TA 2EWNA 1ZQ1A 2ATCB 4C92F 5GANg 1YFRA 1VYVA 4QQDA 5KCHA 2A0FB 2EQUA 1X2QA 3REXA 1ZBJA 4KR3A 1ZLMA 3CCET 3ZEHA 2DEUA 2X4WA 2HNIA 2QQ9A 1MV0B 1SRMA 1MNDA 2K79A 1NNHA 4DOVA 5LJ5j 3QDFA 3MCAB 2NUPB 3NPFA 3V8KA 4P71A 4IUTA 2F1LA 2E3CA 3HY0A 1X2KA 4JRQA 1EOVA 1D1AA 5CO7A 3M4GA 3ME9A 1H4TA 3QO5A 1JXMA 3OD1A 4C8QB 2YXYA 3L42A 2LVMA 4XTXA 1Z9QA 2E70A 1VQ5Q 4TQFA 1TUCA 2AZVA 2QYZA 1N27A 4FIBA 1EFNA 5LJ5g 2ZR3A 1M1GA 4J9FA 2KXCA 4G85A 2G3RA 1VQKQ 1B7YB 4DBHA 2DE0X 1KD1U 1M3BA 1WZOA 5FU7B 1X69A 1GGMA 1N9WA 2ZR2A 4WI1A 4P3PA 2AKKA 1JXOA 2YRVA 1VQ5T 2AKWA 1H4VB 2JS2A 2FB7A 1PKSA 3OW2A 1RAIB 4PNOA 2LX7A 1FMVA 3C4SA 3CMAA 4RUGA 1BBWA 2ZZDA 3D7SB 1G8XA 1Q86U 2A8EA 2QHUA 3ZFJA 3LH0A 2JW4A 1U5SA 4PFPA 1VQKT 3GIBA 4HVWA 3H6ZA 5J39A 1EVLA 1K73R 2L8DA 1D0YA 2E3IA 3REAB 1JB0E 4AFUC 2DL7A 3A8OB 4M7DC 3CCLA 2EPDA 3TU4K 4A4FA 2E65A 5CKEA 3WVEB 5KYYB 3JRZA 3U23A 5KNNA 1TWBA 1QVFS 4HWSA 3EGXA 1G3TA 3S3MA 4EIKA 3EG1A 3R07A 5GAMd 5LJ5e 1YJWQ 2DRKA 3IQLA 2DVJA 3UH0A 4B6MA 2YSQA 2FZCB 1H92A 3JB9G 4JS4A 1QP2A 3I35A 1FWZA 3MP1A 2RQVA 3GBQA 4II1A 1FXXA 4JJCA 4LD9K 3P8HA 4J9BA 3M0TA 3QIIA 1K0SA 4HWRA 2F69A 3RMSA 2D6FA 4YRRA 1H8KA 4M77A 5CVIA 4ELZC 3QWXX 1YIJQ 1YJWT 2NYSA 4B9XA 4Z8AA 5IH2A 1ADYA 2JTFA 1M1KR 4IUPA 5FWCA 3DLLA 2R5AA 2BZYA 1NJIR 3M9QA 4RG2A 4X9DA 3JCMh 2YLCA 3C0CA 1Q7YR 1K9MU 1WX6A 4IKFA 1X56A 4TQDA 3LGLA 2MPXC 1K8AU 4HXJA 1UGVA 3JCMX 1YIJT 2ODRC 1RAHB 2EBPA 1JJCB 2OTLA 1CKBA 2L0AA 3OB9A 3JV3A 1B70A 4RTTA 4XTWA 3OBWA 4K88A 2DK3A 4JRIA 4X9CA 5GJVB 3LYIA 2GFAA 2RB6A 4MDWA 2LMJA 3NETA 4M77G 5GAOm 2YRDA 2HBWA 4HCKA 4AG2C 3CEYA 4J6YA 2NS6A 4CS3A 3PZCA 1W6XA 2RK2A 2QQSA 1R0CB 2EJ9A 2HDAA 1NJ8A 4DBQA 1Y71A 2DL4A 4XK8E 4J15A 2VKNA 4BI8B 2CZ7B 3L2ZA 3M4PA 3SEMA 3GP8A 1WPYA 4QKUA 4MMLA 4P75A 1WYXA 1OEBA 3TEHB 2QAZA 3QTCA 2CJAA 2YLBA 1ZSZC 4C92B 1Q81R 4C92E 2DKGA 1T3LA 3URGA 4DBFA 3CCRA 1YWOA 2CS7A 2PQWA 2CGHA 1M1KC 4M7AD 2A3LA 2C0IA 3HXVA 1TSFA 1E7OA 1OPLA 1SG5A 1PSEA 1VYUA 4PJOB 4PJOE 4LNPA 5AYFA 3CCVT 1BBUA 1VQZA 4JJBA 3HL8A 2JOYA 1NEGA 2KEAA 4NCXA 4E7ZA 1YBYA 4HVVA 3JCMW 1MMGA 3A1PA 1EIYA 1TUDA 2KYBA 5FRNA 2EYZA 3O8VA 4M78D 3INZA 1T0HA 4KUIA 4M77F 1USYC 2HL5C 2ZAEA 2J6KA 3OBYA 1GL5A 4L6V5 2O4XB 4LVKA 5LJ3d 4AMCA 4C8QA 5KYWB 1BBZA 1IGQA 1RI9A 4ME7A 4J9CA 4N4IA 3G1ZA 1VUBA 4LDYA 4BE0A 2F2XA 3UA7A 4ATOA 3QDRB 5J26A 4F7UB 3E2UA 3S3NA 3P8BB 2IY5A 2XK0A 4F7UE 3SHWA 1G3WA 4CH4A 3TSZA 1H4SA 4P72C 3QJYA 4J7FA 3MJXA 2XKOC 2B86A 4P5NA 1G2BA 2BIVA 2CJBA 2HBPA 3VQXA 3BE3A 3T9NA 2I4OA 5D7UA 1X27A 2PNIA 1VA7A 2RHYA 2KRMA 1RI0A 4FYYB 1C1AA 1VQPQ 3CC2Q 2QDLA 3QNEA 5GANf 4PJMA 2I4MA 3RACA 1YJWA 1GBRA 3UFGA 4CH3A 1RAGB 4N4GA 1V76A 2DJZA 3OYEA 1Q81C 3TQ7P 1Q82U 1N9SA 4C8QG 2SEMA 5IXFA 4HKEA 1M90U 2O88A 1U1TA 2XGTA 3N5BB 4M75D 1I5LA 1SETA 5C53B 1VQPT 3CC2T 2KXDA 4E2FB 4DBRA 1ACMB 3C12A 3FLGA 3CXCS 1PSFA 3WVDB 2DAQA 2FO0A 5KYYA 4FU6A 2P4TA 3E9HA 3PVLA 3G4SA 1R77A 2KRNA 2HKNA 2CZ1B 4YRLA 1NJ2A 4MZPA 1YFSA 1X6BA 3MO8A 2L3SA 1K0XA 3JSCA 3NTHA 1VQ6T 3LGFA 3PIOA 4P74C 2E6NA 1JJ2P 3CCUQ 4UP8A 3BJUA 1TOVA 4FYVB 3VQVA 1YFNA 3JCMP 1VQOA 4QVDA 3JCMg 1H3ZA 1UHCA 4J7IA 4NS5A 2A28A 2KNBB 3KXTA 3VS5A 4YROA 2M0OA 4XTUA 3M53A 3CCMQ 2LQWA 4P73A 2C0OA 4OMPA 3CCUT 5IHKA 1V29B 4WCIA 4DOWA 2J6OA 3JB9I 1WXBA 2HQHA 1EX4A 3M57A 4FT4A 5GAOl 3QYGB 2K7AA 1I4K1 3J81E 3Q1JA 2EGCA 4KRTA 4ZGEB 4E6RA 3OYLA 4RDXA 2DXUA 3A8MB 2O2OA 1JJCA 2CP2A 3CCMT 5GAOp 1KQSP 2AIRB 1X2GA 4YRTA 2XIDA 4CH6A 1M27C 2JMCA 5LJ3f 3PGGA 4C8QF 1XTDA 2ARSA 4PG3A 2DXTA 2W0ZA 4EMGA 1HK9A 2CJ9A 2D0NA 1N9RA 4RG8A 1EIFA 2G6FX 1PYSA 2RO0A 2KMTA 3LSSA 4GBQA 1WQ7A 1K1ZA 3HRUA 4MMKA 3RMQA 2RJEA 1YJ9Q 2DTOA 2EKHA 3E1SA 4M78C 4F04B 1G5VA 1IHVA 3VS6A 9ATCB 5KE2A 2F5TX 4QQ6A 1C0MA 3HXUA 3SD4A 1VQLQ 3LC0A 3VS0A 2AKLA 1V1CA 1MUZA 3G7ZA 3CXCA 2DTHA 3A8GB 3QG1A 2EGAA 4YRKA 3JCMJ 1D3BA 1RADB 5C0MA 1YJ9T 5CCAA 2JM9A 1YITA 3QXEB 3EGUA 1KQ2A 4OB2B 1NM7A 4BDYA 3OMGA 4J9HA 1D1BA 4PJOA 1VQLT 3G6EQ 1NYRA 4KQEA 3VUBA 2DD5A 4BI3A 2OI3A 1M2VB 1OV3A 2M51A 2XDDA 1OOTA 2IG0A 4CS4A 4K86A 5GAN5 1MHNA 2J06A 1SHGA 2JJ9A 4A63B 5GAMj 3EFRA 5KE3A 1QVGA 4LNSA 2CH4A 5GAN8 1R8OB 2A37A 2FRYA 2VB6A 2XU8A 3G6ET 4LVLA 3EG3A 4M75C 2OJ2A 3I55T 2O4XA 1GXIE 2DRMA 2XICA 2KT8A 5KYWA 1ZUYA 1NYFA 5F5WA 5CIUA 4K11A 1ABOA 4PJOG 1W66A 1QKWA 2QA4A 1N5ZA 4F7UA 4KUDK 1VQNQ 1R0BG 1QVPA 1RLQC 5GAMg 3UWNA 3PCOB 3KUFA 4AH6A 3BFMA 3JCMd 4J6XA 3OS2A 2QTXA 2YRCA 2DTIA 2XHCA 4ZN1A 2OTJQ 4C0FA 3VS3A 4M7AA 4BUGA 3QYHB 1VQNT 3NFCA 2RM4A 5GAOq 1PD0A 1VQ7Q 4XEMA 2I4LA 1VQ8Q 1J5WA 5DY9A 4Y91A 4ZTZB 1KG1A 3SWNC 2BE7D 1YCYA 5GANj 1G5HA 2M1HA 3VYHB 2L3PA 2ZZGA 1RLPC 2DMOA 4D8DA 4Q15A 4YRPA 2ODRD 2HSEB 3SB2A 2OTJT 4J8OA 2X3WD 3OSSC 1QWFA 1XQHA 2EVRA 3A98A 3EFSA 5DLQE 4R55A 3CCMA 4TWAA 1AD5A 2CT3A 2E5AA 3HY1A 2I2LA 3OYAA 1VQ7T 2K5IA 4M78A 2LT1A 1VQ8T 4UP7A 3UGQA 4OMLA 4M7DB 3H9NA 3L2UA 4HT4A 1ZA2B 2P0QA 2ARUA 4H2XB 1UDLA 3KFVA 4RTXA 3NTIA 3RNJA 3MEUA 1YGBA 1WI7A 2FRWA 1LJOA 4M7AG 3A7UA 1XOVA 2SRCA 4CRIA 2QK0A 2QXFA 1X54A 1JBMA 2BZXA 3V7SA 4XU3A 1K73U 2DZ9A 1QW1A 3OYGA 4EMKC 1HXDA 4PJOF 1EIYB 3L1AA 1QKXA 1UB4A 1GCPA 4JZ4A 2QEXA 2Q7GA 1YJNQ 3LSQA 1NJ5A 4M78G 5GJWB 4HCCA 1SEMA 3RL6A 3VJPA 3JAME 1AOJA 2CIMA 4C8QE 3S6WA 3FIFA 3CBMA 3CPWA 1D0XA 1OQKA 3PMIA 4LUEA 4DPGA 1RABB 2JT4A 3X25B 1BIAA 1UG1A 3JCMc 2IY5B 1YJ9A 2C0TA 1YJNT 2AK5A 2X4XA 2EQKA 2I4NA 2YUPA 5GANe 3P8YA 1YI2Q 2JUFA 5ELNA 3G71A 1VQ9Q 4RQEA 1M1KU 3MHXA 2ZZFA 2KE9A 2FPDA 1I81A 2PUOB 1M4ZA 3OW2P 1NJIU 4F7UF 1NYGA 3OYHA 4A53A 5LJ3j 1KC8R 1Q7YU 4JJDA 4LDWA 3QSUA 1J3TA 3JCMf 1B7TA 1KHIA 3RF1A 3MEWA 2LTOA 5GMKe 3RKYA 2GTJA 2RHUA 1YI2T 2VASA 1KSWA 1VQ9T 3L2RA 1TXQA 2NLUA 4KH1B 2XMFA 4ANJA 4M7AF 2DA9A 1SF9A 2YWWA 4BACA 2LCSA 4E7SA 2CT4A 4M75G 4OGEA 3C94A 2PMFA 2CSQA 1AZGB 2KRSA 4EMHA 1GCQA 1K9AA 2RHSA 2XG8D 2XI9A 5HGQA 2EQMA 1AWJA 5LJ3g 3ZL7C 2RA2A 4DEYA 3J80E 4PJNA 2K2MA 2QGFB 1HC7A 3M0SA 2E4HA 4P3NA 3EG9B 5D6WA 1S72Q 2XDBA 3IG2A 3I5SA 2E3HA 3LWHA 5FROA 1AWXA 4BY6C 3OMCA 3NELA 2EGEA 2QG9B 4J6WA 4N4HA 2ZZEA 3H0IA 1ZSZB 4IURA 1WFWA 3DB4A 2H3EB 4HA8A 3X28B 2ESWA 1WDXA 4RTUA 1WGSA 3CC7Q 2Q5HA 1M2VA 2JVVA 3RGLA 5CQYA 2YUOA 1KHCA 1N6AA 1TH7A 2VGNA 4C5HA 2CP7A 1S72T 4CS2A 3HRSA 3PTAA 2CZ0B 2JM8A 2LJ0A 4N0AC 2DX1A 2E41A 1VIFA 5C51B 1Q81U 2MI6A 2DDZA 2L3RA 3IALA 2CP6A 3CC7T 3CCQQ 1MMNA 2DO3A 4P3OA 1ATIA 1UGSB 2E5QA 3RUXA 5LJ3e 4NL2A 1KC8C 5K1XA 1U1SA 4LDVA 2RPNA 1SRYA 1PHTA 3GNGA 1FMWA 2X9HA 4RQFA 1L0WA 1PD1A 1AEYA 1W4SA 2ABLA 4C0ZA 4BW9A 3LH5A 1YWPA 4BI4A 3W3SA 3M0PA 2RJFA 3A74A 3CCQT 3PCOA 1ZX6A 4D8KA 4FCYA 1VQMQ 1LNXA 1E24A 2ZT6A 3A7AA 5EC7A 3P8DA 1A0NB 1M30A 3CCEA 2CKKA 2PMEA 4XTYA 1WLPB 1PYSB 7AT1B 5KYUA 3JCMQ 4PFZA 4J9IA 5KYXB 3DSQA 3QHSA 5FU6C 5GAN6 1UUEA 5A0LA 3QO7A 4YRFA 3TCJA 2X3XD 4RKUE 1N8RR 4V2SA 3S3OA 1JO8A 1VQMT 4YP0A 3JB9F 2P0KA 3OYIA 2LJ3A 3VQWA 3HXWA 3I7FA 4XAXB 2FL7A 4YRCA 1WHMA 3CCVQ 1G83A 3EFOA 2HSPA 2GTOA 1UGRB 1EVKA 2VYTA 3M59A 3CMQA 2A7YA 1QVFA 4M7DA 4H2XA 1YJNA 2AZSA 1WU7A 2ZCEA 1D3BB 5A0DA 1NBEB 4JRPA 1LCKA 2LCCA 1YP5A 2HZYA 2VVKA 2O9SA 5IN1A 4ZGDB 5GAMf 3H0HA 2LQ8A 2DD4A 4AFQC 1VOMA 3OS1A 4WTOB 4YCUA 1NLPC 1BI0A 1VQ5A 1CKAA 1PWTA 4F17A 3V7RA 4HT9A 4H2WA 4IUVA 2WSCE 2IPOB 1KD1C 4OLFA 1VQKA 1HSQA 3UA6A 3VS2A 1VQ9A 3RKWA 2ZCFB 2ZPIB 2HQXA 4B9WA 1AWOA 2DIGA 1JJ2S 2V8KA 3A31A 5IHNA 4M7DG 1IZ6A 2BUDA 4RMFA 2K6DA 3V7CA 5KYNA 4N0AA 3RR6A 1GFDA 2FPEA 2X35A 3HXXA 3MQZA 3CMEQ 3MF2A 4KH0B 2DQ3A 1KFZA 2QGGA 2GF7A 1W2BS 3A8HB 4WJ4A 2BZ8A 3ZBDA 1Y7XA
chains in the Genus database with same CATH topology
2WSFE 4A54A 4HWOA 3SDZA 2MWPA 1N8RC 2IVWA 4R56A 4H2YA 4NL3A 2DU7A 4E51A 3CMET 2C8MA 1X2HA 1B34B 2WSEE 1G3YA 4M7AB 1OZ2A 3H8ZA 4M7AE 1KQSS 3RESA 2RHQB 1G3SA 3EAEA 1Z7MA 2CZ6B 4ELYC 3GLXA 2DIQA 1M1FA 1YIJA 2KDSA 1ADJA 4J5YA 1WQWA 4M78B 4Y28E 4M78E 4YRSA 4RCCA 3GPLA 4C92C 2E64A 1VQ4T 3CCST 2QHVA 4M7DF 3MEYA 4BDZA 1UEBA 5L8RE 2J3MA 2LDMA 3REUA 5GAOr 1C0AA 3CC4T 5I2MA 2G4CA 3MP8A 3FC3A 5EG2A 3M54A 3JCMV 2C06A 4JS5A 3MEAA 2VC8A 2Y90A 4C0DC 4XU0A 3AHUA 4HCBA 2B8AA 4QW2A 5A0GA 4DA4A 2LC4A 3CD6T 2KVQG 1USYA 4VUBA 3PMTA 3QZ5B 4M75B 2ZPBB 1W2BA 4M75E 3V8JA 2JZ2A 2K3YA 3OYDA 4YCWA 2KSSA 2DQ0A 2R58A 4FL6A 1EFWA 3HFVA 2VXFA 3JCMe 2X4YA 2YHTA 3L2VA 4QQGA 3CCVA 3OYJA 5GMKh 3HP9A 3TREA 1E1OA 4P72A 1AHJB 4YRJA 3OS0A 1BI3A 5GMKl 4E7JA 4M77D 4ZTJA 2ZPHB 3E9IA 1X01A 5HK3A 3M55A 3L4GB 4LVJA 4MDXA 2K5FA 3HFOA 3LWIA 4XTVA 1ASZA 3CBOA 5LJ5h 2EJGA 1Z7NA 3NENA 2V8IA 2V8JA 2RHSB 4JDSA 3GOXA 1QP3A 3SWNB 1B8AA 4TVAA 3OYNA 2ZT8A 2CYZB 2EQJA 2JN0A 3FRNA 2RJCA 2Y4XA 4P74A 4BB7A 3X26B 1H641 4H2SA 1SSFA 4HWPA 3J7AF 4GLKA 2E12A 4NOYA 2K5LA 4EMKB 2RI2A 3TEGA 4P71C 1NPPA 1M8VA 1VQPA 1KMNA 3CC2A 3OYBA 4Q5WA 4O2DA 1Q82C 2D9TA 4OMFB 4WF2A 3CMAT 3C95A 4ZTFA 2EYQA 1VQ6A 3SFMA 2KQWA 2DU5A 1B76A 4JLIA 4A4GA 5J3BA 3HSBA 3CCLT 4E7LA 3IKLA 4IUUA 1Y96B 2M9UA 3E19A 1WYDA 1KOGA 2E10A 1B34A 2PVDB 1WJRA 1IL2A 2RHQA 3CCUA 2L89A 4TVYA 2R5MA 2Q7EA 3MEVA 3HTZA 5E3IA 4A4EA 4O6JA 2ZPEB 3OW2S 4YREA 2LT4A 1WJQA 4C8QD 2XTIA 1KC8U 4EPCA 2ALYB 5GAMe 4HT8A 4M7DE 3QO8A 3VUZA 2K4YA 1QE0A 5HY6A 5GAN2 3WXMB 4J83A 4JUVA 2ZNJA 2EJFA 3I56T 2OTLT 1M5Q1 4BY6B 2ZIOA 1NYQA 2Q5IA 5FRMA 4D6WA 5GAN7 2EIFA 4M77C 4PLIA 5GAOn 4YCVA 3FB9A 3ICAA 1X55A 3WQZA 4H2TA 3M58A 3A5ZB 2J3LA 2K57A 4XU1A 4ZGJB 3FDRA 4M75A 4KT0E 2QI2A 2RI5A 5IT9E 3QPHA 1VQLA 2HQEA 3BDLA 4WJ3M 1BIBA 3VYGA 4A4HA 1ASYA 2M16A 3CCRT 3UDCA 4BWAA 1UGPB 4E7IA 3L4GA 4OP0A 3G6EA 2C7IA 2MWOA 3I55A 5FU6B 3E9FA 2ZT7A 1FX7A 3RERA 1O75A 2RD1A 4P75C 3GNFB 3SWNA 4G84A 3UT1A 5KCOA 3OYMA 2R57A 5KH6A 2HAXA 3MP6A 2XD0A 4TVRA 4M78F 4L5GA 4K87A 3TUPA 1WNLA 1N8RU 3PIPA 5GAN4 3BDUA 4OVAA 4XEOA 1VQNA 3LLRA 2VGMA 4YTLA 4XTZA 1SERA 1BKBA 3QUIA 4O5VA 4EMKA 2DVEA 2LX9A 5CK9A 2L5QA 3X20B 4C0GA 2OTJA 1U8RA 3IKMB 3HRTA 2VV5A 4H2VA 4BD3A 1VQ7A 4DQ2A 1E22A 3VV0A 1VQ8A 4C8QC 4C92D 3JB9J 2VUBA 4OF1A 1EQRA 3OYYA 3E9GA 2FHDA 4JRKA 4LVIA 4M75F 1Y96A 4Q6GA 3I56A 4PJOD 2KY9A 1VIEA 3G4ST 5FU7C 4E47A 1OI1A 3RIRA 1HTTA 5GANd 3HFZB 1OZ3A 1K73C 1WJSA 3A8LB 5FLXE 2MF2A 1VQOT 2PVOB 1LYLA 1OYXA 2D0QB 5CKBA 5CKDA 3JCMb 4BE1A 2K2VA 2KAFA 2QHSA 3CBPA 5GMKm 2RJDA 4YRNA 4Z02A 3KBGA 1G51A 3OS5A 2ALYA 4TVAB 2AMCB 4LD6A 3CPFA 4MZMA 2RHZA 2EAYA 3FJPA 3NEMA 1X6OA 4LDXA 5LJ5d 5DM7R 1Y07A 3VU3C 4EDUA 5DLOA 1NJIC 2EKOA 3FEOA 1YI2A 4L59A 1Q7YC 2E1HA 3QZ9B 4KBMB 4FSXA 4P73C 1P92A 4OGCA 2ZXFA 1DJ7B 3RKXA 3A5ZA 4FM4B 2ZTGA 1Q86C 3TEEA 1BI2A 5CQXA 2DXBA 4C0DB 4RMOA 5GMKi 3L2QA 2Q7HA 4BE2A 2FVUA 3PNWC 4OB3B 2PU9B 3HKSA 2RHIA 1NJ1A 3VBBA 5CKHA 3UPUA 3DKMA 4YDQA 3QJ6A 3DB3A 2DEQA 1SESA 4UP9A 5GAN3 1KQ1A 1KMMA 4PL6A 3HXZA 5HKCA 4C5IA 4H02A 1IREB 3MF1A 2E6ZA 4OB0B 1S72A 4H2UA 4JJNK 2PUKB 2ZPGB 1YITT 2BKDN 3DLMA 1B7YA 1MGQA 5CKFA 3CC7A 5HK0A 3OYFA 2QHTA 1QF6A 4CI0C 5GAMh 2F5KA 5I2SA 2ZNIA 3QO3A 4EX5A 1RL2A 1K9MC 3A7RA 3HRKA 4TVWA 5LL6S 2P0LA 4FT2A 4ZTUB 3HHTB 4YRIA 1BI1A 1K8AC 3CCQA 4YRGA 3M56A 3OYKA 4C5EA 1BYMA 2VXEA 4YYEA 3HPWA 4QVZA 3OA6A 1NJ6A 2DPPB 2RH2A 4PJOC 5ELOA 4ZN3A 2QA4T 3JB9D 3CCJT 2QQBA 2RHXA 4LVMA 5D6YA 2DXCA 4C5GA 2MMPA 4X5OA 1ZBXA 1VQMA 3P8TA 5LJ5f 2AHJB 2P0PA 1JJ2A 3P8VA 4OB1B 1RIQA 2JNGA 2GFUA 5M9OA 1QVGS 2QQAA 3QBYA 5GANh 4GY5A 2PVGB 3OY9A 1YHQT 5D6XA 2QDYB 5IAYA 1UGQB 3F70A 2LRQA 2ARTA 1YFTA 3R6OA 5CAIA 1NZ9A 1KQSA 4TTVA 4YRMA 3HFZA 4M7AC 4LDUA 2EL9A 4L87A 2ZINA 2GCXA 3A5YA 2ZGWA 3META 2AKWB 1O9SA 3LW5E 4PHCA 2ZIMA 3OYCA 1NE8A 2LCLA 2Y4YA 4RCBA 3GF5A 1H4QA 1WLEA 2AMCA 3M4QA 2QEXT 1YB3A 4UPAA 3QKJA 3TEHA 4PKCC 3L2WA 3VKIA 3CMEA 2XDPA 5I21A 2DZCA 4C92A 2RI3A 3PFSA 4E7KA 2LNVA 4CH5A 2JTMA 12ASA 2X4JA 11ASA 1X75C 3ASKA 3VQYA 5LJ3h 3G71T 4PLLA 4MZTA 2H3JA 1I8FA 3BY7A 1M9SA 4M77B 1NPRA 4M77E 4QVCA 4JLGA 1M90C 4UC4A 2KK4A 2RK1A 4HWTA 4M7DD 2EFIA 1VQ4A 3PT9A 3CCSA 1FYFA 3BW1A 4C92G 4X34A 2ZT5A 4KR2A 5C52B 3KFUA 3CPWS 2GQVA 2QQRA 5A2QE 4KULA 2K3XA 2P5IA 1B70B 5K1PA 2LQKA 3CCJA 3CC4A 4HCZA 3X24B 2FYKA 3JB9H 3ERRA 2OAUA 3HFNA 2WACA 1JRIA 5C6SA 3OQ5A 1G5IA 3OSVA 3CD6A 1XNIA 4HVCA 2HD0A 3NTKA 4XQ3A 2MAMA 4IUQA 2O01E 4EO4A 2ZPFB 1YHQA 3UGTA 3M4YA 4E7HA 3HRIA 3HXYA 3ER0A 3LX7A 4F7UG 1LOJA 4A4KA 4YPFA 4ZIBA 3M5AA 3V8LA 5CR2A 4YRQA 5GMKj 3A32A 1ZHIA 4XU2A 1E1TA 2EWNA 1ZQ1A 4C92F 5GANg 1YFRA 4QQDA 5KCHA 2EQUA 3REXA 4KR3A 3CCET 3ZEHA 2X4WA 2HNIA 2QQ9A 1NNHA 4DOVA 5LJ5j 3MCAB 3V8KA 4P71A 4IUTA 2E3CA 3HY0A 4JRQA 1EOVA 5CO7A 3M4GA 3ME9A 1H4TA 3QO5A 3OD1A 4C8QB 3L42A 2LVMA 4XTXA 2E70A 4TQFA 1N27A 4FIBA 5LJ5g 2ZR3A 1M1GA 4G85A 2G3RA 1B7YB 1KD1U 5FU7B 2ZR2A 1GGMA 1N9WA 4WI1A 4P3PA 2YRVA 1VQ5T 2AKWA 1H4VB 2FB7A 3OW2A 4PNOA 3C4SA 3CMAA 1BBWA 2ZZDA 1Q86U 2A8EA 2QHUA 3ZFJA 3LH0A 1VQKT 3GIBA 3H6ZA 5J39A 1EVLA 2L8DA 1JB0E 3A8OB 4M7DC 3CCLA 3TU4K 4A4FA 2E65A 5CKEA 3WVEB 3JRZA 5KNNA 1QVFS 4HWSA 1G3TA 3S3MA 3R07A 5GAMd 5LJ5e 3UH0A 3JB9G 4JS4A 1QP2A 1FWZA 3MP1A 4II1A 1FXXA 4LD9K 3P8HA 4YRRA 3QIIA 4HWRA 2F69A 3RMSA 2D6FA 5CVIA 4M77A 4ELZC 1YJWT 4B9XA 1ADYA 2JTFA 4IUPA 3DLLA 2R5AA 3M9QA 4RG2A 4X9DA 3JCMh 2YLCA 1K9MU 4IKFA 1X56A 4TQDA 3LGLA 1K8AU 3JCMX 1YIJT 2ODRC 1JJCB 2OTLA 3OB9A 1B70A 4XTWA 3OBWA 4K88A 2DK3A 4JRIA 4X9CA 3LYIA 2GFAA 2RB6A 4MDWA 3NETA 4M77G 5GAOm 3CEYA 4J6YA 2NS6A 4CS3A 3PZCA 2RK2A 2QQSA 2EJ9A 1NJ8A 1Y71A 4XK8E 4J15A 4BI8B 2CZ7B 3L2ZA 3M4PA 3GP8A 1WPYA 4MMLA 4P75A 3TEHB 3QTCA 2CJAA 2YLBA 4C92B 4C92E 2DKGA 3URGA 3CCRA 2CS7A 2PQWA 2CGHA 1M1KC 4M7AD 2A3LA 3HXVA 1PSEA 4PJOB 4PJOE 3CCVT 5AYFA 1BBUA 1VQZA 3HL8A 2JOYA 4NCXA 1YBYA 3JCMW 1EIYA 5FRNA 3O8VA 4M78D 3INZA 4KUIA 4M77F 1USYC 3OBYA 4L6V5 2O4XB 4LVKA 5LJ3d 4C8QA 4ME7A 4N4IA 3G1ZA 1VUBA 4LDYA 4BE0A 4ATOA 3QDRB 5J26A 4F7UB 3S3NA 2IY5A 3P8BB 2XK0A 4F7UE 1G3WA 4CH4A 1H4SA 4P72C 3QJYA 4J7FA 2XKOC 4P5NA 2BIVA 2CJBA 2HBPA 3VQXA 3T9NA 2I4OA 2RHYA 1RI0A 3QNEA 5GANf 2I4MA 3RACA 1YJWA 3UFGA 4CH3A 4N4GA 2DJZA 3OYEA 1Q81C 1Q82U 1N9SA 4C8QG 4HKEA 1M90U 2XGTA 1U1TA 3N5BB 4M75D 1I5LA 1SETA 5C53B 1VQPT 3CC2T 3C12A 3FLGA 3CXCS 1PSFA 3WVDB 2DAQA 4FU6A 2P4TA 3E9HA 3G4SA 2CZ1B 4YRLA 1NJ2A 4MZPA 1YFSA 3MO8A 3JSCA 3NTHA 1VQ6T 3LGFA 3PIOA 4P74C 2E6NA 4UP8A 3BJUA 3VQVA 3JCMP 1VQOA 4QVDA 3JCMg 1H3ZA 4J7IA 4NS5A 3KXTA 4YROA 2M0OA 4XTUA 3M53A 4P73A 3CCUT 1V29B 4DOWA 3JB9I 3M57A 4FT4A 5GAOl 3QYGB 1I4K1 3J81E 3Q1JA 4ZGEB 3OYLA 4RDXA 2DXUA 3A8MB 1JJCA 3CCMT 5GAOp 1X2GA 4YRTA 2XIDA 4CH6A 5LJ3f 3PGGA 4C8QF 1XTDA 2ARSA 4PG3A 2DXTA 4EMGA 1HK9A 2CJ9A 1N9RA 4RG8A 1EIFA 1PYSA 2RO0A 2KMTA 3LSSA 1WQ7A 3HRUA 4MMKA 3RMQA 2RJEA 2DTOA 3E1SA 4M78C 1G5VA 5KE2A 2F5TX 4QQ6A 3HXUA 3SD4A 3LC0A 3G7ZA 3CXCA 2DTHA 3A8GB 3QG1A 4YRKA 3JCMJ 1D3BA 5C0MA 1YJ9T 5CCAA 1YITA 3QXEB 1KQ2A 4OB2B 4BDYA 3OMGA 4PJOA 1VQLT 1NYRA 4KQEA 3VUBA 2DD5A 4BI3A 2XDDA 2IG0A 4CS4A 4K86A 5GAN5 1MHNA 5GAMj 3EFRA 5KE3A 1QVGA 4LNSA 5GAN8 1R8OB 2XU8A 3G6ET 4LVLA 4M75C 3I55T 2O4XA 1GXIE 2XICA 5F5WA 5CIUA 1W66A 4PJOG 4KUDK 2QA4A 4F7UA 1QVPA 5GAMg 3UWNA 3PCOB 3KUFA 4AH6A 3BFMA 3JCMd 4J6XA 3OS2A 2QTXA 2DTIA 2XHCA 4ZN1A 4C0FA 4M7AA 4BUGA 3QYHB 1VQNT 3NFCA 2RM4A 5GAOq 4XEMA 2I4LA 1J5WA 5DY9A 4Y91A 4ZTZB 1KG1A 3SWNC 5GANj 1YCYA 1G5HA 2M1HA 3VYHB 2ZZGA 4Q15A 4YRPA 2ODRD 3SB2A 2OTJT 4J8OA 3OSSC 1XQHA 3EFSA 5DLQE 4R55A 3CCMA 4TWAA 2E5AA 3HY1A 2I2LA 3OYAA 1VQ7T 2K5IA 4M78A 2LT1A 1VQ8T 4UP7A 3UGQA 4M7DB 4HT4A 3L2UA 2P0QA 2ARUA 4H2XB 3NTIA 1YGBA 3MEUA 1LJOA 4M7AG 3A7UA 1XOVA 4CRIA 2QXFA 1X54A 1JBMA 3V7SA 4XU3A 1K73U 2DZ9A 1QW1A 3OYGA 4EMKC 1HXDA 4PJOF 1EIYB 3L1AA 1UB4A 2QEXA 2Q7GA 3LSQA 1NJ5A 4M78G 4HCCA 3RL6A 3VJPA 3JAME 2CIMA 4C8QE 3S6WA 3FIFA 3CBMA 3CPWA 3PMIA 4DPGA 3X25B 1BIAA 3JCMc 2IY5B 1YJ9A 1YJNT 2X4XA 2EQKA 2I4NA 5GANe 3P8YA 2JUFA 5ELNA 3G71A 4RQEA 1M1KU 3MHXA 2ZZFA 2PUOB 1I81A 1NJIU 1M4ZA 4F7UF 3OYHA 4A53A 5LJ3j 1Q7YU 4LDWA 3QSUA 3JCMf 1KHIA 3RF1A 3MEWA 2LTOA 5GMKe 3RKYA 2RHUA 1YI2T 1VQ9T 3L2RA 2NLUA 4M7AF 4BACA 4M75G 4OGEA 3C94A 2PMFA 4EMHA 2RHSA 2XG8D 2XI9A 5HGQA 2EQMA 5LJ3g 2RA2A 3J80E 1HC7A 4P3NA 5D6WA 2XDBA 3IG2A 3LWHA 5FROA 4BY6C 3OMCA 3NELA 4J6WA 4N4HA 2ZZEA 4IURA 3DB4A 4HA8A 3X28B 1WGSA 2Q5HA 2JVVA 3RGLA 5CQYA 1KHCA 1N6AA 1TH7A 2VGNA 4C5HA 1S72T 4CS2A 3HRSA 3PTAA 2CZ0B 4N0AC 2E41A 1VIFA 5C51B 1Q81U 2MI6A 2DDZA 2L3RA 3IALA 3CC7T 2DO3A 4P3OA 1ATIA 1UGSB 2E5QA 3RUXA 5LJ3e 4NL2A 1KC8C 5K1XA 1U1SA 4LDVA 1SRYA 3GNGA 4RQFA 1L0WA 1W4SA 4BW9A 4C0ZA 4BI4A 3W3SA 2RJFA 3A74A 3CCQT 3PCOA 1LNXA 1E24A 2ZT6A 3A7AA 3P8DA 3CCEA 2CKKA 2PMEA 4XTYA 1PYSB 3JCMQ 3DSQA 3QHSA 5FU6C 5GAN6 5A0LA 3QO7A 4YRFA 3TCJA 4RKUE 4V2SA 3S3OA 1VQMT 4YP0A 3JB9F 2P0KA 3OYIA 3VQWA 3HXWA 3I7FA 4XAXB 2FL7A 4YRCA 1UGRB 1EVKA 2VYTA 3M59A 3CMQA 2A7YA 1QVFA 4M7DA 4H2XA 1YJNA 2ZCEA 1WU7A 1D3BB 5A0DA 4JRPA 2LCCA 5IN1A 4ZGDB 5GAMf 2LQ8A 2DD4A 3OS1A 4YCUA 1BI0A 1VQ5A 3V7RA 4HT9A 4H2WA 4IUVA 2WSCE 1KD1C 4OLFA 1VQKA 1VQ9A 3RKWA 2ZCFB 2ZPIB 2HQXA 4B9WA 2DIGA 1JJ2S 2V8KA 3A31A 4M7DG 1IZ6A 2BUDA 4RMFA 3V7CA 4N0AA 2X35A 3HXXA 3MQZA 3MF2A 2DQ3A 2GF7A 1W2BS 3A8HB 4WJ4A 3ZBDA 1Y7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A54 A;  4HWO A;  4EMK A;  2DVE A;  3V8L A;  4YRQ A;  4MMK A;  5GMK j;  3IKM B;  3A32 A;  4H2Y A;  4H2V A;  2DTO A;  4NL3 A;  4XU2 A;  4M78 C;  2DU7 A;  1E22 A;  4DQ2 A;  4E51 A;  1E1T A;  2EWN A;  2C8M A;  1X2H A;  1B34 B;  4C8Q C;  4C92 F;  4C92 D;  3HXU A;  3LC0 A;  4M7A B;  3JB9 J;  5GAN g;  4M7A E;  1YFR A;  1EQR A;  3RES A;  3REX A;  2RHQ B;  2DTH A;  4KR3 A;  4JRK A;  2HNI A;  1Z7M A;  4YRK A;  4M75 F;  1Y96 A;  3JCM J;  1NNH A;  4Q6G A;  1D3B A;  4PJO D;  5LJ5 j;  3V8K A;  1KQ2 A;  4P71 A;  4PJO A;  2E3C A;  1NYR A;  3HY0 A;  3RIR A;  4KQE A;  1EOV A;  1HTT A;  1ADJ A;  4J5Y A;  5GAN d;  1WQW A;  4M78 B;  3HFZ B;  3M4G A;  4CS4 A;  4M78 E;  1H4T A;  4K86 A;  3QO5 A;  4YRS A;  3OD1 A;  4C8Q B;  4RCC A;  5GAN 5;  4C92 C;  2E64 A;  1LYL A;  5GAM j;  3EFR A;  4XTX A;  4LNS A;  4TQF A;  5GAN 8;  2QHV A;  3JCM b;  4M7D F;  3MEY A;  2QHS A;  5GMK m;  4YRN A;  5LJ5 g;  2ZR3 A;  4M75 C;  2J3M A;  4G85 A;  3REU A;  1B7Y B;  1G51 A;  4TVA B;  5GAO r;  2ALY A;  2AMC B;  1C0A A;  2G4C A;  5F5W A;  1GGM A;  1N9W A;  2ZR2 A;  2EAY A;  4WI1 A;  3JCM V;  3FJP A;  4P3P A;  1W66 A;  4PJO G;  4F7U A;  2AKW A;  1H4V B;  2FB7 A;  2VC8 A;  2Y90 A;  3NEM A;  4PNO A;  1BBW A;  5GAM g;  4XU0 A;  3AHU A;  3PCO B;  2QHU A;  4AH6 A;  3BFM A;  3JCM d;  5LJ5 d;  3GIB A;  4J6X A;  2QTX A;  1EVL A;  3VU3 C;  2DTI A;  1USY A;  4M7D C;  2E1H A;  4M75 B;  4M75 E;  4M7A A;  2E65 A;  3V8J A;  4P73 C;  2ZXF A;  4YCW A;  2RM4 A;  3RKX A;  5GAO q;  3A5Z A;  2I4L A;  4XEM A;  5KNN A;  2DQ0 A;  4HWS A;  1J5W A;  1EFW A;  5DY9 A;  4Y91 A;  4ZTZ B;  3HFV A;  3R07 A;  2VXF A;  2ZTG A;  5GAM d;  3JCM e;  5LJ5 e;  2YHT A;  3SWN C;  5GAN j;  1YCY A;  1G5H A;  3UH0 A;  5GMK h;  2ZZG A;  4Q15 A;  5GMK i;  1E1O A;  3JB9 G;  4P72 A;  4YRP A;  4YRJ A;  2ODR D;  3SB2 A;  5GMK l;  2Q7H A;  3EFS A;  4M77 D;  4TWA A;  1NJ1 A;  3VBB A;  2E5A A;  3HY1 A;  2I2L A;  4M78 A;  3E9I A;  1X01 A;  4YRR A;  4HWR A;  3L4G B;  4UP7 A;  3UGQ A;  4M7D B;  4M77 A;  4YDQ A;  2ARU A;  4H2X B;  2DEQ A;  1SES A;  1YGB A;  4UP9 A;  5GAN 3;  1KQ1 A;  3HFO A;  1ADY A;  1KMM A;  3HXZ A;  4XTV A;  4H02 A;  1ASZ A;  1LJO A;  4M7A G;  3A7U A;  3JCM h;  4X9D A;  5LJ5 h;  2YLC A;  3MF1 A;  2EJG A;  1X54 A;  4H2U A;  1Z7N A;  3NEN A;  1JBM A;  2RHS B;  3SWN B;  1B8A A;  1X56 A;  3V7S A;  4TQD A;  4XU3 A;  2DZ9 A;  1B7Y A;  1MGQ A;  4TVA A;  4EMK C;  3JCM X;  2ODR C;  2ZT8 A;  1HXD A;  4PJO F;  1JJC B;  1EIY B;  2QHT A;  1QF6 A;  3L1A A;  1B70 A;  2JN0 A;  4XTW A;  5GAM h;  4K88 A;  4JRI A;  2ZNI A;  2Q7G A;  3QO3 A;  4X9C A;  4EX5 A;  3LSQ A;  1NJ5 A;  4M78 G;  2RB6 A;  3A7R A;  4TVW A;  3HRK A;  4P74 A;  3NET A;  4M77 G;  5GAO m;  2P0L A;  3RL6 A;  4ZTU B;  2CIM A;  1H64 1;  4C8Q E;  4YRI A;  4H2S A;  4HWP A;  4J6Y A;  3FIF A;  4CS3 A;  4YRG A;  3PZC A;  4DPG A;  2VXE A;  2EJ9 A;  1BIA A;  3JCM c;  4YYE A;  2IY5 B;  1NJ8 A;  4NOY A;  4EMK B;  3TEG A;  4P71 C;  2I4N A;  1NJ6 A;  1M8V A;  5GAN e;  1KMN A;  3P8Y A;  4J15 A;  4PJO C;  5ELO A;  5ELN A;  4RQE A;  4O2D A;  3L2Z A;  3M4P A;  1WPY A;  2ZZF A;  1I81 A;  3JB9 D;  4F7U F;  4MML A;  4A53 A;  5LJ3 j;  4WF2 A;  4P75 A;  4X5O A;  3QSU A;  3P8T A;  3TEH B;  3JCM f;  5LJ5 f;  3QTC A;  3RF1 A;  2DU5 A;  5GMK e;  1B76 A;  3RKY A;  3P8V A;  2CJA A;  2YLB A;  4JLI A;  4C92 B;  1RIQ A;  4C92 E;  2DKG A;  3HSB A;  3IKL A;  2CGH A;  1Y96 B;  4M7A F;  4M7A D;  1WYD A;  5GAN h;  3HXV A;  4M75 G;  1KOG A;  2E10 A;  1B34 A;  2PMF A;  4PJO B;  4EMH A;  4PJO E;  2RHS A;  1BBU A;  1IL2 A;  5HGQ A;  5LJ3 g;  2RHQ A;  2RA2 A;  1VQZ A;  1HC7 A;  4TVY A;  4P3N A;  2Q7E A;  2ART A;  3IG2 A;  4NCX A;  3JCM W;  3HTZ A;  5E3I A;  1YFT A;  3NEL A;  1EIY A;  4J6W A;  2ZZE A;  4M78 D;  4YRE A;  4HA8 A;  3INZ A;  5CAI A;  1USY C;  4M77 F;  4C8Q D;  2Q5H A;  2XTI A;  4TTV A;  4YRM A;  3RGL A;  3HFZ A;  4M7A C;  5LJ3 d;  1TH7 A;  2EL9 A;  2ALY B;  4C8Q A;  5GAM e;  4HT8 A;  4M7D E;  4L87 A;  2ZIN A;  3QO8 A;  4CS2 A;  1QE0 A;  3A5Y A;  3G1Z A;  2ZGW A;  4N0A C;  5GAN 2;  2E41 A;  4F7U B;  2AKW B;  5C51 B;  2IY5 A;  4F7U E;  2DDZ A;  3IAL A;  4PHC A;  4CH4 A;  2ZIM A;  1H4S A;  4JUV A;  4P72 C;  2ZNJ A;  2EJF A;  4P3O A;  4RCB A;  1ATI A;  1M5Q 1;  3RUX A;  2CJB A;  5LJ3 e;  2ZIO A;  3VQX A;  1NYQ A;  1H4Q A;  4NL2 A;  1WLE A;  2AMC A;  2Q5I A;  2I4O A;  3M4Q A;  5K1X A;  1U1S A;  1YB3 A;  1SRY A;  5GAN 7;  4UPA A;  4M77 C;  5GAO n;  3QNE A;  4YCV A;  5GAN f;  2I4M A;  3TEH A;  4RQF A;  1L0W A;  3RAC A;  3FB9 A;  3ICA A;  3UFG A;  4BW9 A;  4CH3 A;  1X55 A;  3WQZ A;  2DJZ A;  4H2T A;  3W3S A;  5I21 A;  2DZC A;  3A74 A;  3PCO A;  2J3L A;  4C92 A;  1N9S A;  4C8Q G;  2K57 A;  1LNX A;  1E24 A;  1U1T A;  2XGT A;  2ZT6 A;  3A7A A;  4XU1 A;  4M75 D;  4CH5 A;  1I5L A;  12AS A;  11AS A;  1SET A;  3VQY A;  5C53 B;  2PME A;  4XTY A;  4M75 A;  5LJ3 h;  1PYS B;  3JCM Q;  3DSQ A;  3QHS A;  3E9H A;  5GAN 6;  1I8F A;  3QO7 A;  4YRF A;  4YRL A;  1NJ2 A;  3BY7 A;  4V2S A;  1YFS A;  4M77 B;  4M77 E;  4YP0 A;  4QVC A;  3JB9 F;  4WJ3 M;  4P74 C;  3VQW A;  3HXW A;  3I7F A;  4UP8 A;  1BIB A;  3BJU A;  3VQV A;  4YRC A;  3JCM P;  4HWT A;  4M7D D;  1ASY A;  1FYF A;  3BW1 A;  4BWA A;  4QVD A;  3JCM g;  4C92 G;  1EVK A;  2ZT5 A;  3CMQ A;  3L4G A;  5C52 B;  4KR2 A;  4M7D A;  3KFU A;  4H2X A;  4OP0 A;  4YRO A;  2ZCE A;  1WU7 A;  4XTU A;  2C7I A;  1D3B B;  4P73 A;  2P5I A;  2ZT7 A;  1B70 B;  5K1P A;  3RER A;  3JB9 I;  5GAM f;  2RD1 A;  4P75 C;  2FYK A;  5GAO l;  3JB9 H;  3SWN A;  4G84 A;  3ERR A;  1I4K 1;  4YCU A;  3V7R A;  3HFN A;  4HT9 A;  4RDX A;  2DXU A;  4H2W A;  1JJC A;  5GAO p;  1JRI A;  4OLF A;  1X2G A;  4YRT A;  1G5I A;  4CH6 A;  3RKW A;  4M78 F;  3TUP A;  4K87 A;  1WNL A;  5LJ3 f;  3PGG A;  4C8Q F;  3A31 A;  2ARS A;  4PG3 A;  4HVC A;  2DXT A;  4EMG A;  4XQ3 A;  1HK9 A;  4M7D G;  5GAN 4;  3BDU A;  2CJ9 A;  4RMF A;  4XEO A;  3V7C A;  4N0A A;  4EO4 A;  4XTZ A;  3UGT A;  3HXX A;  3MF2 A;  1N9R A;  1SER A;  3HRI A;  2DQ3 A;  3HXY A;  4F7U G;  1LOJ A;  3QUI A;  4WJ4 A;  1PYS A;  4YPF A;  3LSS A;  4ZIB A;  1WQ7 A; 
#chains in the Genus database with same CATH topology
 2WSF E;  4A54 A;  4HWO A;  2RMO A;  3SDZ A;  2MWP A;  1N8R C;  2IVW A;  4FYX B;  2HKQ B;  1WHH A;  2CUB A;  4R56 A;  4H2Y A;  1I0C A;  4NL3 A;  2DU7 A;  4E51 A;  3CME T;  2C8M A;  4ORZ A;  1B34 B;  1X2H A;  1JQQ A;  2WSE E;  4JPB W;  1G3Y A;  1AT1 B;  4M7A B;  1OZ2 A;  2DLP A;  3H8Z A;  4M7A E;  1KQS S;  3RES A;  1VYT A;  2RHQ B;  1G3S A;  3EAE A;  2RQT A;  2LJ1 A;  1Z7M A;  1YN8 A;  2K9G A;  1VQ6 Q;  1VQ4 Q;  2DNU A;  3CCS Q;  2EYX A;  2CZ6 B;  4ELY C;  2DFU A;  3GLX A;  2DIQ A;  1M1F A;  4Z88 A;  1YIJ A;  2KYM A;  2KI7 A;  1PM3 A;  2KDS A;  1ADJ A;  2DF6 A;  4J5Y A;  2HEQ A;  1SPK A;  1WQW A;  4M78 B;  4Y28 E;  3ULR B;  4M78 E;  4YRS A;  3EG9 A;  1PC0 A;  4RCC A;  3GPL A;  3CC4 Q;  1WHK A;  4C92 C;  1AZE A;  2E64 A;  1VQ4 T;  1K76 A;  3CCS T;  4KGX B;  2V1R A;  4R0K A;  1ZSZ A;  2FG0 A;  2NUZ A;  2QHV A;  4M7D F;  3MEY A;  3NGP A;  3UF4 A;  1UTI A;  4BDZ A;  5I22 A;  1UEB A;  5L8R E;  2J3M A;  2LDM A;  3REU A;  2J7I A;  5GAO r;  3CD6 Q;  1C0A A;  2FZK B;  3CC4 T;  5I2M A;  2G4C A;  3MP8 A;  3FC3 A;  2ROL A;  5EG2 A;  3M54 A;  1E6H A;  3JCM V;  1HYO A;  2C06 A;  1M3A A;  1QCN A;  1IXD A;  3EHR A;  4JS5 A;  3MEA A;  2VC8 A;  2Y90 A;  4C0D C;  2CH4 W;  3PVQ A;  2EW3 A;  4XU0 A;  3AHU A;  4HCB A;  2B8A A;  1RAC B;  4QW2 A;  5A0G A;  4DA4 A;  1D0Z A;  2LC4 A;  3CD6 T;  2KVQ G;  1USY A;  4VUB A;  2ROT A;  3PMT A;  3QZ5 B;  4M75 B;  2ZPB B;  1W2B A;  4M75 E;  3V8J A;  2JZ2 A;  2K3Y A;  3OYD A;  6AT1 B;  3HTR A;  4YCW A;  4IIO A;  2KSS A;  2DQ0 A;  2R58 A;  4FL6 A;  3QWY A;  1EFW A;  3HFV A;  2VXF A;  3JCM e;  2X4Y A;  2YHT A;  3L2V A;  4QQG A;  3CCV A;  2MIO A;  3OYJ A;  5GMK h;  3HP9 A;  3TRE A;  1E1O A;  3NMZ C;  2MCN A;  4P72 A;  1AHJ B;  4LUD A;  4YRJ A;  1MMA A;  3OS0 A;  1BI3 A;  1GRI A;  5GMK l;  4JZ3 A;  4E7J A;  4M77 D;  5KYX A;  2ED0 A;  4ZTJ A;  1E6G A;  2ZPH B;  3E9I A;  1X01 A;  5HK3 A;  3M55 A;  1QWE A;  3L4G B;  4LVJ A;  4MDX A;  1BCO A;  2K5F A;  5HCK A;  2M02 A;  3THK A;  1Y57 A;  3HFO A;  3LWI A;  4XTV A;  1ASZ A;  1WHJ A;  3CBO A;  5LJ5 h;  2EJG A;  1Z7N A;  3NEN A;  2V8I A;  2V8J A;  2RHS B;  4JDS A;  3GOX A;  1QP3 A;  3SWN B;  1B8A A;  4AT1 B;  4TVA A;  2LZ6 B;  3OYN A;  2ZT8 A;  1QLY A;  2CYZ B;  1K4U S;  2KT1 A;  2EQJ A;  2LQN A;  2JN0 A;  3FRN A;  2YT6 A;  1TG0 A;  2JMA A;  2RJC A;  2K3B A;  3H0F A;  2DYB A;  4OMM A;  2Y4X A;  3I55 Q;  4P74 A;  1QVG P;  1OPK A;  4BB7 A;  3X26 B;  1QCF A;  1H64 1;  1PRL C;  4H2S A;  1SSF A;  4HWP A;  3CMA Q;  2MYS A;  3J7A F;  2FPF A;  4GLK A;  4J9D A;  1JEG A;  2E12 A;  4NOY A;  2K5L A;  2P4R A;  4EMK B;  2RI2 A;  1FMK A;  3TEG A;  4P71 C;  1NPP A;  1M8V A;  1VQP A;  1KMN A;  3CC2 A;  3OYB A;  3M0R A;  4Q5W A;  3CCL Q;  4O2D A;  1LVK A;  1Q82 C;  3EG2 A;  2O31 A;  4RTY A;  2J05 A;  2D9T A;  4OMF B;  4WF2 A;  3CMA T;  2L2P A;  3C95 A;  4ZTF A;  4AFZ C;  2EYQ A;  1VQ6 A;  3SFM A;  2KQW A;  3RBB B;  2DU5 A;  1B76 A;  2DIL A;  3EH1 A;  4JLI A;  4A4G A;  5J3B A;  3HSB A;  3CCL T;  4E7L A;  2JXB A;  1SRL A;  3M0Q A;  3IKL A;  4IUU A;  1Y96 B;  2JS0 A;  2M9U A;  3E19 A;  1WYD A;  1LPL A;  1WIE A;  5FW9 A;  1IO6 A;  1KOG A;  2E10 A;  1B34 A;  2PVD B;  4LE9 A;  1M2O A;  5KYU B;  4CC2 A;  1WJR A;  1IL2 A;  5FWB A;  1W1F A;  2RHQ A;  3CCU A;  2L89 A;  4CC4 B;  4TVY A;  2R5M A;  2Q7E A;  3MEV A;  4GLM A;  2CP5 A;  3HTZ A;  5E3I A;  2QAS A;  4O6J A;  4FW2 A;  4A4E A;  1U3O A;  2HMA A;  2ZPE B;  3OW2 S;  4YRE A;  2LT4 A;  1WJQ A;  2DL3 A;  2RF0 A;  4C8Q D;  3EFO B;  2XTI A;  1M3C A;  1X43 A;  3VS7 A;  3I56 Q;  2OTL Q;  2D1X A;  1KC8 U;  2KRO A;  4EPC A;  2ALY B;  5GAM e;  4HT8 A;  4M7D E;  1OX8 A;  3QO8 A;  4QT7 A;  3VUZ A;  2K4Y A;  1QE0 A;  5HY6 A;  1T3S A;  5GAN 2;  3WXM B;  4J83 A;  4JUV A;  2ZNJ A;  4RTZ A;  2EJF A;  2MK5 A;  3I56 T;  2OTL T;  1IB8 A;  1M5Q 1;  4BY6 B;  1RAF B;  2ZIO A;  1NYQ A;  2Q5I A;  5FRM A;  3EGD A;  1M8M A;  4D6W A;  5AT1 B;  5GAN 7;  2EIF A;  4M77 C;  4PLI A;  5GAO n;  2LNH B;  4YCV A;  2YUN A;  4F14 A;  3FB9 A;  3TSW A;  4ESR A;  3ICA A;  1X55 A;  3WQZ A;  4H2T A;  2BTT A;  3CPW P;  3M58 A;  2QTV A;  3A5Z B;  1RAA B;  2J3L A;  1H3H A;  2K57 A;  1IGU A;  1ZSG A;  1TU0 B;  4XU1 A;  2PTK A;  4ZGJ B;  3H41 A;  3G1J A;  3FDR A;  4M4Z A;  4ZNX A;  2O9V A;  4M75 A;  3CCR Q;  1QCO A;  2GNC A;  4KT0 E;  4FW1 A;  2QI2 A;  2F2W A;  2RI5 A;  5IT9 E;  2FEI A;  3QPH A;  1VQL A;  3FJ5 A;  2HQE A;  1EZZ B;  2FZG B;  3BDL A;  4WJ3 M;  1UJ0 A;  1I5O B;  4RTV A;  4FYW B;  1BIB A;  3VYG A;  2J6F A;  2NWM A;  2MOX A;  4A4H A;  1ASY A;  2M16 A;  3CCR T;  1SKU B;  3UDC A;  4BWA A;  1UGP B;  2GGR A;  4E7I A;  3L4G A;  1WXU A;  4OP0 A;  3G6E A;  2C7I A;  2MWO A;  3I55 A;  1RUW A;  5FU6 B;  3E9F A;  2ZT7 A;  1FX7 A;  3RER A;  1O75 A;  2RD1 A;  1F1B B;  4P75 C;  3GNF B;  3SWN A;  4CC7 A;  1PCX A;  4G84 A;  3UT1 A;  5KCO A;  3OYM A;  2R57 A;  5KH6 A;  1HJD A;  4PJL A;  2HAX A;  3MP6 A;  2XD0 A;  4TVR A;  2CP3 A;  4M78 F;  4Z89 A;  4L5G A;  4K87 A;  3TUP A;  1WNL A;  1WHL A;  1N8R U;  3PIP A;  4X1V A;  5GAN 4;  3BDU A;  4OVA A;  2IIM A;  4XEO A;  1VQN A;  3LLR A;  1PKT A;  2VGM A;  4XTZ A;  4YTL A;  1SER A;  2E5K A;  1BKB A;  3QUI A;  1UEC A;  1KIK A;  4O5V A;  4AG1 C;  3TVT A;  4EMK A;  2DVE A;  2LX9 A;  1YCS B;  5CK9 A;  1NLO C;  2GBQ A;  2GQI A;  2L5Q A;  3X20 B;  4C0G A;  2OTJ A;  1U8R A;  3IKM B;  3HRT A;  2RQU A;  1TTH B;  2VV5 A;  4H2V A;  4LXC A;  4BD3 A;  1VQ7 A;  1JU5 C;  4DQ2 A;  3VV0 A;  1E22 A;  1VQ8 A;  3G4S Q;  4C8Q C;  1KD1 R;  2RQW A;  4C92 D;  3JB9 J;  2OX7 A;  1C6V X;  2VUB A;  4OF1 A;  1EQR A;  1PG5 B;  3OYY A;  3E9G A;  1Q95 G;  2FHD A;  4JRK A;  4LVI A;  2OAW A;  1NEB A;  4M75 F;  1Y96 A;  2KGT A;  1BB9 A;  1VQO Q;  4Q6G A;  3I56 A;  1Q86 R;  4PJO D;  1WXT A;  2D8J A;  2KY9 A;  1VIE A;  3G4S T;  3AT1 B;  1OU9 A;  3VRZ A;  1RAE B;  4Y92 A;  5FU7 C;  4E47 A;  1OI1 A;  3NHN A;  2COY A;  3RIR A;  1HTT A;  1BK2 A;  5GAN d;  3HFZ B;  1OZ3 A;  1MMD A;  5I11 A;  1K73 C;  1WJS A;  3A8L B;  5FLX E;  3O5Z A;  2MF2 A;  1VQO T;  2PVO B;  3MKD A;  1LYL A;  2X51 A;  1OYX A;  2D0Q B;  1QVF P;  5CKB A;  5CKD A;  2DJQ A;  3JCM b;  4BE1 A;  2K2V A;  2DM1 A;  2KAF A;  1U06 A;  2QHS A;  1PNJ A;  3CBP A;  2RJD A;  5GMK m;  4YRN A;  1ABQ A;  2LP5 A;  2DBK A;  1AVZ C;  1CSK A;  2W10 A;  2H8H A;  4Z02 A;  3KBG A;  1PRM C;  2CRE A;  1G51 A;  3OS5 A;  2ALY A;  4TVA B;  2EYW A;  2AMC B;  4LD6 A;  3CPF A;  4MZM A;  1GFC A;  2RHZ A;  2EAY A;  3FJP A;  2ENM A;  2RN8 A;  1QQJ A;  3NEM A;  1X6O A;  2M0Y A;  2D8H A;  1WA7 A;  2NUT A;  4LDX A;  1K9M R;  5LJ5 d;  2KR3 A;  5DM7 R;  1Y07 A;  3VU3 C;  2V1Q A;  4EDU A;  5DLO A;  1NJI C;  2EKO A;  3FEO A;  1K8A R;  1YI2 A;  4L59 A;  1Q7Y C;  2DL5 A;  2E1H A;  3QZ9 B;  4KBM B;  4FSX A;  4P73 C;  1P92 A;  4OGC A;  1IHW A;  2ZXF A;  1DJ7 B;  3RKX A;  3A5Z A;  3MPU B;  4FM4 B;  2ZTG A;  1Q86 C;  3TEE A;  1BI2 A;  2RQR A;  5CQX A;  2DXB A;  4C0D B;  4RMO A;  5GMK i;  2NUP A;  3L2Q A;  2Q7H A;  4BE2 A;  2FVU A;  3PNW C;  4OB3 B;  2PU9 B;  2CDT A;  2AT1 B;  3HKS A;  2RHI A;  2COZ A;  1NJ1 A;  1HD3 A;  3VBB A;  5CKH A;  3UPU A;  1YIT Q;  3DKM A;  2P84 A;  1TUG B;  4YDQ A;  3QJ6 A;  3DB3 A;  2DEQ A;  1SES A;  4UP9 A;  5GAN 3;  1KQ1 A;  1KMM A;  4PL6 A;  3HXZ A;  5HKC A;  4IIM A;  2A36 A;  4C5I A;  4H02 A;  1IRE B;  3MF1 A;  4F16 A;  2E6Z A;  4OB0 B;  1S72 A;  4H2U A;  4OMO A;  4JJN K;  2PUK B;  4OMN A;  1BCM A;  2ZPG B;  1YIT T;  2BKD N;  3DLM A;  1B7Y A;  1MGQ A;  4AFS C;  3I9Q A;  4KGV B;  5CKF A;  3CC7 A;  2HCK A;  1D09 B;  5HK0 A;  1W70 A;  3OYF A;  2QHT A;  1QF6 A;  4CI0 C;  5GAM h;  2F5K A;  5I2S A;  2ZNI A;  3QO3 A;  4EX5 A;  5IHI A;  1RL2 A;  3REB B;  1MNE A;  1K9M C;  3A7R A;  3HRK A;  8ATC B;  4TVW A;  5LL6 S;  1Z9Z A;  2P0L A;  4FT2 A;  4ZTU B;  2QA4 Q;  1SHF A;  3HHT B;  3CCJ Q;  4YRI A;  1BI1 A;  1S1N A;  1K8A C;  1UFF A;  3CCQ A;  4YRG A;  3M56 A;  3OYK A;  2ECZ A;  4C5E A;  1BYM A;  1IRX A;  2VXE A;  2KBT A;  1SSH A;  4YYE A;  1UHF A;  4FSS A;  3HPW A;  4QVZ A;  3OA6 A;  1NJ6 A;  3CQT A;  2DPP B;  2RH2 A;  4PJO C;  5ELO A;  2RNA A;  1QMC A;  4ZN3 A;  2QA4 T;  3JB9 D;  3CCJ T;  2QQB A;  1FYN A;  2RHX A;  4LVM A;  3EGD B;  5D6Y A;  2DET A;  2DXC A;  4PFO A;  4C5G A;  2MMP A;  4HVU A;  4X5O A;  1ZBX A;  1VQM A;  3P8T A;  2CSI A;  5LJ5 f;  1YHQ Q;  2AHJ B;  1D1C A;  2P0P A;  1JJ2 A;  3P8V A;  4OB1 B;  1RIQ A;  1W2B P;  1MV3 A;  4J9G A;  2JNG A;  3RDV A;  2GFU A;  5M9O A;  1TS9 A;  3VS4 A;  2QQA A;  3QBY A;  5GAN h;  1QVG S;  4GY5 A;  2DER A;  3EH2 A;  1YNZ A;  3VS1 A;  2PVG B;  3UAT A;  3OY9 A;  1OU8 A;  1YHQ T;  5ECA A;  2BE9 B;  1Y0M A;  5D6X A;  2QDY B;  3I5R A;  5IAY A;  1UGQ B;  3F70 A;  2LRQ A;  4LN2 A;  2ART A;  1ZA1 B;  1Q82 R;  1YFT A;  3R6O A;  1M90 R;  2EQI A;  3VRY A;  5CAI A;  1NZ9 A;  1X6G A;  1OX9 A;  1KQS A;  4TTV A;  4YRM A;  3HFZ A;  4M7A C;  4LDU A;  2EL9 A;  4L87 A;  2ZIN A;  2GCX A;  2QEX Q;  3CXC P;  3A5Y A;  1ZUK A;  2V26 A;  3EG0 A;  2ZGW A;  3MET A;  2AKW B;  1O9S A;  3LW5 E;  4PHC A;  2ZIM A;  3OYC A;  1NE8 A;  2LCL A;  1GBQ A;  5IXB A;  2Y4Y A;  4RCB A;  2COW A;  1XJW B;  3M0U A;  1BU1 A;  3GF5 A;  1H4Q A;  1WLE A;  2AMC A;  3M4Q A;  2DBM A;  2QEX T;  1YB3 A;  4UPA A;  3QKJ A;  2YDL A;  3TEH A;  4RTW A;  3G71 Q;  4OMQ A;  4PKC C;  2CP0 A;  3L2W A;  1I1J A;  3VKI A;  3CME A;  2XDP A;  5I21 A;  2DZC A;  3EGX B;  4C92 A;  2RI3 A;  3PFS A;  1UJY A;  4E7K A;  2LNV A;  4CH5 A;  2JTM A;  4J9E A;  2VWF A;  2YUQ A;  12AS A;  2X4J A;  11AS A;  1X75 C;  2ED1 A;  3ASK A;  3VQY A;  5LJ3 h;  2PZ1 A;  3G71 T;  2Z0W A;  4PLL A;  4MZT A;  2H3J A;  1I8F A;  3EHQ A;  3BY7 A;  1M9S A;  4M77 B;  1NPR A;  4M77 E;  4QVC A;  4JLG A;  1M90 C;  4UC4 A;  1AWW A;  2KK4 A;  2RK1 A;  4HWT A;  4M7D D;  2EFI A;  1VQ4 A;  3PT9 A;  3CCS A;  1FYF A;  3BW1 A;  4C92 G;  4X34 A;  2ZT5 A;  4KR2 A;  5C52 B;  1KJW A;  1WHG A;  3KFU A;  2I0N A;  3CPW S;  2GQV A;  2QQR A;  5A2Q E;  1I07 A;  4KUL A;  4PJJ A;  2K3X A;  1B3Q A;  2P5I A;  1B70 B;  5K1P A;  2LQK A;  5L23 A;  2CUD A;  3CCJ A;  2DL8 A;  3CC4 A;  4HCZ A;  3X24 B;  2FYK A;  3JB9 H;  3ERR A;  2OAU A;  1KK7 A;  3HFN A;  4KGZ B;  2WAC A;  3PE0 A;  3R6N A;  1JRI A;  5C6S A;  3OQ5 A;  1G5I A;  3OSV A;  2JTE A;  3CD6 A;  1XNI A;  4CC3 A;  4HVC A;  2HD0 A;  3NTK A;  4XQ3 A;  2L3Q A;  2MAM A;  1GCQ C;  2F2V A;  4IUQ A;  1NG2 A;  2O01 E;  4EO4 A;  2ZPF B;  1YHQ A;  3UGT A;  3M4Y A;  4E7H A;  2HL3 A;  3HRI A;  3ER0 A;  3HXY A;  3LX7 A;  4DEX A;  4F7U G;  1LOJ A;  4A4K A;  8AT1 B;  4YPF A;  4ZIB A;  1OUL A;  2EYY A;  3M5A A;  3V8L A;  3CCE Q;  5CR2 A;  1ZUU A;  4YRQ A;  2NUT B;  5GMK j;  4PK4 A;  3A32 A;  1B07 A;  2A08 A;  1ZHI A;  1T0J A;  1ARK A;  4XU2 A;  2DYI A;  1UE9 A;  1E1T A;  2EWN A;  1ZQ1 A;  2ATC B;  4C92 F;  5GAN g;  1YFR A;  1VYV A;  4QQD A;  5KCH A;  2A0F B;  2EQU A;  1X2Q A;  3REX A;  1ZBJ A;  4KR3 A;  1ZLM A;  3CCE T;  3ZEH A;  2DEU A;  2X4W A;  2HNI A;  2QQ9 A;  1MV0 B;  1SRM A;  1MND A;  2K79 A;  1NNH A;  4DOV A;  5LJ5 j;  3QDF A;  3MCA B;  2NUP B;  3NPF A;  3V8K A;  4P71 A;  4IUT A;  2F1L A;  2E3C A;  3HY0 A;  1X2K A;  4JRQ A;  1EOV A;  1D1A A;  5CO7 A;  3M4G A;  3ME9 A;  1H4T A;  3QO5 A;  1JXM A;  3OD1 A;  4C8Q B;  2YXY A;  3L42 A;  2LVM A;  4XTX A;  1Z9Q A;  2E70 A;  1VQ5 Q;  4TQF A;  1TUC A;  2AZV A;  2QYZ A;  1N27 A;  4FIB A;  1EFN A;  5LJ5 g;  2ZR3 A;  1M1G A;  4J9F A;  2KXC A;  4G85 A;  2G3R A;  1VQK Q;  1B7Y B;  4DBH A;  2DE0 X;  1KD1 U;  1M3B A;  1WZO A;  5FU7 B;  1X69 A;  1GGM A;  1N9W A;  2ZR2 A;  4WI1 A;  4P3P A;  2AKK A;  1JXO A;  2YRV A;  1VQ5 T;  2AKW A;  1H4V B;  2JS2 A;  2FB7 A;  1PKS A;  3OW2 A;  1RAI B;  4PNO A;  2LX7 A;  1FMV A;  3C4S A;  3CMA A;  4RUG A;  1BBW A;  2ZZD A;  3D7S B;  1G8X A;  1Q86 U;  2A8E A;  2QHU A;  3ZFJ A;  3LH0 A;  2JW4 A;  1U5S A;  4PFP A;  1VQK T;  3GIB A;  4HVW A;  3H6Z A;  5J39 A;  1EVL A;  1K73 R;  2L8D A;  1D0Y A;  2E3I A;  3REA B;  1JB0 E;  4AFU C;  2DL7 A;  3A8O B;  4M7D C;  3CCL A;  2EPD A;  3TU4 K;  4A4F A;  2E65 A;  5CKE A;  3WVE B;  5KYY B;  3JRZ A;  3U23 A;  5KNN A;  1TWB A;  1QVF S;  4HWS A;  3EGX A;  1G3T A;  3S3M A;  4EIK A;  3EG1 A;  3R07 A;  5GAM d;  5LJ5 e;  1YJW Q;  2DRK A;  3IQL A;  2DVJ A;  3UH0 A;  4B6M A;  2YSQ A;  2FZC B;  1H92 A;  3JB9 G;  4JS4 A;  1QP2 A;  3I35 A;  1FWZ A;  3MP1 A;  2RQV A;  3GBQ A;  4II1 A;  1FXX A;  4JJC A;  4LD9 K;  3P8H A;  4J9B A;  3M0T A;  3QII A;  1K0S A;  4HWR A;  2F69 A;  3RMS A;  2D6F A;  4YRR A;  1H8K A;  4M77 A;  5CVI A;  4ELZ C;  3QWX X;  1YIJ Q;  1YJW T;  2NYS A;  4B9X A;  4Z8A A;  5IH2 A;  1ADY A;  2JTF A;  1M1K R;  4IUP A;  5FWC A;  3DLL A;  2R5A A;  2BZY A;  1NJI R;  3M9Q A;  4RG2 A;  4X9D A;  3JCM h;  2YLC A;  3C0C A;  1Q7Y R;  1K9M U;  1WX6 A;  4IKF A;  1X56 A;  4TQD A;  3LGL A;  2MPX C;  1K8A U;  4HXJ A;  1UGV A;  3JCM X;  1YIJ T;  2ODR C;  1RAH B;  2EBP A;  1JJC B;  2OTL A;  1CKB A;  2L0A A;  3OB9 A;  3JV3 A;  1B70 A;  4RTT A;  4XTW A;  3OBW A;  4K88 A;  2DK3 A;  4JRI A;  4X9C A;  5GJV B;  3LYI A;  2GFA A;  2RB6 A;  4MDW A;  2LMJ A;  3NET A;  4M77 G;  5GAO m;  2YRD A;  2HBW A;  4HCK A;  4AG2 C;  3CEY A;  4J6Y A;  2NS6 A;  4CS3 A;  3PZC A;  1W6X A;  2RK2 A;  2QQS A;  1R0C B;  2EJ9 A;  2HDA A;  1NJ8 A;  4DBQ A;  1Y71 A;  2DL4 A;  4XK8 E;  4J15 A;  2VKN A;  4BI8 B;  2CZ7 B;  3L2Z A;  3M4P A;  3SEM A;  3GP8 A;  1WPY A;  4QKU A;  4MML A;  4P75 A;  1WYX A;  1OEB A;  3TEH B;  2QAZ A;  3QTC A;  2CJA A;  2YLB A;  1ZSZ C;  4C92 B;  1Q81 R;  4C92 E;  2DKG A;  1T3L A;  3URG A;  4DBF A;  3CCR A;  1YWO A;  2CS7 A;  2PQW A;  2CGH A;  1M1K C;  4M7A D;  2A3L A;  2C0I A;  3HXV A;  1TSF A;  1E7O A;  1OPL A;  1SG5 A;  1PSE A;  1VYU A;  4PJO B;  4PJO E;  4LNP A;  5AYF A;  3CCV T;  1BBU A;  1VQZ A;  4JJB A;  3HL8 A;  2JOY A;  1NEG A;  2KEA A;  4NCX A;  4E7Z A;  1YBY A;  4HVV A;  3JCM W;  1MMG A;  3A1P A;  1EIY A;  1TUD A;  2KYB A;  5FRN A;  2EYZ A;  3O8V A;  4M78 D;  3INZ A;  1T0H A;  4KUI A;  4M77 F;  1USY C;  2HL5 C;  2ZAE A;  2J6K A;  3OBY A;  1GL5 A;  4L6V 5;  2O4X B;  4LVK A;  5LJ3 d;  4AMC A;  4C8Q A;  5KYW B;  1BBZ A;  1IGQ A;  1RI9 A;  4ME7 A;  4J9C A;  4N4I A;  3G1Z A;  1VUB A;  4LDY A;  4BE0 A;  2F2X A;  3UA7 A;  4ATO A;  3QDR B;  5J26 A;  4F7U B;  3E2U A;  3S3N A;  3P8B B;  2IY5 A;  2XK0 A;  4F7U E;  3SHW A;  1G3W A;  4CH4 A;  3TSZ A;  1H4S A;  4P72 C;  3QJY A;  4J7F A;  3MJX A;  2XKO C;  2B86 A;  4P5N A;  1G2B A;  2BIV A;  2CJB A;  2HBP A;  3VQX A;  3BE3 A;  3T9N A;  2I4O A;  5D7U A;  1X27 A;  2PNI A;  1VA7 A;  2RHY A;  2KRM A;  1RI0 A;  4FYY B;  1C1A A;  1VQP Q;  3CC2 Q;  2QDL A;  3QNE A;  5GAN f;  4PJM A;  2I4M A;  3RAC A;  1YJW A;  1GBR A;  3UFG A;  4CH3 A;  1RAG B;  4N4G A;  1V76 A;  2DJZ A;  3OYE A;  1Q81 C;  3TQ7 P;  1Q82 U;  1N9S A;  4C8Q G;  2SEM A;  5IXF A;  4HKE A;  1M90 U;  2O88 A;  1U1T A;  2XGT A;  3N5B B;  4M75 D;  1I5L A;  1SET A;  5C53 B;  1VQP T;  3CC2 T;  2KXD A;  4E2F B;  4DBR A;  1ACM B;  3C12 A;  3FLG A;  3CXC S;  1PSF A;  3WVD B;  2DAQ A;  2FO0 A;  5KYY A;  4FU6 A;  2P4T A;  3E9H A;  3PVL A;  3G4S A;  1R77 A;  2KRN A;  2HKN A;  2CZ1 B;  4YRL A;  1NJ2 A;  4MZP A;  1YFS A;  1X6B A;  3MO8 A;  2L3S A;  1K0X A;  3JSC A;  3NTH A;  1VQ6 T;  3LGF A;  3PIO A;  4P74 C;  2E6N A;  1JJ2 P;  3CCU Q;  4UP8 A;  3BJU A;  1TOV A;  4FYV B;  3VQV A;  1YFN A;  3JCM P;  1VQO A;  4QVD A;  3JCM g;  1H3Z A;  1UHC A;  4J7I A;  4NS5 A;  2A28 A;  2KNB B;  3KXT A;  3VS5 A;  4YRO A;  2M0O A;  4XTU A;  3M53 A;  3CCM Q;  2LQW A;  4P73 A;  2C0O A;  4OMP A;  3CCU T;  5IHK A;  1V29 B;  4WCI A;  4DOW A;  2J6O A;  3JB9 I;  1WXB A;  2HQH A;  1EX4 A;  3M57 A;  4FT4 A;  5GAO l;  3QYG B;  2K7A A;  1I4K 1;  3J81 E;  3Q1J A;  2EGC A;  4KRT A;  4ZGE B;  4E6R A;  3OYL A;  4RDX A;  2DXU A;  3A8M B;  2O2O A;  1JJC A;  2CP2 A;  3CCM T;  5GAO p;  1KQS P;  2AIR B;  1X2G A;  4YRT A;  2XID A;  4CH6 A;  1M27 C;  2JMC A;  5LJ3 f;  3PGG A;  4C8Q F;  1XTD A;  2ARS A;  4PG3 A;  2DXT A;  2W0Z A;  4EMG A;  1HK9 A;  2CJ9 A;  2D0N A;  1N9R A;  4RG8 A;  1EIF A;  2G6F X;  1PYS A;  2RO0 A;  2KMT A;  3LSS A;  4GBQ A;  1WQ7 A;  1K1Z A;  3HRU A;  4MMK A;  3RMQ A;  2RJE A;  1YJ9 Q;  2DTO A;  2EKH A;  3E1S A;  4M78 C;  4F04 B;  1G5V A;  1IHV A;  3VS6 A;  9ATC B;  5KE2 A;  2F5T X;  4QQ6 A;  1C0M A;  3HXU A;  3SD4 A;  1VQL Q;  3LC0 A;  3VS0 A;  2AKL A;  1V1C A;  1MUZ A;  3G7Z A;  3CXC A;  2DTH A;  3A8G B;  3QG1 A;  2EGA A;  4YRK A;  3JCM J;  1D3B A;  1RAD B;  5C0M A;  1YJ9 T;  5CCA A;  2JM9 A;  1YIT A;  3QXE B;  3EGU A;  1KQ2 A;  4OB2 B;  1NM7 A;  4BDY A;  3OMG A;  4J9H A;  1D1B A;  4PJO A;  1VQL T;  3G6E Q;  1NYR A;  4KQE A;  3VUB A;  2DD5 A;  4BI3 A;  2OI3 A;  1M2V B;  1OV3 A;  2M51 A;  2XDD A;  1OOT A;  2IG0 A;  4CS4 A;  4K86 A;  5GAN 5;  1MHN A;  2J06 A;  1SHG A;  2JJ9 A;  4A63 B;  5GAM j;  3EFR A;  5KE3 A;  1QVG A;  4LNS A;  2CH4 A;  5GAN 8;  1R8O B;  2A37 A;  2FRY A;  2VB6 A;  2XU8 A;  3G6E T;  4LVL A;  3EG3 A;  4M75 C;  2OJ2 A;  3I55 T;  2O4X A;  1GXI E;  2DRM A;  2XIC A;  2KT8 A;  5KYW A;  1ZUY A;  1NYF A;  5F5W A;  5CIU A;  4K11 A;  1ABO A;  4PJO G;  1W66 A;  1QKW A;  2QA4 A;  1N5Z A;  4F7U A;  4KUD K;  1VQN Q;  1R0B G;  1QVP A;  1RLQ C;  5GAM g;  3UWN A;  3PCO B;  3KUF A;  4AH6 A;  3BFM A;  3JCM d;  4J6X A;  3OS2 A;  2QTX A;  2YRC A;  2DTI A;  2XHC A;  4ZN1 A;  2OTJ Q;  4C0F A;  3VS3 A;  4M7A A;  4BUG A;  3QYH B;  1VQN T;  3NFC A;  2RM4 A;  5GAO q;  1PD0 A;  1VQ7 Q;  4XEM A;  2I4L A;  1VQ8 Q;  1J5W A;  5DY9 A;  4Y91 A;  4ZTZ B;  1KG1 A;  3SWN C;  2BE7 D;  1YCY A;  5GAN j;  1G5H A;  2M1H A;  3VYH B;  2L3P A;  2ZZG A;  1RLP C;  2DMO A;  4D8D A;  4Q15 A;  4YRP A;  2ODR D;  2HSE B;  3SB2 A;  2OTJ T;  4J8O A;  2X3W D;  3OSS C;  1QWF A;  1XQH A;  2EVR A;  3A98 A;  3EFS A;  5DLQ E;  4R55 A;  3CCM A;  4TWA A;  1AD5 A;  2CT3 A;  2E5A A;  3HY1 A;  2I2L A;  3OYA A;  1VQ7 T;  2K5I A;  4M78 A;  2LT1 A;  1VQ8 T;  4UP7 A;  3UGQ A;  4OML A;  4M7D B;  3H9N A;  3L2U A;  4HT4 A;  1ZA2 B;  2P0Q A;  2ARU A;  4H2X B;  1UDL A;  3KFV A;  4RTX A;  3NTI A;  3RNJ A;  3MEU A;  1YGB A;  1WI7 A;  2FRW A;  1LJO A;  4M7A G;  3A7U A;  1XOV A;  2SRC A;  4CRI A;  2QK0 A;  2QXF A;  1X54 A;  1JBM A;  2BZX A;  3V7S A;  4XU3 A;  1K73 U;  2DZ9 A;  1QW1 A;  3OYG A;  4EMK C;  1HXD A;  4PJO F;  1EIY B;  3L1A A;  1QKX A;  1UB4 A;  1GCP A;  4JZ4 A;  2QEX A;  2Q7G A;  1YJN Q;  3LSQ A;  1NJ5 A;  4M78 G;  5GJW B;  4HCC A;  1SEM A;  3RL6 A;  3VJP A;  3JAM E;  1AOJ A;  2CIM A;  4C8Q E;  3S6W A;  3FIF A;  3CBM A;  3CPW A;  1D0X A;  1OQK A;  3PMI A;  4LUE A;  4DPG A;  1RAB B;  2JT4 A;  3X25 B;  1BIA A;  1UG1 A;  3JCM c;  2IY5 B;  1YJ9 A;  2C0T A;  1YJN T;  2AK5 A;  2X4X A;  2EQK A;  2I4N A;  2YUP A;  5GAN e;  3P8Y A;  1YI2 Q;  2JUF A;  5ELN A;  3G71 A;  1VQ9 Q;  4RQE A;  1M1K U;  3MHX A;  2ZZF A;  2KE9 A;  2FPD A;  1I81 A;  2PUO B;  1M4Z A;  3OW2 P;  1NJI U;  4F7U F;  1NYG A;  3OYH A;  4A53 A;  5LJ3 j;  1KC8 R;  1Q7Y U;  4JJD A;  4LDW A;  3QSU A;  1J3T A;  3JCM f;  1B7T A;  1KHI A;  3RF1 A;  3MEW A;  2LTO A;  5GMK e;  3RKY A;  2GTJ A;  2RHU A;  1YI2 T;  2VAS A;  1KSW A;  1VQ9 T;  3L2R A;  1TXQ A;  2NLU A;  4KH1 B;  2XMF A;  4ANJ A;  4M7A F;  2DA9 A;  1SF9 A;  2YWW A;  4BAC A;  2LCS A;  4E7S A;  2CT4 A;  4M75 G;  4OGE A;  3C94 A;  2PMF A;  2CSQ A;  1AZG B;  2KRS A;  4EMH A;  1GCQ A;  1K9A A;  2RHS A;  2XG8 D;  2XI9 A;  5HGQ A;  2EQM A;  1AWJ A;  5LJ3 g;  3ZL7 C;  2RA2 A;  4DEY A;  3J80 E;  4PJN A;  2K2M A;  2QGF B;  1HC7 A;  3M0S A;  2E4H A;  4P3N A;  3EG9 B;  5D6W A;  1S72 Q;  2XDB A;  3IG2 A;  3I5S A;  2E3H A;  3LWH A;  5FRO A;  1AWX A;  4BY6 C;  3OMC A;  3NEL A;  2EGE A;  2QG9 B;  4J6W A;  4N4H A;  2ZZE A;  3H0I A;  1ZSZ B;  4IUR A;  1WFW A;  3DB4 A;  2H3E B;  4HA8 A;  3X28 B;  2ESW A;  1WDX A;  4RTU A;  1WGS A;  3CC7 Q;  2Q5H A;  1M2V A;  2JVV A;  3RGL A;  5CQY A;  2YUO A;  1KHC A;  1N6A A;  1TH7 A;  2VGN A;  4C5H A;  2CP7 A;  1S72 T;  4CS2 A;  3HRS A;  3PTA A;  2CZ0 B;  2JM8 A;  2LJ0 A;  4N0A C;  2DX1 A;  2E41 A;  1VIF A;  5C51 B;  1Q81 U;  2MI6 A;  2DDZ A;  2L3R A;  3IAL A;  2CP6 A;  3CC7 T;  3CCQ Q;  1MMN A;  2DO3 A;  4P3O A;  1ATI A;  1UGS B;  2E5Q A;  3RUX A;  5LJ3 e;  4NL2 A;  1KC8 C;  5K1X A;  1U1S A;  4LDV A;  2RPN A;  1SRY A;  1PHT A;  3GNG A;  1FMW A;  2X9H A;  4RQF A;  1L0W A;  1PD1 A;  1AEY A;  1W4S A;  2ABL A;  4C0Z A;  4BW9 A;  3LH5 A;  1YWP A;  4BI4 A;  3W3S A;  3M0P A;  2RJF A;  3A74 A;  3CCQ T;  3PCO A;  1ZX6 A;  4D8K A;  4FCY A;  1VQM Q;  1LNX A;  1E24 A;  2ZT6 A;  3A7A A;  5EC7 A;  3P8D A;  1A0N B;  1M30 A;  3CCE A;  2CKK A;  2PME A;  4XTY A;  1WLP B;  1PYS B;  7AT1 B;  5KYU A;  3JCM Q;  4PFZ A;  4J9I A;  5KYX B;  3DSQ A;  3QHS A;  5FU6 C;  5GAN 6;  1UUE A;  5A0L A;  3QO7 A;  4YRF A;  3TCJ A;  2X3X D;  4RKU E;  1N8R R;  4V2S A;  3S3O A;  1JO8 A;  1VQM T;  4YP0 A;  3JB9 F;  2P0K A;  3OYI A;  2LJ3 A;  3VQW A;  3HXW A;  3I7F A;  4XAX B;  2FL7 A;  4YRC A;  1WHM A;  3CCV Q;  1G83 A;  3EFO A;  2HSP A;  2GTO A;  1UGR B;  1EVK A;  2VYT A;  3M59 A;  3CMQ A;  2A7Y A;  1QVF A;  4M7D A;  4H2X A;  1YJN A;  2AZS A;  1WU7 A;  2ZCE A;  1D3B B;  5A0D A;  1NBE B;  4JRP A;  1LCK A;  2LCC A;  1YP5 A;  2HZY A;  2VVK A;  2O9S A;  5IN1 A;  4ZGD B;  5GAM f;  3H0H A;  2LQ8 A;  2DD4 A;  4AFQ C;  1VOM A;  3OS1 A;  4WTO B;  4YCU A;  1NLP C;  1BI0 A;  1VQ5 A;  1CKA A;  1PWT A;  4F17 A;  3V7R A;  4HT9 A;  4H2W A;  4IUV A;  2WSC E;  2IPO B;  1KD1 C;  4OLF A;  1VQK A;  1HSQ A;  3UA6 A;  3VS2 A;  1VQ9 A;  3RKW A;  2ZCF B;  2ZPI B;  2HQX A;  4B9W A;  1AWO A;  2DIG A;  1JJ2 S;  2V8K A;  3A31 A;  5IHN A;  4M7D G;  1IZ6 A;  2BUD A;  4RMF A;  2K6D A;  3V7C A;  5KYN A;  4N0A A;  3RR6 A;  1GFD A;  2FPE A;  2X35 A;  3HXX A;  3MQZ A;  3CME Q;  3MF2 A;  4KH0 B;  2DQ3 A;  1KFZ A;  2QGG A;  2GF7 A;  1W2B S;  3A8H B;  4WJ4 A;  2BZ8 A;  3ZBD A;  1Y7X A; 
#chains in the Genus database with same CATH homology
 2WSF E;  4A54 A;  4HWO A;  3SDZ A;  2MWP A;  1N8R C;  2IVW A;  4R56 A;  4H2Y A;  4NL3 A;  2DU7 A;  4E51 A;  3CME T;  2C8M A;  1X2H A;  1B34 B;  2WSE E;  1G3Y A;  4M7A B;  1OZ2 A;  3H8Z A;  4M7A E;  1KQS S;  3RES A;  2RHQ B;  1G3S A;  3EAE A;  1Z7M A;  2CZ6 B;  4ELY C;  3GLX A;  2DIQ A;  1M1F A;  1YIJ A;  2KDS A;  1ADJ A;  4J5Y A;  1WQW A;  4M78 B;  4Y28 E;  4M78 E;  4YRS A;  4RCC A;  3GPL A;  4C92 C;  2E64 A;  1VQ4 T;  3CCS T;  2QHV A;  4M7D F;  3MEY A;  4BDZ A;  1UEB A;  5L8R E;  2J3M A;  2LDM A;  3REU A;  5GAO r;  1C0A A;  3CC4 T;  5I2M A;  2G4C A;  3MP8 A;  3FC3 A;  5EG2 A;  3M54 A;  3JCM V;  2C06 A;  4JS5 A;  3MEA A;  2VC8 A;  2Y90 A;  4C0D C;  4XU0 A;  3AHU A;  4HCB A;  2B8A A;  4QW2 A;  5A0G A;  4DA4 A;  2LC4 A;  3CD6 T;  2KVQ G;  1USY A;  4VUB A;  3PMT A;  3QZ5 B;  4M75 B;  2ZPB B;  1W2B A;  4M75 E;  3V8J A;  2JZ2 A;  2K3Y A;  3OYD A;  4YCW A;  2KSS A;  2DQ0 A;  2R58 A;  4FL6 A;  1EFW A;  3HFV A;  2VXF A;  3JCM e;  2X4Y A;  2YHT A;  3L2V A;  4QQG A;  3CCV A;  3OYJ A;  5GMK h;  3HP9 A;  3TRE A;  1E1O A;  4P72 A;  1AHJ B;  4YRJ A;  3OS0 A;  1BI3 A;  5GMK l;  4E7J A;  4M77 D;  4ZTJ A;  2ZPH B;  3E9I A;  1X01 A;  5HK3 A;  3M55 A;  3L4G B;  4LVJ A;  4MDX A;  2K5F A;  3HFO A;  3LWI A;  4XTV A;  1ASZ A;  3CBO A;  5LJ5 h;  2EJG A;  1Z7N A;  3NEN A;  2V8I A;  2V8J A;  2RHS B;  4JDS A;  3GOX A;  1QP3 A;  3SWN B;  1B8A A;  4TVA A;  3OYN A;  2ZT8 A;  2CYZ B;  2EQJ A;  2JN0 A;  3FRN A;  2RJC A;  2Y4X A;  4P74 A;  4BB7 A;  3X26 B;  1H64 1;  4H2S A;  1SSF A;  4HWP A;  3J7A F;  4GLK A;  2E12 A;  4NOY A;  2K5L A;  4EMK B;  2RI2 A;  3TEG A;  4P71 C;  1NPP A;  1M8V A;  1VQP A;  1KMN A;  3CC2 A;  3OYB A;  4Q5W A;  4O2D A;  1Q82 C;  2D9T A;  4OMF B;  4WF2 A;  3CMA T;  3C95 A;  4ZTF A;  2EYQ A;  1VQ6 A;  3SFM A;  2KQW A;  2DU5 A;  1B76 A;  4JLI A;  4A4G A;  5J3B A;  3HSB A;  3CCL T;  4E7L A;  3IKL A;  4IUU A;  1Y96 B;  2M9U A;  3E19 A;  1WYD A;  1KOG A;  2E10 A;  1B34 A;  2PVD B;  1WJR A;  1IL2 A;  2RHQ A;  3CCU A;  2L89 A;  4TVY A;  2R5M A;  2Q7E A;  3MEV A;  3HTZ A;  5E3I A;  4A4E A;  4O6J A;  2ZPE B;  3OW2 S;  4YRE A;  2LT4 A;  1WJQ A;  4C8Q D;  2XTI A;  1KC8 U;  4EPC A;  2ALY B;  5GAM e;  4HT8 A;  4M7D E;  3QO8 A;  3VUZ A;  2K4Y A;  1QE0 A;  5HY6 A;  5GAN 2;  3WXM B;  4J83 A;  4JUV A;  2ZNJ A;  2EJF A;  3I56 T;  2OTL T;  1M5Q 1;  4BY6 B;  2ZIO A;  1NYQ A;  2Q5I A;  5FRM A;  4D6W A;  5GAN 7;  2EIF A;  4M77 C;  4PLI A;  5GAO n;  4YCV A;  3FB9 A;  3ICA A;  1X55 A;  3WQZ A;  4H2T A;  3M58 A;  3A5Z B;  2J3L A;  2K57 A;  4XU1 A;  4ZGJ B;  3FDR A;  4M75 A;  4KT0 E;  2QI2 A;  2RI5 A;  5IT9 E;  3QPH A;  1VQL A;  2HQE A;  3BDL A;  4WJ3 M;  1BIB A;  3VYG A;  4A4H A;  1ASY A;  2M16 A;  3CCR T;  3UDC A;  4BWA A;  1UGP B;  4E7I A;  3L4G A;  4OP0 A;  3G6E A;  2C7I A;  2MWO A;  3I55 A;  5FU6 B;  3E9F A;  2ZT7 A;  1FX7 A;  3RER A;  1O75 A;  2RD1 A;  4P75 C;  3GNF B;  3SWN A;  4G84 A;  3UT1 A;  5KCO A;  3OYM A;  2R57 A;  5KH6 A;  2HAX A;  3MP6 A;  2XD0 A;  4TVR A;  4M78 F;  4L5G A;  4K87 A;  3TUP A;  1WNL A;  1N8R U;  3PIP A;  5GAN 4;  3BDU A;  4OVA A;  4XEO A;  1VQN A;  3LLR A;  2VGM A;  4YTL A;  4XTZ A;  1SER A;  1BKB A;  3QUI A;  4O5V A;  4EMK A;  2DVE A;  2LX9 A;  5CK9 A;  2L5Q A;  3X20 B;  4C0G A;  2OTJ A;  1U8R A;  3IKM B;  3HRT A;  2VV5 A;  4H2V A;  4BD3 A;  1VQ7 A;  4DQ2 A;  1E22 A;  3VV0 A;  1VQ8 A;  4C8Q C;  4C92 D;  3JB9 J;  2VUB A;  4OF1 A;  1EQR A;  3OYY A;  3E9G A;  2FHD A;  4JRK A;  4LVI A;  4M75 F;  1Y96 A;  4Q6G A;  3I56 A;  4PJO D;  2KY9 A;  1VIE A;  3G4S T;  5FU7 C;  4E47 A;  1OI1 A;  3RIR A;  1HTT A;  5GAN d;  3HFZ B;  1OZ3 A;  1K73 C;  1WJS A;  3A8L B;  5FLX E;  2MF2 A;  1VQO T;  2PVO B;  1LYL A;  1OYX A;  2D0Q B;  5CKB A;  5CKD A;  3JCM b;  4BE1 A;  2K2V A;  2KAF A;  2QHS A;  3CBP A;  5GMK m;  2RJD A;  4YRN A;  4Z02 A;  3KBG A;  1G51 A;  3OS5 A;  2ALY A;  4TVA B;  2AMC B;  4LD6 A;  3CPF A;  4MZM A;  2RHZ A;  2EAY A;  3FJP A;  3NEM A;  1X6O A;  4LDX A;  5LJ5 d;  5DM7 R;  1Y07 A;  3VU3 C;  4EDU A;  5DLO A;  1NJI C;  2EKO A;  3FEO A;  1YI2 A;  4L59 A;  1Q7Y C;  2E1H A;  3QZ9 B;  4KBM B;  4FSX A;  4P73 C;  1P92 A;  4OGC A;  2ZXF A;  1DJ7 B;  3RKX A;  3A5Z A;  4FM4 B;  2ZTG A;  1Q86 C;  3TEE A;  1BI2 A;  5CQX A;  2DXB A;  4C0D B;  4RMO A;  5GMK i;  3L2Q A;  2Q7H A;  4BE2 A;  2FVU A;  3PNW C;  4OB3 B;  2PU9 B;  3HKS A;  2RHI A;  1NJ1 A;  3VBB A;  5CKH A;  3UPU A;  3DKM A;  4YDQ A;  3QJ6 A;  3DB3 A;  2DEQ A;  1SES A;  4UP9 A;  5GAN 3;  1KQ1 A;  1KMM A;  4PL6 A;  3HXZ A;  5HKC A;  4C5I A;  4H02 A;  1IRE B;  3MF1 A;  2E6Z A;  4OB0 B;  1S72 A;  4H2U A;  4JJN K;  2PUK B;  2ZPG B;  1YIT T;  2BKD N;  3DLM A;  1B7Y A;  1MGQ A;  5CKF A;  3CC7 A;  5HK0 A;  3OYF A;  2QHT A;  1QF6 A;  4CI0 C;  5GAM h;  2F5K A;  5I2S A;  2ZNI A;  3QO3 A;  4EX5 A;  1RL2 A;  1K9M C;  3A7R A;  3HRK A;  4TVW A;  5LL6 S;  2P0L A;  4FT2 A;  4ZTU B;  3HHT B;  4YRI A;  1BI1 A;  1K8A C;  3CCQ A;  4YRG A;  3M56 A;  3OYK A;  4C5E A;  1BYM A;  2VXE A;  4YYE A;  3HPW A;  4QVZ A;  3OA6 A;  1NJ6 A;  2DPP B;  2RH2 A;  4PJO C;  5ELO A;  4ZN3 A;  2QA4 T;  3JB9 D;  3CCJ T;  2QQB A;  2RHX A;  4LVM A;  5D6Y A;  2DXC A;  4C5G A;  2MMP A;  4X5O A;  1ZBX A;  1VQM A;  3P8T A;  5LJ5 f;  2AHJ B;  2P0P A;  1JJ2 A;  3P8V A;  4OB1 B;  1RIQ A;  2JNG A;  2GFU A;  5M9O A;  1QVG S;  2QQA A;  3QBY A;  5GAN h;  4GY5 A;  2PVG B;  3OY9 A;  1YHQ T;  5D6X A;  2QDY B;  5IAY A;  1UGQ B;  3F70 A;  2LRQ A;  2ART A;  1YFT A;  3R6O A;  5CAI A;  1NZ9 A;  1KQS A;  4TTV A;  4YRM A;  3HFZ A;  4M7A C;  4LDU A;  2EL9 A;  4L87 A;  2ZIN A;  2GCX A;  3A5Y A;  2ZGW A;  3MET A;  2AKW B;  1O9S A;  3LW5 E;  4PHC A;  2ZIM A;  3OYC A;  1NE8 A;  2LCL A;  2Y4Y A;  4RCB A;  3GF5 A;  1H4Q A;  1WLE A;  2AMC A;  3M4Q A;  2QEX T;  1YB3 A;  4UPA A;  3QKJ A;  3TEH A;  4PKC C;  3L2W A;  3VKI A;  3CME A;  2XDP A;  5I21 A;  2DZC A;  4C92 A;  2RI3 A;  3PFS A;  4E7K A;  2LNV A;  4CH5 A;  2JTM A;  12AS A;  2X4J A;  11AS A;  1X75 C;  3ASK A;  3VQY A;  5LJ3 h;  3G71 T;  4PLL A;  4MZT A;  2H3J A;  1I8F A;  3BY7 A;  1M9S A;  4M77 B;  1NPR A;  4M77 E;  4QVC A;  4JLG A;  1M90 C;  4UC4 A;  2KK4 A;  2RK1 A;  4HWT A;  4M7D D;  2EFI A;  1VQ4 A;  3PT9 A;  3CCS A;  1FYF A;  3BW1 A;  4C92 G;  4X34 A;  2ZT5 A;  4KR2 A;  5C52 B;  3KFU A;  3CPW S;  2GQV A;  2QQR A;  5A2Q E;  4KUL A;  2K3X A;  2P5I A;  1B70 B;  5K1P A;  2LQK A;  3CCJ A;  3CC4 A;  4HCZ A;  3X24 B;  2FYK A;  3JB9 H;  3ERR A;  2OAU A;  3HFN A;  2WAC A;  1JRI A;  5C6S A;  3OQ5 A;  1G5I A;  3OSV A;  3CD6 A;  1XNI A;  4HVC A;  2HD0 A;  3NTK A;  4XQ3 A;  2MAM A;  4IUQ A;  2O01 E;  4EO4 A;  2ZPF B;  1YHQ A;  3UGT A;  3M4Y A;  4E7H A;  3HRI A;  3HXY A;  3ER0 A;  3LX7 A;  4F7U G;  1LOJ A;  4A4K A;  4YPF A;  4ZIB A;  3M5A A;  3V8L A;  5CR2 A;  4YRQ A;  5GMK j;  3A32 A;  1ZHI A;  4XU2 A;  1E1T A;  2EWN A;  1ZQ1 A;  4C92 F;  5GAN g;  1YFR A;  4QQD A;  5KCH A;  2EQU A;  3REX A;  4KR3 A;  3CCE T;  3ZEH A;  2X4W A;  2HNI A;  2QQ9 A;  1NNH A;  4DOV A;  5LJ5 j;  3MCA B;  3V8K A;  4P71 A;  4IUT A;  2E3C A;  3HY0 A;  4JRQ A;  1EOV A;  5CO7 A;  3M4G A;  3ME9 A;  1H4T A;  3QO5 A;  3OD1 A;  4C8Q B;  3L42 A;  2LVM A;  4XTX A;  2E70 A;  4TQF A;  1N27 A;  4FIB A;  5LJ5 g;  2ZR3 A;  1M1G A;  4G85 A;  2G3R A;  1B7Y B;  1KD1 U;  5FU7 B;  2ZR2 A;  1GGM A;  1N9W A;  4WI1 A;  4P3P A;  2YRV A;  1VQ5 T;  2AKW A;  1H4V B;  2FB7 A;  3OW2 A;  4PNO A;  3C4S A;  3CMA A;  1BBW A;  2ZZD A;  1Q86 U;  2A8E A;  2QHU A;  3ZFJ A;  3LH0 A;  1VQK T;  3GIB A;  3H6Z A;  5J39 A;  1EVL A;  2L8D A;  1JB0 E;  3A8O B;  4M7D C;  3CCL A;  3TU4 K;  4A4F A;  2E65 A;  5CKE A;  3WVE B;  3JRZ A;  5KNN A;  1QVF S;  4HWS A;  1G3T A;  3S3M A;  3R07 A;  5GAM d;  5LJ5 e;  3UH0 A;  3JB9 G;  4JS4 A;  1QP2 A;  1FWZ A;  3MP1 A;  4II1 A;  1FXX A;  4LD9 K;  3P8H A;  4YRR A;  3QII A;  4HWR A;  2F69 A;  3RMS A;  2D6F A;  5CVI A;  4M77 A;  4ELZ C;  1YJW T;  4B9X A;  1ADY A;  2JTF A;  4IUP A;  3DLL A;  2R5A A;  3M9Q A;  4RG2 A;  4X9D A;  3JCM h;  2YLC A;  1K9M U;  4IKF A;  1X56 A;  4TQD A;  3LGL A;  1K8A U;  3JCM X;  1YIJ T;  2ODR C;  1JJC B;  2OTL A;  3OB9 A;  1B70 A;  4XTW A;  3OBW A;  4K88 A;  2DK3 A;  4JRI A;  4X9C A;  3LYI A;  2GFA A;  2RB6 A;  4MDW A;  3NET A;  4M77 G;  5GAO m;  3CEY A;  4J6Y A;  2NS6 A;  4CS3 A;  3PZC A;  2RK2 A;  2QQS A;  2EJ9 A;  1NJ8 A;  1Y71 A;  4XK8 E;  4J15 A;  4BI8 B;  2CZ7 B;  3L2Z A;  3M4P A;  3GP8 A;  1WPY A;  4MML A;  4P75 A;  3TEH B;  3QTC A;  2CJA A;  2YLB A;  4C92 B;  4C92 E;  2DKG A;  3URG A;  3CCR A;  2CS7 A;  2PQW A;  2CGH A;  1M1K C;  4M7A D;  2A3L A;  3HXV A;  1PSE A;  4PJO B;  4PJO E;  3CCV T;  5AYF A;  1BBU A;  1VQZ A;  3HL8 A;  2JOY A;  4NCX A;  1YBY A;  3JCM W;  1EIY A;  5FRN A;  3O8V A;  4M78 D;  3INZ A;  4KUI A;  4M77 F;  1USY C;  3OBY A;  4L6V 5;  2O4X B;  4LVK A;  5LJ3 d;  4C8Q A;  4ME7 A;  4N4I A;  3G1Z A;  1VUB A;  4LDY A;  4BE0 A;  4ATO A;  3QDR B;  5J26 A;  4F7U B;  3S3N A;  2IY5 A;  3P8B B;  2XK0 A;  4F7U E;  1G3W A;  4CH4 A;  1H4S A;  4P72 C;  3QJY A;  4J7F A;  2XKO C;  4P5N A;  2BIV A;  2CJB A;  2HBP A;  3VQX A;  3T9N A;  2I4O A;  2RHY A;  1RI0 A;  3QNE A;  5GAN f;  2I4M A;  3RAC A;  1YJW A;  3UFG A;  4CH3 A;  4N4G A;  2DJZ A;  3OYE A;  1Q81 C;  1Q82 U;  1N9S A;  4C8Q G;  4HKE A;  1M90 U;  2XGT A;  1U1T A;  3N5B B;  4M75 D;  1I5L A;  1SET A;  5C53 B;  1VQP T;  3CC2 T;  3C12 A;  3FLG A;  3CXC S;  1PSF A;  3WVD B;  2DAQ A;  4FU6 A;  2P4T A;  3E9H A;  3G4S A;  2CZ1 B;  4YRL A;  1NJ2 A;  4MZP A;  1YFS A;  3MO8 A;  3JSC A;  3NTH A;  1VQ6 T;  3LGF A;  3PIO A;  4P74 C;  2E6N A;  4UP8 A;  3BJU A;  3VQV A;  3JCM P;  1VQO A;  4QVD A;  3JCM g;  1H3Z A;  4J7I A;  4NS5 A;  3KXT A;  4YRO A;  2M0O A;  4XTU A;  3M53 A;  4P73 A;  3CCU T;  1V29 B;  4DOW A;  3JB9 I;  3M57 A;  4FT4 A;  5GAO l;  3QYG B;  1I4K 1;  3J81 E;  3Q1J A;  4ZGE B;  3OYL A;  4RDX A;  2DXU A;  3A8M B;  1JJC A;  3CCM T;  5GAO p;  1X2G A;  4YRT A;  2XID A;  4CH6 A;  5LJ3 f;  3PGG A;  4C8Q F;  1XTD A;  2ARS A;  4PG3 A;  2DXT A;  4EMG A;  1HK9 A;  2CJ9 A;  1N9R A;  4RG8 A;  1EIF A;  1PYS A;  2RO0 A;  2KMT A;  3LSS A;  1WQ7 A;  3HRU A;  4MMK A;  3RMQ A;  2RJE A;  2DTO A;  3E1S A;  4M78 C;  1G5V A;  5KE2 A;  2F5T X;  4QQ6 A;  3HXU A;  3SD4 A;  3LC0 A;  3G7Z A;  3CXC A;  2DTH A;  3A8G B;  3QG1 A;  4YRK A;  3JCM J;  1D3B A;  5C0M A;  1YJ9 T;  5CCA A;  1YIT A;  3QXE B;  1KQ2 A;  4OB2 B;  4BDY A;  3OMG A;  4PJO A;  1VQL T;  1NYR A;  4KQE A;  3VUB A;  2DD5 A;  4BI3 A;  2XDD A;  2IG0 A;  4CS4 A;  4K86 A;  5GAN 5;  1MHN A;  5GAM j;  3EFR A;  5KE3 A;  1QVG A;  4LNS A;  5GAN 8;  1R8O B;  2XU8 A;  3G6E T;  4LVL A;  4M75 C;  3I55 T;  2O4X A;  1GXI E;  2XIC A;  5F5W A;  5CIU A;  1W66 A;  4PJO G;  4KUD K;  2QA4 A;  4F7U A;  1QVP A;  5GAM g;  3UWN A;  3PCO B;  3KUF A;  4AH6 A;  3BFM A;  3JCM d;  4J6X A;  3OS2 A;  2QTX A;  2DTI A;  2XHC A;  4ZN1 A;  4C0F A;  4M7A A;  4BUG A;  3QYH B;  1VQN T;  3NFC A;  2RM4 A;  5GAO q;  4XEM A;  2I4L A;  1J5W A;  5DY9 A;  4Y91 A;  4ZTZ B;  1KG1 A;  3SWN C;  5GAN j;  1YCY A;  1G5H A;  2M1H A;  3VYH B;  2ZZG A;  4Q15 A;  4YRP A;  2ODR D;  3SB2 A;  2OTJ T;  4J8O A;  3OSS C;  1XQH A;  3EFS A;  5DLQ E;  4R55 A;  3CCM A;  4TWA A;  2E5A A;  3HY1 A;  2I2L A;  3OYA A;  1VQ7 T;  2K5I A;  4M78 A;  2LT1 A;  1VQ8 T;  4UP7 A;  3UGQ A;  4M7D B;  4HT4 A;  3L2U A;  2P0Q A;  2ARU A;  4H2X B;  3NTI A;  1YGB A;  3MEU A;  1LJO A;  4M7A G;  3A7U A;  1XOV A;  4CRI A;  2QXF A;  1X54 A;  1JBM A;  3V7S A;  4XU3 A;  1K73 U;  2DZ9 A;  1QW1 A;  3OYG A;  4EMK C;  1HXD A;  4PJO F;  1EIY B;  3L1A A;  1UB4 A;  2QEX A;  2Q7G A;  3LSQ A;  1NJ5 A;  4M78 G;  4HCC A;  3RL6 A;  3VJP A;  3JAM E;  2CIM A;  4C8Q E;  3S6W A;  3FIF A;  3CBM A;  3CPW A;  3PMI A;  4DPG A;  3X25 B;  1BIA A;  3JCM c;  2IY5 B;  1YJ9 A;  1YJN T;  2X4X A;  2EQK A;  2I4N A;  5GAN e;  3P8Y A;  2JUF A;  5ELN A;  3G71 A;  4RQE A;  1M1K U;  3MHX A;  2ZZF A;  2PUO B;  1I81 A;  1NJI U;  1M4Z A;  4F7U F;  3OYH A;  4A53 A;  5LJ3 j;  1Q7Y U;  4LDW A;  3QSU A;  3JCM f;  1KHI A;  3RF1 A;  3MEW A;  2LTO A;  5GMK e;  3RKY A;  2RHU A;  1YI2 T;  1VQ9 T;  3L2R A;  2NLU A;  4M7A F;  4BAC A;  4M75 G;  4OGE A;  3C94 A;  2PMF A;  4EMH A;  2RHS A;  2XG8 D;  2XI9 A;  5HGQ A;  2EQM A;  5LJ3 g;  2RA2 A;  3J80 E;  1HC7 A;  4P3N A;  5D6W A;  2XDB A;  3IG2 A;  3LWH A;  5FRO A;  4BY6 C;  3OMC A;  3NEL A;  4J6W A;  4N4H A;  2ZZE A;  4IUR A;  3DB4 A;  4HA8 A;  3X28 B;  1WGS A;  2Q5H A;  2JVV A;  3RGL A;  5CQY A;  1KHC A;  1N6A A;  1TH7 A;  2VGN A;  4C5H A;  1S72 T;  4CS2 A;  3HRS A;  3PTA A;  2CZ0 B;  4N0A C;  2E41 A;  1VIF A;  5C51 B;  1Q81 U;  2MI6 A;  2DDZ A;  2L3R A;  3IAL A;  3CC7 T;  2DO3 A;  4P3O A;  1ATI A;  1UGS B;  2E5Q A;  3RUX A;  5LJ3 e;  4NL2 A;  1KC8 C;  5K1X A;  1U1S A;  4LDV A;  1SRY A;  3GNG A;  4RQF A;  1L0W A;  1W4S A;  4BW9 A;  4C0Z A;  4BI4 A;  3W3S A;  2RJF A;  3A74 A;  3CCQ T;  3PCO A;  1LNX A;  1E24 A;  2ZT6 A;  3A7A A;  3P8D A;  3CCE A;  2CKK A;  2PME A;  4XTY A;  1PYS B;  3JCM Q;  3DSQ A;  3QHS A;  5FU6 C;  5GAN 6;  5A0L A;  3QO7 A;  4YRF A;  3TCJ A;  4RKU E;  4V2S A;  3S3O A;  1VQM T;  4YP0 A;  3JB9 F;  2P0K A;  3OYI A;  3VQW A;  3HXW A;  3I7F A;  4XAX B;  2FL7 A;  4YRC A;  1UGR B;  1EVK A;  2VYT A;  3M59 A;  3CMQ A;  2A7Y A;  1QVF A;  4M7D A;  4H2X A;  1YJN A;  2ZCE A;  1WU7 A;  1D3B B;  5A0D A;  4JRP A;  2LCC A;  5IN1 A;  4ZGD B;  5GAM f;  2LQ8 A;  2DD4 A;  3OS1 A;  4YCU A;  1BI0 A;  1VQ5 A;  3V7R A;  4HT9 A;  4H2W A;  4IUV A;  2WSC E;  1KD1 C;  4OLF A;  1VQK A;  1VQ9 A;  3RKW A;  2ZCF B;  2ZPI B;  2HQX A;  4B9W A;  2DIG A;  1JJ2 S;  2V8K A;  3A31 A;  4M7D G;  1IZ6 A;  2BUD A;  4RMF A;  3V7C A;  4N0A A;  2X35 A;  3HXX A;  3MQZ A;  3MF2 A;  2DQ3 A;  2GF7 A;  1W2B S;  3A8H B;  4WJ4 A;  3ZBD A;  1Y7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...