4RQEA

Human seryl-trna synthetase dimer complexed with two molecules of trnasec
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
478
structure length
460
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKELSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVTSIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine--tRNA ligase, cytoplasmic
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
total genus 121
structure length 460
sequence length 478
chains with identical sequence C
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqeA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqeA02
3V7CA 3L1AA 4P71C 4BWAA 3TUPA 2ODRD 4YRIA 1HTTA 1SERA 3QTCA 4XTUA 4XTZA 5KNNA 3P8TA 4XTXA 1X01A 4DQ2A 4TTVA 4YRSA 4TQDA 3V7RA 2DXTA 3UGTA 5K1XA 2EWNA 2DU7A 1B7YB 3UFGA 4H2XB 1C0AA 4PHCA 1H4TA 1ASYA 4H02A 2CJAA 3L4GB 1X2HA 3A32A 5ELNA 2XTIA 2QHVA 2RHQB 4EO4A 5C51B 1JJCA 2ZT8A 2EAYA 4HA8A 3A74A 4K86A 2E3CA 5ELOA 1NYRA 4P72C 2CJBA 4WF2A 2XGTA 4XU3A 1GGMA 2ARSA 4ZTZB 2AKWA 1HXDA 3ICAA 3REXA 4L87A 3LC0A 4UPAA 3UGQA 2DZCA 1PYSA 1N9WA 3VBBA 3EFSA 3MF1A 3E9IA 4J15A 1BBUA 1BIBA 3NENA 3M4PA 3RKYA 1SETA 1USYA 2ZGWA 4H2VA 3RKWA 4UP8A 4Q15A 4H2XA 3FJPA 4P75C 3QO5A 3L4GA 5HGQA 3HXUA 2J3MA 3IG2A 4YRQA 2RHQA 3HXWA 4H2SA 3REUA 3R07A 1SESA 3RACA 4CH5A 3CMQA 4XTYA 1JJCB 4XU0A 4ZIBA 1LYLA 4RQFA 2E65A 1HC7A 4WJ3M 1E24A 2P0LA 3IKMB 1QF6A 4P3OA 1Z7NA 2DXUA 1IL2A 4YCWA 1NJ6A 3A31A 2EJGA 1PYSB 3W3SA 2DQ3A 2E41A 3A7UA 1G5HA 4CS2A 2QHSA 2ZNIA 4HWOA 1H4QA 2I4NA 1X2GA 1B76A 3A5YA 2IY5A 4TVAA 4G85A 1YB3A 3QO7A 4YRRA 2C8MA 2ARTA 1NYQA 1G5IA 1EVKA 2ZZEA 3M4QA 4P3PA 3HFZB 1ATIA 2ZT5A 4CH4A 2AMCB 3P8VA 3RF1A 3RL6A 4XEMA 3PCOB 2ZR3A 4YRGA 2P5IA 1J5WA 4P74A 4EX5A 4HWTA 2PMFA 4HWRA 1SRYA 3VQVA 4DPGA 3HXYA 4YRCA 2I4MA 1EVLA 5C53B 3WQZA 5C52B 4YRJA 1WQWA 4RDXA 4KQEA 4CH6A 4KR2A 2Q7HA 1NJ8A 2DTIA 1WQ7A 1L0WA 3G1ZA 1WYDA 4XU2A 1KMMA 4YRMA 4YROA 4E51A 3NETA 1X54A 2C7IA 3OD1A 2DVEA 3TEHB 4YREA 3IALA 1EOVA 1KOGA 4ZTUB 1H4VB 2IY5B 4TVAB 5K1PA 2Q5IA 4NCXA 4YRKA 3HFZA 4YP0A 2DDZA 3V7SA 3HFVA 2AMCA 2I4OA 1ADYA 2Q7EA 3TEGA 4XTVA 3PCOA 1W66A 4TVWA 4OLFA 4P74C 2Q5HA 4H2TA 4TQFA 4G84A 1X55A 3HY1A 4UP9A 4H2YA 1FYFA 2I4LA 4BW9A 2ZT6A 4YDQA 1KMNA 2DQ0A 2ARUA 2J3LA 4LNSA 2DTOA 3A7AA 1EIYB 4Q6GA 2Q7GA 1WLEA 4CS4A 2RHSB 4KR3A 1USYC 2ZR2A 4YYEA 4P3NA 4X5OA 3TEHA 1B70B 1EQRA 2E64A 4YRFA 4YCVA 4YRNA 2E5AA 4H2UA 3MEYA 4P72A 3L2ZA 1E22A 1WU7A 3EFRA 1VQZA 4YPFA 3BFMA 3HXXA 1H4SA 4XEOA 3LSQA 2ZINA 3HTZA 1YFRA 2ZIMA 2QHUA 3MF2A 3V8KA 3IKLA 3HRKA 4XU1A 4TVYA 1NJ2A 2ZT7A 3BJUA 2ZIOA 3I7FA 4P75A 11ASA 3A7RA 4K88A 3A5ZA 3HXVA 2ZXFA 3ERRA 4CH3A 1EIYA 1NNHA 1RIQA 2EJFA 2RHSA 4PG3A 2CIMA 3VQYA 4RQEA 1B70A 3VQXA 2ZTGA 3DSQA 1WNLA 4YRLA 2ALYB 1NJ1A 2ZNJA 4YCUA 4UP7A 4P73A 4TWAA 1WPYA 4RMFA 4XTWA 2HNIA 3KFUA 1G51A 1BIAA 1E1TA 2FYKA 4OP0A 2PMEA 4WI1A 1YGBA 3QNEA 3UH0A 4P71A 1YFTA 2DU5A 3PZCA 3HXZA 3RKXA 1B7YA 2ZZFA 5E3IA 4YRPA 2DEQA 2EJ9A 3P8YA 3NELA 2E10A 1EFWA 5F5WA 1YFSA 2G4CA 3HRIA 1ADJA 1E1OA 2DTHA 4HVCA 2ODRC 1Z7MA 12ASA 2ZCEA 1X56A 3V8JA 3QO8A 3RUXA 2DJZA 4AH6A 3NEMA 1BBWA 2EL9A 3V8LA 4CS3A 1ASZA 2ALYA 1B8AA 2CGHA 4P73C 2QHTA 4K87A 1QE0A 2ZZGA 4HWSA 2DZ9A 4WJ4A 4YRTA 2CJ9A 2DKGA 4H2WA 1NJ5A 3VQWA 3RIRA 2E1HA 3HY0A 4O2DA 3E9HA 2AKWB 3LSSA 4HWPA 3RGLA
chains in the Genus database with same CATH superfamily
4BWAA 3TUPA 1ORQC 3RFRA 1URFA 3CRQA 3FB8C 3LDDA 4XTZA 2JK5C 4N21A 4GKKB 1MG1A 2RQ6A 2AZ2A 2RCVA 3JD0A 3N2GA 2DXTA 5K1XA 2EWNA 3ZMSA 1W0JG 1VF5B 2N05A 1XHZA 1MZEA 1D5AA 5IJ9B 3APQA 3BRCA 1H4TA 2V7QG 1F7YA 1X4TA 4F6RA 4FZ0A 1K4DC 4UXNA 4QPKA 3E86A 2LFRA 5ELNA 4LBEC 2WA3A 4NTWA 3LDCA 1GN3A 2OTJV 4EO4A 5LGTA 1O9HA 2XAJA 1JJCA 3CD6V 3ETGA 4NTYA 5J2TA 3K08A 4BR6A 1RPRA 3A74A 1E1RG 4UVBA 4K86A 2E3CA 1ZL8B 4P72C 1FKAO 1P84F 1GO3F 1OCRC 4JTAB 4LF5O 3K06A 2ARSA 4XDKA 1NH2B 1BHBA 4L87A 2YEVB 2DZCA 3RWRD 4J7JA 1Q8IA 1R1BA 3E9IA 1RSOA 4JF3A 3FYIB 3E83A 4J15A 1US6A 5JQGA 3WG7B 1J5EO 1U96A 3G71V 4DV7B 3NXSA 2XTAA 1QVFU 4YY3O 4BAYA 4FZ1A 5CBHA 2DOSA 3ZMUA 1QQCA 2A7WA 3L4GA 4P9OA 1IZ3A 3JARA 2ARHA 2J3MA 5LP6B 4DR6O 2Q0OC 5IYBO 2GBOA 2RN9A 3REUA 2LW7A 4GX1A 3JCUZ 4NXNO 3TK1A 2Y0IA 3CMQA 1JJCB 4XU0A 2A0LA 3W7WA 4YJ3A 1BL8A 3IJ4A 1LYLA 1IDSA 4BIOA 2P0LA 3IKMB 3T1CA 4P3OA 1EN6A 2DXUA 2A3QA 4K3AA 1NT2B 3ZMVA 4Z2WA 2W0XA 5CA1A 3PJSK 2EJGA 4I50A 4B7EA 4LF5B 3W3SA 3UCSC 1YJNV 3A7UA 1ZTEA 4B08A 2EZOA 3MAQA 3CRCA 3FYEB 5B3SB 5JQGB 1VARA 1VQLV 2P7TC 5LHHA 3S3WA 1QU7A 5EK0A 2DYRB 3A5YA 1MSDA 2IY5A 4TOIA 4TVAA 4OX9O 1AROP 1J5EB 1F51A 2F66C 2Y0PA 2OYQA 1PM9A 1NYQA 1R3KC 5A2QN 1I7FA 3M4QA 2ETNA 3HFZB 4YY3B 2ZT5A 4CH4A 2F93B 1CPYA 1NU1H 2OCCB 3OMNB 3CE2A 1IBMO 4A5UB 1YZBA 3PCOB 2WAMA 2ZR3A 4TSFG 4YRGA 3SYAA 2P5IA 2UXNA 1M57B 2BOBC 1J5WA 4DR6B 4EX5A 1JCHA 4GT1A 4DV6O 4TV9B 2ADQB 1SQQH 4NTXA 2F4VO 3RYFA 4I5SA 4G2KA 3M8AA 4LVKA 3W7UA 4NXNB 3HXYA 1FYJA 2HFEC 2I4MA 2IM9A 3WQZA 1AR4A 1GRJA 2GUZA 1S5HC 4QJFB 4YRJA 3WG7C 4KQEA 4CH6A 4KR2A 2MK3A 4RAIA 1NJ8A 2DTIA 4FLVA 3G1ZA 4FLUA 1WYDA 1KMMA 4YRMA 4YROA 5LMNO 1X54A 2QKCA 2C7IA 4FK5C 2ZQMA 2DWDC 3TEHB 1QLNA 1NH2D 2JGUA 2OIGA 4UCVA 3IALA 4YIPA 3BY6A 4LR3A 5LP6C 1IX9A 1Y66A 4WFEA 2IY5B 4TVAB 3K5LA 5A9GA 1ZUQA 3E8HA 2Q5IA 3ETEA 2JIZG 4YRKA 4PA6A 1JFFA 3RW0A 4U7NA 3JSLA 5B66Z 4GX2A 2DW4A 1ADYA 2Q7EA 3TEGA 4O4JA 1SF9A 3UT5A 4TVWA 4P74C 3THOA 3OUSA 4H2TA 1YHQV 1SQVH 4TQFA 1DTOA 5JVDB 4R50A 1VQ4V 4G84A 1X55A 3HY1A 2BTOA 5EBMC 2LW1A 1IBMB 1M9NA 1PNMA 1L0LH 1KMNA 2ARUA 1QNMA 3APOA 1Q3EA 4TT3G 2BSKA 1DF4A 3B4SA 4DV6B 4X1YB 5B3SC 2F4VB 1YF2A 3C3SA 4FVMA 2FB5A 3E8FA 4ZKIA 2UUBO 2UXDO 2DYRC 3G6EV 1EQRA 2E64A 3GB7C 1F23A 3E89A 1FXKA 1G8MA 1LUWA 1PL4A 1YVWA 2ZDIA 3S3XA 3EFRA 4DR4O 2D2CB 4YPFA 1K92A 1KKDA 5LMNB 3P3PA 5IYZA 2OCCC 1KECA 4ABMA 3TXSA 5LA6B 1ZLZA 4WFAV 1JFFB 2R72A 3ZHSA 2EJ7A 1M57C 4I9WA 3A2FA 3V8KA 3IKLA 3HRKA 1NJ2A 4XDLA 4O4IB 1A32A 3EXAA 4NVPA 3SPJA 4U3FH 4K88A 1R3LC 3HXVA 4PA3A 4G28B 3OE7G 4CH3A 1EIYA 1BQ0A 2JRIA 3QVNA 2YIBD 4DW0A 3RYCB 1K3EA 2BSKB 4HNAA 1RM1B 2ODMA 1K5QA 1B70A 3DGEA 2HR3A 3DSQA 1VMGA 2DE0X 1FFTB 2Y4UA 1GMGA 3ZHVA 3CC7V 4FMTA 2RMKB 2YI9A 4DK0A 3FD9A 1AILA 4P73A 2MW2B 4YXWG 5KAFZ 1XMQO 4TWAA 1IVSA 1WAZA 2UUBB 4PJ0Z 2UXDB 4HBNA 2YDEA 1R3IC 2VS0A 3ABTA 1BIAA 3F7YC 3H1LH 3QNEA 1TVKA 2DU5A 4DR4B 3R65A 1XNQO 3T4DA 1Q6UA 4B3MO 5E3IA 1I08A 3ABMB 3HKBA 2HVKC 4YRPA 3BEHA 3UO2A 2BE3A 1HNZO 2DEQA 4PELA 1EFWA 3P30A 3SPIA 2WLKA 4I55B 1UPGA 3EHBB 4LFBO 3UKMA 4E4EA 5LOVA 1EFRG 1J95A 2R9RB 4BW5A 1X56A 4LH7A 3RUXA 2DJZA 4I4TA 4AH6A 1FD9A 1Z5WA 1K7DA 4CS3A 1B8AA 5L3GA 4HNAB 1OCOB 1YSCA 3RYIB 5JH7A 5E1AC 4JI4O 1MMMA 2IBZH 4YJ2B 1JR9A 4J7ZA 3ZJZA 4AILC 2JS5A 2P4VA 3D8CA 2CJ9A 2DKGA 3OTOO 2QA4V 1EZJA 1V54B 2AKWB 1Q7YW 3ZHRA 3VOUA 5ITZA 2QE7G 3W7XA 3RGLA 1PNKA 2AW9A 4LWSB 3K3WA 3ZEDA 5KMGB 5JWPA 4YRIA 4DV4O 5BR8O 1HTTA 1XMQB 3P8TA 3CCLV 3I55V 4X1KB 1PL0A 4XTXA 1X01A 4LVLA 1EM1A 5EC2C 1H8EG 3OEHG 1Q90D 5L3BA 3ASOB 3K04A 3UFGA 4H2XB 3HKBB 4QNHB 3SYOA 1C0AA 4PHCA 3Q4HB 1XNQB 4H02A 1Y74A 4GX0A 5J2UA 1XQ8A 4B3MB 1RM1C 4TUYA 1XREA 1Y76A 5JJJB 4QGPA 2NN4A 5LOVB 2RHQB 1HNZB 3CCSV 3HKCB 3DXRB 1BE3H 4LFBB 2CH7A 2Y69B 2A79B 5H5NA 4CBCA 1WN7A 1NYRA 1M56B 4U7OA 2CJBA 3G4SV 4WF2A 3MHSC 2XGTA 1GGMA 3L9DA 4C7UA 2AXTZ 3LC0A 3UGQA 1PYSA 1PPJH 4JI4B 1N9WA 3A0BZ 3VBBA 3EFSA 3MF1A 1BS3A 2QJ1A 1R6KA 3ABMC 1SA0A 3RKYA 3OTOB 1USYA 1XL6A 3NR7A 4MVOA 4Q15A 4DV4B 2FTKA 2A06H 2CTWA 5BR8B 2Y4TA 1XOUA 1D5NA 3SPGA 3CPWU 4JV5O 1ENVA 3OAAG 1CXZB 3FX7A 4PA7A 5KHHA 3HXWA 2Z3YA 4H2SA 2Q9LA 2C2AA 1OCOC 4TUYB 2IH1C 5CN0A 4CH5A 3B2EE 4XTYA 2QWRB 5C93A 1V54C 3OM3B 1EN4A 4ZIBA 4WJ3M 2ZXWB 1VF7A 2YEVA 3FB7C 4E2LA 1OJHA 4OGQB 2ITDC 1NBMG 3OUFA 1H2NA 2WSSG 2Q0AA 3U0ZA 4BIUA 1G1XB 1PYSB 3RYHA 1YJ9V 2WPDG 1H38A 2AGAA 3AG4B 3BPZA 2QHSA 5GTIZ 3L75H 2FKXA 3ASOC 2E76B 1SA0B 2I4NA 2ATKC 1B76A 3MHHC 3O65A 4G85A 4WBNB 2QTOA 4DV0O 1YB3A 3CCRV 3G80A 3QO7A 1OCZB 4YRRA 2JJ2G 1KMIZ 5CBGA 2C8MA 2AHZA 1N33O 5LP6A 1HP8A 4O2BB 2OIEA 2GV9A 5EC1C 3E35A 2Y69C 4NB5A 1ATIA 4AQYO 1MZFA 4FM2A 2AMCB 1KC8W 1M56C 1S77D 3RF1A 3RL6A 2K9PA 3BA8A 4PDRA 4JV5B 4OPAA 2ZE8A 4IT5A 4EFEA 4P74A 4PDLA 1CEZA 2PMFA 4X8AA 4HWRA 4MVZA 2XAFA 1GK9A 1VF6C 1FXVA 4DPGA 1PKXA 2F95B 5C53B 4JTDB 2UXBO 4MTGA 2X6AA 3ZRWB 4QE7A 2Q7HA 3F5TA 3ZBHA 1YI2V 1AI6A 3I5DA 2XASA 1L0WA 3RYHB 4XU2A 2QTSA 4E51A 3OD1A 4KL1A 1UFIA 4JYAO 1WPBA 3KCXA 1HNXO 2RJZA 1EOVA 2NS6A 1KOGA 3CC2V 4ZTUB 5TISZ 1AP6A 1BHAA 5EIBC 1AI7A 5JCOA 2XHBA 4JI7O 4IYIA 3SJQC 1KP2A 4DR5O 3SYPA 1HR0O 1H4VB 3AG7A 5EZYB 1Q43A 1Q5OA 4UCOA 4MW8A 4NCXA 3CX5F 3HFZA 4YP0A 1VQKV 3K03A 4FM0A 2Q67A 3V7SA 2CE4A 3J81N 2XUMA 2I4OA 2YIBA 1MA1A 1H8HG 5L3EA 4KUMA 4DV0B 2HHHO 3PCOA 1N33B 3DC6A 2WLIB 4Q20A 2ZXWC 2JGDB 3P3NA 5LXTA 2UXCO 4TV9A 3K0DA 5FLXN 4AQYB 1JJ2U 3E22A 4N23A 4DV5O 4UP9A 5EIBD 4O4LB 1TAEA 4YHHO 4H2YA 1FYFA 2I4LA 3WFVA 2DQ0A 3ICXA 2W6JG 1XI1A 3AG4C 2GTAA 3H1IH 5JJEB 2X6BA 1WLEA 4CS4A 2E75B 2RHSB 1USYC 4DR3O 2ZR2A 3J80N 3TEHA 4FLYA 2UXBB 1QCEA 2O57A 4JAVA 4DV3O 4YRFA 1K9MW 2Z0AA 1OCZC 1VQ8V 3MEYA 3L2ZA 2JEUA 2P5OA 4Z1VA 3N2KA 3BFMA 4HYOA 1PP9H 4FLTA 5KUMA 5AG2A 4JYAB 3GVMA 5LHIA 4R8CA 2IJJA 3E8GA 1HNXB 3ZHUA 1KQSU 1Q81W 4JI7B 3KKYA 4DR5B 1HR0B 2YIAA 5GONB 2Y48A 4TVYA 5JVDA 2UUCO 2ADPA 4JAAA 3JCZA 2QR4A 2G38A 3CMEV 2ZIOA 3L71H 3DC5A 4UCRA 3AK3A 5LXTB 1IBKO 1P49A 4B7KA 4P75A 2LO1A 2QWQB 11ASA 2QM7A 1IURA 2HHHB 1JMKC 3E22B 1KBHA 4X1IB 4J80A 1N0JA 2ZXFA 3F7VC 4X1YA 2UXCB 1NNHA 1RIQA 3E2EA 4LVIA 1YTFB 1DGSA 4DV5B 4I7ZB 1BZKA 4MTXA 4YHHB 2CIMA 3VQXA 4RQEA 2Q73A 1NZ6A 1GM9A 3JD1A 4K8XA 4YRLA 2ALYB 1NJ1A 4FLWA 1SKVA 4YCUA 4LNUA 1QVGU 5IE9A 1NI8A 1XDCA 1AR1B 2VQFO 4KFMA 4XTWA 4DR3B 1BMFG 1V55B 4JI3O 4DR7O 3AK2A 3N2KB 4DV3B 1G51A 1E1TA 2PMEA 5LA6A 3FKSG 4PV1B 3UH0A 2IJHA 5DN6G 2B1GA 1K97A 3HXZA 2Q4PA 4UV9A 5IYDO 5DECA 5BZBA 2ZZFA 3JASB 4DK1A 1BGYH 4DR1O 4O4IA 4MSWC 1JX9A 3BA9A 1DK1A 3D3QA 2EJ9A 3NELA 2H94A 2IJKA 3G67A 5F5WA 4X88A 1RP3B 3IFXA 1YFSA 2XAQA 3B77A 3HRIA 4IIJB 4PA4A 4NKGB 4DR2O 2ODRC 1K33A 4JI1O 12ASA 1VQ7V 2ZCEA 5LHGA 2UUCB 2PI4A 3RYCA 5H6QA 3JAKA 4EKWA 1FJGO 3NEMA 3HR0A 1BBWA 3ZN0A 2FL4A 1IBKB 2PTMA 2EL9A 3V8LA 1B3QA 4ICGA 1COWG 4B3SO 2QHTA 1P7BA 3CB2A 3OGIB 1JQ0A 4MTOA 2ZE7A 1QE0A 2ZZGA 4UVAA 3LSUA 2B5UA 5HFMA 3D3IA 4QIWF 4I9QA 4DRXB 4JYYA 5JCOC 2PYLA 4LNUB 5KAIZ 3RIRA 2LP7A 2E1HA 2H8PC 3PN1A 3U10A 3E8BA 3V7CA 4P71C 1CP9A 2ODRD 3QTCA 4XTUA 1T5EA 5LGUA 1GTOA 2P06A 2VQFB 1JA8A 4J7KA 2YIDA 3CXCU 4TTVA 2BCCH 2QWOB 4JI3B 4DR7B 1YDXA 3UGTA 5KUKA 2DU7A 2PUSA 3RT3C 1I5YA 1S3JA 3L72H 4I55A 4X64O 2VWJA 2FMLA 1S5LZ 1WB8A 5FPOA 2LJ2A 2KG7B 4I0XA 3A32A 4DR1B 4MVSA 1L8DA 1Z2GA 3K79A 1Q86W 2WWWA 2XTIA 5IJ0B 2QHVA 1ZX3A 2UUAO 4JI6O 1XILA 5IWAO 5EYPB 4ZHQA 3JAKB 1FAFA 2ZT8A 3RYIA 1I94O 1JOYA 1TUEB 3EVKA 1WPXA 4YJ2A 4DR2B 4JI1B 4PDVA 4JI2O 3FAVA 4NYKA 1QBZA 1V55C 3D36A 1FJGB 4ZTZB 2AKWA 4JPRA 1HXDA 1N32O 2HJDA 4KHPO 4B3SB 4LWSA 5KMGA 1Q6IA 1YTFD 1AR5A 4AI8A 4WCEV 1GN6A 1LR1A 1H2MA 4O4HB 4JYBA 2D3OW 2EINB 2EIMB 1BBUA 3NENA 3ZS8C 4X1KA 3M4PA 1M93A 1SETA 3CHXA 1XUQA 1GM8A 2YS8A 4J42A 4H2VA 3RKWA 4CC6A 3JATB 3ZMZA 1VQPV 4UP8A 1SZXA 2UXXA 2CGNA 4H2XA 2XAHA 2P90A 4RWUA 2LGQA 2LQTA 3FJPA 4P75C 3Q4HA 3QO5A 2P67A 5C8YB 1P7GA 1GAXA 2X6CA 1S72V 3JAMN 3ETQA 5HGQA 3SYQA 2RHQA 5E79Z 2OT5A 3HKCA 4KP4A 4I0XB 3DXRA 4X64B 5EBWC 4JI0O 3A8TA 1K8AW 1SESA 4WFGA 1NR1A 2V4DA 5J9PC 4ZHQB 4PHZA 3AG2B 2UUAB 4JI6B 3HKEB 5KA5A 4P2ZA 1HC7A 4LF7O 3SGIA 5IWAB 1QF6A 3FAVB 1IL2A 4YCWA 1I94B 1VF6A 1XMOO 3FB6C 3A31A 4JI2B 4EB6A 1SC5B 3ML0A 5D5QA 3GWKC 2E41A 1G5HA 3T2MA 4UB6Z 1N32B 1PV0A 4JGSA 4KHPB 2ITCC 3B40A 3I56V 2PZSA 1V9PA 2X7RB 3RVYA 4ZOLA 1VQNV 1GH6A 1K34A 4WFHA 1X2GA 2CAZC 2GHYA 2ARTA 2JEXA 1K73W 4J9YB 2JDIG 3JALB 5CA0B 5CA3A 2ZZEA 4P3PA 2M7WA 2E74B 2EX3A 1NS1A 1Y4MA 5B5EZ 4XEMA 1R3JC 1O9GA 1H2SB 4F6EA 1ZWIC 5LL6Y 2R9AA 4K0KO 2HG5C 1NJIW 2Z5UA 4HWTA 3ZHQA 5F2VO 3TGUH 3IC7A 1WP7A 5IY5B 1SRYA 3VQVA 3K9AA 2P22C 4JI0B 2N74A 1QHTA 2EINC 2EIMC 4JI5O 4YRCA 3RGBA 1EVLA 1NVPB 1VQ6V 5C52B 1WQWA 4OXSA 3CRMA 4RDXA 4WFBV 2DWEC 1E79G 1FPOA 2IH3C 2F1MA 3HKDA 3CCQV 2A8EA 3H01A 5L3FA 1N34O 3ABKB 4LF7B 1WQ7A 4EB6B 4K8ZA 1SQGA 3O9OA 2DVEA 1AP5A 3TJTA 1XMOB 1LNQA 3SJCC 3WB2A 2HEPA 3AG1B 2HVJC 3BABA 1KU9A 2R70A 3C90A 4PA9A 4ZOLB 4WBNA 1GN4A 2IJIA 2WLMA 4FIPC 2Q5ZA 3OMIB 4LC1A 4O2BA 2Q8VA 3L73H 1HNWO 4RO2A 4J9ZB 2Q6AA 2L6LA 2AMCA 1SQXH 4DUZO 5H2FZ 3CS5A 1NTKH 5D5PA 3B8MA 4XTVA 3AG2C 4UVCA 5L3DA 1YITV 1TGOA 4FLZA 4OLFA 4DV2O 2YI8A 4CZZA 4TWKA 3K58A 3D36C 1H2LA 5LBQA 2W0FC 3K57A 3L70H 2ILMA 3QF7A 4PI2A 4BW9A 3OEEG 4P9PA 3CCEV 4K0KB 3WB0A 1XHXA 3W7TA 3ZRWA 1Q6HA 2CTPA 3OMAB 2J3LA 3RVZA 4LNSA 2DTOA 2P4KA 1M90W 3A7AA 4J11A 2Q7GA 2DJVA 2X0LA 2E5LO 4F4LA 3HKDB 4QE9A 3CCVV 4LP8A 4G27B 4YYEA 4JI5B 5B1AB 4YCVA 4YRNA 5JJNB 2JVDA 1E22A 1N34B 2N04A 3SDLA 1B6QA 4IHJB 3K5OA 5EZYA 4GZRB 5FNVB 1H4SA 5KX5B 4XEOA 3K9SA 5B1NA 1VQMV 2CTRA 4IL6Z 2HLDG 2VWKA 1AI4A 2ZIMA 2H3OA 2QHUA 1D2DA 2WLIA 1IBLO 2JS3A 5IYCO 2CDYA 1SZTA 3H1JH 2JGDA 5IY5C 4LF8O 1HNWB 2HJFC 2ZT7A 3BJUA 4MVMA 3WB1A 4EFBA 4O4LA 4UCUA 4DUZB 3I7FA 1L0NH 2EZPA 4GCZA 4ZBMA 3A5ZA 4DV2B 3ABKC 3CJHA 2GDSA 3LUTB 1MSWD 1YXBA 2NNUA 2EJFA 3P32A 2RHSA 1K5SA 1NTMH 3JD2A 3OTFA 3ZN1A 3AG1C 1BSMA 3VQYA 2ZTGA 1WNLA 1VQ5V 1AI5A 2QKAA 2PF4E 3TETA 3JYCA 4UP7A 3CEIA 3IC9A 4X89A 1M4UA 1WPYA 4FFBA 2F23A 3UO3A 1NVPD 2E5LB 4ZI7A 2ZKOA 4U3JA 1NTZH 1QLEB 2ZM6O 4LFAO 3KZIZ 4D7TA 4OP0A 3GWOA 4JZGA 1YGBA 4P71A 4TV8A 5H9CA 5GONA 3SYCA 1EZVH 3PZCA 1YEWA 4PDMA 5EBLC 4DV1O 1KD1W 1B7YA 5KLVH 4OPHA 4PD4F 5CMUA 2RDCA 5LGNA 3N2GB 1FXHA 2EJRA 2M6YA 4WF9V 1NR7A 4HAMA 4X1IA 1IBLB 2G4CA 1VIBA 1G4YB 4DO2A 3BAAA 5CB4A 1QR8A 4F6RB 4LF8B 4HVCA 4MW3A 1Z7MA 3V8JA 1KKCA 3QO8A 2CUGA 3H1KH 5B1AC 3CJHB 4ASUG 4YIOA 5DEDA 3SR2C 2ALYA 1AJQA 3OR7C 2CGHA 4K35A 5J2TB 4K87A 2KKWA 1JJOA 4UCSA 4HWSA 2QSAA 1GN2A 4H2WA 1TUBA 1LUVA 2YSUB 2XOKG 4MVQA 1YCIA 3B8NA 4HWPA 1QR9A 4FFBB 3OW2U 4ZI7B 3L1AA 1M5IA 4U3JB 1RFYA 4LFCO 1SERA 4J41A 5KNNA 1RSOB 1Y6XA 1WJZA 4DQ2A 2ZM6B 4GUNA 3JASA 4MVRA 4TV8B 4YRSA 4TQDA 3F5WC 3FB5C 4PI0A 2YXLA 4UCTA 4LFAB 3V7RA 5KA6A 1M1KW 1WNSA 5CBFA 1B7YB 3ETDA 3HPLC 3CWBH 4IIJA 3ZRSA 1BCCH 4GKJO 4DV1B 1ASYA 2QWNB 1B06A 2XT9A 2CJAA 1X2HA 4FM1A 3L4GB 1R73A 1GKFA 1TA8A 4B3RO 3JARB 1AB3A 5CB4B 1EN5A 3T1YO 1OCCB 4JTCB 5C51B 4O2AA 1F4NA 2FYUH 1XEQA 4EEQA 3CXHF 3SJAC 2EAYA 4HA8A 4X65O 1FFXA 4B3TO 5ELOA 1I5XA 4DRXA 2IU3A 1AJNA 1QLEC 2YXYA 5FL7G 1XBLA 2EIJB 1X59A 5LYJA 1YJWV 4XU3A 4YJ3B 2Q68A 3JD4A 3JSNA 3MQZA 3ICAA 3REXA 3JD3A 4UPAA 4JYCA 2PYJA 2WLLA 1N0NA 1TUBB 3K0GA 3U11A 5CA1B 1BIBA 4I50B 5KHGA 3QG5A 5KHJA 3RN4A 1AVMA 5HFLA 4W4KA 2ZGWA 3SPCA 2WLJA 4LFCB 3BVOA 4X62O 4J10A 4LH6A 1BT8A 4LVMA 3K5NA 2KG7A 2YXHA 4IGGA 1KB9F 3CRAA 3UM7A 3W7SA 1H2KA 4BIZA 3HXUA 5IJ0A 3IG2A 1VQOV 4YRQA 2HP8A 3A0HZ 4OX9B 5EYPA 3R07A 3EFFK 2AHYA 4JI8O 4GKJB 2CGOA 4FJCC 3RACA 4O2AB 1S5JA 3KCYA 3C3TA 4B3RB 2DYSB 1FS0G 1FFXB 2IU0A 3CSXA 3T1YB 4RQFA 2E65A 1E24A 4MVUA 4GX5A 3X2QB 4H37A 3RYFB 5LYJB 1Z7NA 3CP1A 3BFRA 3T4ZA 1SS3A 4X65B 2KQXA 2KB1A 2QDOA 4B3TB 2YUAA 4O4HA 1NJ6A 2GUZB 1HW7A 1P4RA 2WLLB 2LGWA 3R66A 2DQ3A 1NKDA 3MDSA 4CS2A 4DUYO 5B1OA 1W59A 2WLHA 2ZNIA 4HWOA 1H4QA 3JATA 5BXZA 3ASNB 4NXMO 1OHHG 4XDJA 5KHIA 3MD0A 1OV9A 1DF5A 2OCHA 3B09A 3M99B 4KXRA 5C8YA 1SQFA 4LF4O 1S76D 4RUFA 5L3CA 2VQEO 4X9QA 1VEWA 1IXMA 1OZ0A 1WB7A 1XL4A 3ABLB 3AG3B 1OCCC 1GM7A 1SQBH 2CTQA 5IDJA 3A0RA 4H0LB 1G5IA 3CCMV 1EVKA 1ZAUA 4R7CA 2XNDG 4LCUC 2HKOA 2JJ1G 5B1BB 4X62B 3LNMB 1Y67A 3IGAC 2DN9A 2W6IG 4L8JA 4D6TH 3P8VA 4DXWA 4O4JB 2EIJC 2V1DA 1YIJV 3UT5B 3OD4A 1W2BU 3TCUA 3OGCC 3T1HO 2RNBA 1WA8A 3HKEA 5BY1A 2EIKB 1L1FA 2ZT9B 2KSDA 3TXQA 1N36O 1G6UA 4JI8B 2UU9O 5GTHZ 1MNGA 4GYCB 1SQPH 2NR5A 1DLBA 1I0HA 1HWYA 1U97A 3ABUA 3CCJV 4FLXA 2EILB 3KG2A 1PNLA 2GSMB 3CCUV 4AHCA 3NETA 3BHPA 4LF9O 4YREA 2QM4A 4CC5A 1FXKB 4DUYB 4WFFA 1E1QG 3JALA 5K1PA 2Q69A 5CA0A 2QEXV 4NXMB 5IYZB 2DDZA 3HFVA 3ZCCA 3IAYA 4QPJA 2GTSA 2EULA 4LF4B 2BTQA 2VQEB 3OR6C 2DYSC 1W66A 2F43G 5KHKA 4MTFA 2Q5HA 3ZIAG 4D7SA 3G6BA 4JZ2A 3X2QC 4DYLA 2XAGA 4HZ3A 2CK3G 4GLXA 1WA8B 3J7AU 3CYOA 2ZD9A 2OTLV 2ZT6A 4YDQA 1Q82W 2ZE5A 3T1HB 3CMAV 3CC4V 2YICA 5GW7A 1BQZA 2IW5A 1EIYB 1VP7A 2DMXA 4Q6GA 3ASNC 1N36B 1KP3A 2AZ0A 1K4CC 4KR3A 4H33A 1EBOA 2UU9B 3BCCH 1RPOA 4P3NA 4X5OA 2ZE6A 1B70B 4P30A 2NLJC 3N27A 1N4CA 3H1HH 2E5AA 1UJWB 3ZRXA 4H2UA 4P72A 3ABLC 4X66O 3AG3C 4LVJA 1WU7A 1JPXA 1VQZA 1F4MA 3H9VA 4UV8A 3HXXA 3OFNG 5B1BC 4X20A 2R9IA 3LSQA 5BMVA 4LF9B 2ZINA 3STZC 1XNRO 3HTZA 3HB3B 5H6RA 4FPPA 1TVKB 1YFRA 3MF2A 3SJBC 2EIKC 1VQ9V 4RUEA 4XU1A 1R6TA 1H2GA 3K59A 1ROPA 4H13B 3LDEA 2BTQB 1MABG 2OWOA 3WU2Z 4MT8A 2BOCC 4JASA 3CRRA 1JVMA 5LMUO 3A7RA 2EILC 2A9HA 5FPRA 4UB8Z 3ERRA 2YC0A 3RBZA 4LF6O 1KYOF 2QKSA 2B1IA 4I4TB 5IT9N 1HDJA 3FFQA 4MS2A 4PG3A 2B9ZA 3M7MX 4HT4A 1B04A 3JAWA 2WLNA 2ZNJA 1FXKC 4DW1A 2ZDIC 3DTUB 5JH7B 2PGGA 4IHJA 1MOFA 1R6NA 4GKKO 2WA4A 5FNVA 4RMFA 5KX5A 4JAUA 1OCRB 3AK1A 1NQTA 2HNIA 1W0KG 3KFUA 5ITZB 1WP8A 4Z1MG 2FYKA 3LNNA 4WI1A 4X20B 4X66B 1YFTA 5BMVB 2L35A 4UUJC 2K1EA 2EBOA 3RKXA 1S0VA 4IYHA 3ZRVA 2VRZA 3OT7A 2P6JA 2QWPB 5IJ9A 4H44B 1XNRB 2PI5A 4XBFA 2QM8A 2QGNA 3P8YA 2E10A 2PY5A 3UQ8A 1ADJA 1AJPA 1E1OA 2DTHA 1THZA 1Y74B 5J2UB 4W4LA 1KUQA 1Y76B 1PD3A 1ZL8A 1Z5VA 1ASZA 5LMUB 3AEIA 1ZSPA 4FFKA 4P73C 3ZMTA 2CH7B 3SPHA 4R6ZA 3ZHTA 4NR1A 5DM6V 4LF6B 3JAWB 4UFZA 3STLC 1IXBA 3K5MA 2DZ9A 4WJ4A 1N8RW 2LFSA 4YRTA 3VQWA 3ZX6A 1NJ5A 3HY0A 4O2DA 3E9HA 3LSSA 3L74H 4DV7O
chains in the Genus database with same CATH topology
3E8BA 3OW2U 3L1AA 3K3WA 4P71C 3V7CA 1ORQC 4BWAA 3TUPA 1CP9A 2ODRD 4YRIA 1HTTA 1SERA 3QTCA 3FB8C 3LDDA 4XTUA 4XTZA 5KNNA 2JK5C 3P8TA 5LGUA 4N21A 3RGLA 1GTOA 1MG1A 3CCLV 3I55V 1PL0A 4XTXA 1X01A 4LVLA 4DQ2A 3CXCU 4TTVA 4MVRA 4YRSA 5EC2C 1H8EG 4TQDA 3F5WC 3FB5C 3JD0A 3V7RA 2DXTA 5KA6A 3UGTA 5K1XA 5KUKA 1M1KW 3OEHG 5CBFA 2DU7A 2EWNA 3ZMSA 1B7YB 5L3BA 1W0JG 3ETDA 1I5YA 1S3JA 3ASOB 3HPLC 3K04A 3UFGA 4H2XB 5CBGA 4QNHB 3SYOA 1C0AA 3ZRSA 4PHCA 1H4TA 2V7QG 1ASYA 4H02A 2CJAA 1K4DC 4GX0A 4UXNA 1X2HA 4QPKA 3A32A 1R73A 1RM1C 3E86A 3L4GB 2LFRA 1GKFA 4LBEC 4MVSA 5ELNA 3K79A 1Q86W 2WWWA 2XTIA 3LDCA 2QHVA 2RHQB 2OTJV 4EO4A 1OCCB 5LGTA 3CCSV 2XAJA 4JTCB 5C51B 1JJCA 1F4NA 3CD6V 3ETGA 2ZT8A 2Y69B 2A79B 2EAYA 3K08A 1JOYA 4HA8A 1TUEB 1RPRA 3A74A 4CBCA 1E1RG 1WPXA 4UVBA 4K86A 2E3CA 5ELOA 1I5XA 1NYRA 1M56B 4PDVA 4U7OA 4P72C 2CJBA 2IU3A 1AJNA 1QLEC 3G4SV 5FL7G 1GO3F 3MHSC 2XGTA 4WF2A 1OCRC 2EIJB 4JTAB 1YJWV 1QBZA 1GGMA 3K06A 1V55C 3D36A 4XDKA 2ARSA 4XU3A 2Q68A 3JD4A 1NH2B 3MQZA 2AKWA 4ZTZB 4JPRA 1HXDA 1BHBA 3ICAA 3REXA 3JD3A 4L87A 3LC0A 4JYCA 4UPAA 3UGQA 2YEVB 2DZCA 1PYSA 2WLLA 1YTFD 1N9WA 4WCEV 3K0GA 3VBBA 3EFSA 3MF1A 3E9IA 4JF3A 3FYIB 3E83A 4JYBA 2EINB 2EIMB 2D3OW 1BBUA 1BIBA 3NENA 4J15A 1R6KA 4P3PA 3M4PA 3ABMC 3WG7B 3RKYA 1SETA 5HFLA 1GM8A 3G71V 1USYA 2ZGWA 3SPCA 4H2VA 3RKWA 1XL6A 3NXSA 4MVOA 2WLJA 3ZMZA 1VQPV 4UP8A 4Q15A 2UXXA 2FTKA 1QVFU 4H2XA 2XAHA 2P90A 4BAYA 5CBHA 3FJPA 4P75C 4LVJA 3ZMUA 3QO5A 3SPGA 3L4GA 2P67A 4LVMA 2X6CA 4P9OA 1S72V 3W7SA 3UM7A 3CPWU 4BIZA 2J3MA 3HXUA 3SYQA 3IG2A 1VQOV 1ENVA 2RHQA 4YRQA 3OAAG 3HXWA 4PA7A 2Z3YA 2OT5A 5IYBO 4H2SA 4KP4A 2C2AA 1OCOC 3REUA 3R07A 3EFFK 2AHYA 5EBWC 1K8AW 2IH1C 4GX1A 3VOUA 1SESA 3TK1A 4FJCC 5CN0A 3RACA 4WFGA 3CMQA 4XTYA 1NR1A 5J9PC 4CH5A 1JJCB 5C93A 4XU0A 2A0LA 3AG2B 3W7WA 1V54C 2DYSB 3OM3B 1BL8A 1FS0G 2IU0A 4ZIBA 1LYLA 4RQFA 5KA5A 2E65A 4P2ZA 1HC7A 4WJ3M 2ZXWB 1E24A 4MVUA 4GX5A 3X2QB 2P0LA 4H37A 2YEVA 3FB7C 3T1CA 4E2LA 1Z7NA 3CP1A 2DXUA 3IKMB 4P3OA 2ITDC 4YCWA 1IL2A 1NBMG 3T4ZA 3OUFA 4YRRA 2WSSG 2KB1A 3ZMVA 1NJ6A 4BIUA 3FB6C 3A31A 3PJSK 2EJGA 1PYSB 1P4RA 2WLLB 3ML0A 3W3SA 1YJ9V 1YJNV 2DQ3A 1NKDA 2E41A 1G5HA 2WPDG 3T2MA 3A7UA 4CS2A 2EZOA 1H38A 3AG4B 5B1OA 2QHSA 2WLHA 4JGSA 2ZNIA 4HWOA 2ITCC 1H4QA 3FYEB 5B3SB 3ASOC 3ASNB 1OHHG 4XDJA 3I56V 2X7RB 3RVYA 3MD0A 1VQLV 2P7TC 1VQNV 5LHHA 2I4NA 1K34A 5EK0A 1DF5A 4WFHA 2ATKC 1X2GA 1B76A 2DYRB 3A5YA 3M99B 2IY5A 4TVAA 3MHHC 1AROP 4G85A 2QTOA 1S76D 4RUFA 5L3CA 3CCRV 1YB3A 1F51A 3QO7A 1IXMA 1OCZB 1OZ0A 1XL4A 2GHYA 3AG3B 2AHZA 1OCCC 2JEXA 1GM7A 2JDIG 2JJ2G 4J9YB 5IDJA 3A0RA 1K73W 1G5IA 1NYQA 3CCMV 1R3KC 1EVKA 5CA3A 4R7CA 2ZZEA 2XNDG 3M4QA 4LCUC 2HKOA 3E35A 2Y69C 2JJ1G 2M7WA 5EC1C 5B1BB 3LNMB 3HFZB 1ATIA 2ZT5A 4CH4A 1Y4MA 3IGAC 1CPYA 2OCCB 2W6IG 2AMCB 1KC8W 1M56C 3OMNB 1S77D 3P8VA 4XEMA 1R3JC 3RF1A 3RL6A 4DXWA 1ZWIC 2EIJC 2V1DA 2HG5C 1NJIW 1YIJV 3PCOB 2WAMA 2ZR3A 3TCUA 1W2BU 4PDRA 4TSFG 4YRGA 3OGCC 3SYAA 2P5IA 2UXNA 2Z5UA 1M57B 2BOBC 1J5WA 4P74A 4EX5A 1JCHA 4GT1A 4PDLA 1CEZA 2PMFA 2EIKB 4HWTA 4X8AA 1L1FA 3IC7A 5IY5B 4HWRA 4MVZA 2XAFA 1GK9A 4I5SA 4G2KA 1SRYA 4LVKA 1FXVA 3K9AA 3VQVA 3W7UA 4DPGA 1PKXA 2EINC 2EIMC 3HXYA 4YRCA 2HFEC 1EVLA 2I4MA 5C53B 4JTDB 1NVPB 1VQ6V 3WQZA 4MTGA 1S5HC 2X6AA 4QJFB 1WQWA 4OXSA 3WG7C 4YRJA 4RDXA 4WFBV 5C52B 1DLBA 1E79G 2DWEC 2IH3C 3ZRWB 3CCQV 1HWYA 4QE7A 2A8EA 4KQEA 3ABUA 4CH6A 4KR2A 2MK3A 3H01A 4RAIA 5L3FA 2EILB 3CCJV 1NJ8A 2Q7HA 3ABKB 2DTIA 1YI2V 3KG2A 1AI6A 1PNLA 2GSMB 2XASA 1WQ7A 1L0WA 3CCUV 3G1ZA 1WYDA 4XU2A 1KMMA 4YRMA 4YROA 4E51A 3ABLB 3NETA 1X54A 2C7IA 3OD1A 2DVEA 4FK5C 2ZQMA 2DWDC 3TEHB 1LNQA 1QLNA 1NH2D 3AG1B 4YREA 2HVJC 3IALA 1EOVA 2NS6A 1KOGA 3CC2V 4ZTUB 3BY6A 1BHAA 1AI7A 4PA9A 3SJQC 1FXKB 2IJIA 1KP2A 2WLMA 4FIPC 3SYPA 3OMIB 1H4VB 1Y66A 4WFEA 4WFFA 1E1QG 2IY5B 4LC1A 4TVAB 5K1PA 2Q69A 2QEXV 3E8HA 4MW8A 2Q5IA 3ETEA 4NCXA 2JIZG 4YRKA 4RO2A 4J9ZB 4PA6A 2Q6AA 1VQKV 3K03A 3HFZA 4YP0A 2Q67A 2DDZA 3RW0A 4U7NA 3V7SA 3HFVA 3ZCCA 2AMCA 4GX2A 2DW4A 2C8MA 4QPJA 2I4OA 1ADYA 1H8HG 2Q7EA 5L3EA 3B8MA 4XTVA 3AG2C 4KUMA 3TEGA 3OR6C 3PCOA 2DYSC 1W66A 4TVWA 2F43G 4UVCA 5L3DA 1YITV 4OLFA 4MTFA 2WLIB 3ZIAG 4Q20A 2Q5HA 4P74C 3OUSA 4H2TA 1YHQV 4TQFA 2ZXWC 1DTOA 3X2QC 4CZZA 2XAGA 4TWKA 4HZ3A 2CK3G 3K0DA 4R50A 1JJ2U 4N23A 5LBQA 1VQ4V 2ARTA 2W0FC 1X55A 3HY1A 4G84A 5EBMC 4UP9A 3CYOA 1M9NA 1PNMA 1FYFA 2ZD9A 2OTLV 2I4LA 2ZT6A 4H2YA 3OEEG 4P9PA 3CCEV 1Q82W 4BW9A 3WFVA 4YDQA 1KMNA 2DQ0A 2ARUA 2W6JG 4TT3G 3W7TA 3ZRWA 3CMAV 3CC4V 3OMAB 1DF4A 3AG4C 2J3LA 5GW7A 3RVZA 4LNSA 2DTOA 1M90W 3A7AA 2IW5A 1EIYB 5B3SC 4Q6GA 3ASNC 2Q7GA 1KP3A 2X6BA 1WLEA 2X0LA 3W7XA 4CS4A 3E8FA 4F4LA 1K4CC 2RHSB 4ZKIA 4QE9A 3CCVV 4KR3A 4LP8A 4H33A 1USYC 1EBOA 2ZR2A 2DYRC 4G27B 1RPOA 4P3NA 3G6EV 4X5OA 3TEHA 5B1AB 1B70B 4YYEA 1QCEA 4P30A 4JAVA 2NLJC 1EQRA 2E64A 4YRFA 1K9MW 3GB7C 4YCVA 4YRNA 1F23A 2E5AA 1UJWB 3ZRXA 1OCZC 3E89A 3ABLC 1VQ8V 3MEYA 3AG3C 4H2UA 4P72A 1FXKA 3L2ZA 1G8MA 2JEUA 1E22A 1JPXA 2ZDIA 1VQZA 1WU7A 1B6QA 3EFRA 1QF6A 1F4MA 4YPFA 4UV8A 3BFMA 3HXXA 3OFNG 1K92A 5B1BC 4HYOA 1H4SA 1KKDA 4XEOA 5KUMA 2OCCC 5LHIA 5B1NA 4R8CA 2IJJA 2R9IA 1KECA 3E8GA 3LSQA 2ZINA 3STZC 1VQMV 3HTZA 1KQSU 3HB3B 2HLDG 5H6RA 4WFAV 1Q81W 1AI4A 4FPPA 1YFRA 1Z7MA 2ZIMA 2QHUA 1M57C 4I9WA 2WLIA 3MF2A 3V8KA 3IKLA 2EIKC 1VQ9V 4RUEA 5IYCO 3HRKA 4XU1A 1SZTA 1H2GA 2Y48A 4TVYA 5IY5C 1ROPA 3LDEA 1MABG 1NJ2A 2HJFC 3JCZA 4XDLA 3CMEV 2ZT7A 4MVMA 2ZIOA 3BJUA 4MT8A 3I7FA 2BOCC 2EZPA 4P75A 4JASA 4GCZA 11ASA 2QM7A 3SPJA 1JVMA 4ZBMA 3A7RA 4K88A 3A5ZA 1R3LC 2EILC 3HXVA 2ZXFA 3ABKC 2A9HA 3F7VC 4PA3A 4G28B 3ERRA 3LUTB 3OE7G 3RBZA 1MSWD 1NNHA 4CH3A 1EIYA 2NNUA 1RIQA 3E2EA 3P32A 2EJFA 4LVIA 2QKSA 1YTFB 2B1IA 1K3EA 1RM1B 2RHSA 1K5SA 3JD2A 4MS2A 3ZN1A 4PG3A 3AG1C 4MTXA 2CIMA 3VQYA 1K5QA 4HT4A 4RQEA 1B70A 3DGEA 2HR3A 2ZTGA 3VQXA 3DSQA 1GM9A 3JD1A 1VQ5V 1WNLA 4YRLA 1AI5A 1FFTB 2WLNA 2ALYB 1GMGA 3CC7V 1NJ1A 4FMTA 2ZNJA 1FXKC 3TETA 3JYCA 4YCUA 2ZDIC 3DTUB 1QVGU 4UP7A 4P73A 4X89A 4YXWG 1MOFA 4TWAA 1R6NA 1WPYA 1AR1B 1NVPD 4RMFA 4KFMA 1QLEB 4XTWA 4JAUA 1OCRB 2HNIA 1NQTA 1BMFG 1V55B 1W0KG 1R3IC 3KFUA 1G51A 3ABTA 4Z1MG 1BIAA 1E1TA 2FYKA 4OP0A 3F7YC 2PMEA 4WI1A 3GWOA 1YGBA 3QNEA 3FKSG 3UH0A 4P71A 1YFTA 2IJHA 5H9CA 2DU5A 5DN6G 2B1GA 3SYCA 4UUJC 3PZCA 1K97A 2K1EA 2EBOA 3R65A 3HXZA 3RKXA 4PDMA 4UV9A 5EBLC 3T4DA 5IYDO 1S0VA 1KD1W 5BZBA 1B7YA 2ZZFA 3ZRVA 5CMUA 5E3IA 3ABMB 2HVKC 2P6JA 4MSWC 5LGNA 4YRPA 3BEHA 1JX9A 1FXHA 2DEQA 2EJRA 4PELA 4XBFA 2PI5A 4WF9V 2QM8A 2EJ9A 3P8YA 3NELA 2E10A 2H94A 2IJKA 5F5WA 1EFWA 4X88A 1NR7A 3IFXA 1YFSA 2XAQA 3B77A 3P30A 4HAMA 2WLKA 3SPIA 2G4CA 3HRIA 3EHBB 1ADJA 1G4YB 3UKMA 1AJPA 4DO2A 4PA4A 1EFRG 1E1OA 1QR8A 2DTHA 4HVCA 2ODRC 4MW3A 1J95A 1K33A 1THZA 2R9RB 4BW5A 1VQ7V 5LHGA 12ASA 2PI4A 1X56A 2ZCEA 3V8JA 3QO8A 3RUXA 2DJZA 5H6QA 4AH6A 5B1AC 4EKWA 3NEMA 1BBWA 3ZN0A 4ASUG 2EL9A 3V8LA 1K7DA 1PD3A 4CS3A 1ASZA 2ALYA 1COWG 1AJQA 3AEIA 3OR7C 1B8AA 2CGHA 5L3GA 4P73C 2QHTA 1OCOB 1P7BA 1YSCA 3SPHA 3ZMTA 5E1AC 4K87A 4R6ZA 1JQ0A 4MTOA 1QE0A 2ZZGA 5DM6V 4UVAA 2B5UA 5HFMA 3STLC 3ZJZA 3D3IA 4QIWF 5HGQA 4HWSA 2DZ9A 4WJ4A 1N8RW 2LFSA 4YRTA 2CJ9A 2DKGA 4H2WA 1NJ5A 3VQWA 3RIRA 2LP7A 2E1HA 3HY0A 4O2DA 3E9HA 2YSUB 2QA4V 1EZJA 1V54B 2H8PC 2XOKG 4MVQA 2AKWB 3LSSA 3B8NA 1Q7YW 4HWPA 1QR9A 2QE7G 1PNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V7C A;  3L1A A;  4P71 C;  4BWA A;  3TUP A;  2ODR D;  4YRI A;  1HTT A;  1SER A;  3QTC A;  4XTU A;  4XTZ A;  5KNN A;  3P8T A;  4XTX A;  1X01 A;  4DQ2 A;  4TTV A;  4YRS A;  4TQD A;  3V7R A;  2DXT A;  3UGT A;  5K1X A;  2EWN A;  2DU7 A;  1B7Y B;  3UFG A;  4H2X B;  1C0A A;  4PHC A;  1H4T A;  1ASY A;  4H02 A;  2CJA A;  3L4G B;  1X2H A;  3A32 A;  5ELN A;  2XTI A;  2QHV A;  2RHQ B;  4EO4 A;  5C51 B;  1JJC A;  2ZT8 A;  2EAY A;  4HA8 A;  3A74 A;  4K86 A;  2E3C A;  5ELO A;  1NYR A;  4P72 C;  2CJB A;  4WF2 A;  2XGT A;  4XU3 A;  1GGM A;  2ARS A;  4ZTZ B;  2AKW A;  1HXD A;  3ICA A;  3REX A;  4L87 A;  3LC0 A;  4UPA A;  3UGQ A;  2DZC A;  1PYS A;  1N9W A;  3VBB A;  3EFS A;  3MF1 A;  3E9I A;  4J15 A;  1BBU A;  1BIB A;  3NEN A;  3M4P A;  3RKY A;  1SET A;  1USY A;  2ZGW A;  4H2V A;  3RKW A;  4UP8 A;  4Q15 A;  4H2X A;  3FJP A;  4P75 C;  3QO5 A;  3L4G A;  5HGQ A;  3HXU A;  2J3M A;  3IG2 A;  4YRQ A;  2RHQ A;  3HXW A;  4H2S A;  3REU A;  3R07 A;  1SES A;  3RAC A;  4CH5 A;  3CMQ A;  4XTY A;  1JJC B;  4XU0 A;  4ZIB A;  1LYL A;  4RQF A;  2E65 A;  1HC7 A;  4WJ3 M;  1E24 A;  2P0L A;  3IKM B;  1QF6 A;  4P3O A;  1Z7N A;  2DXU A;  1IL2 A;  4YCW A;  1NJ6 A;  3A31 A;  2EJG A;  1PYS B;  3W3S A;  2DQ3 A;  2E41 A;  3A7U A;  1G5H A;  4CS2 A;  2QHS A;  2ZNI A;  4HWO A;  1H4Q A;  2I4N A;  1X2G A;  1B76 A;  3A5Y A;  2IY5 A;  4TVA A;  4G85 A;  1YB3 A;  3QO7 A;  4YRR A;  2C8M A;  2ART A;  1NYQ A;  1G5I A;  1EVK A;  2ZZE A;  3M4Q A;  4P3P A;  3HFZ B;  1ATI A;  2ZT5 A;  4CH4 A;  2AMC B;  3P8V A;  3RF1 A;  3RL6 A;  4XEM A;  3PCO B;  2ZR3 A;  4YRG A;  2P5I A;  1J5W A;  4P74 A;  4EX5 A;  4HWT A;  2PMF A;  4HWR A;  1SRY A;  3VQV A;  4DPG A;  3HXY A;  4YRC A;  2I4M A;  1EVL A;  5C53 B;  3WQZ A;  5C52 B;  4YRJ A;  1WQW A;  4RDX A;  4KQE A;  4CH6 A;  4KR2 A;  2Q7H A;  1NJ8 A;  2DTI A;  1WQ7 A;  1L0W A;  3G1Z A;  1WYD A;  4XU2 A;  1KMM A;  4YRM A;  4YRO A;  4E51 A;  3NET A;  1X54 A;  2C7I A;  3OD1 A;  2DVE A;  3TEH B;  4YRE A;  3IAL A;  1EOV A;  1KOG A;  4ZTU B;  1H4V B;  2IY5 B;  4TVA B;  5K1P A;  2Q5I A;  4NCX A;  4YRK A;  3HFZ A;  4YP0 A;  2DDZ A;  3V7S A;  3HFV A;  2AMC A;  2I4O A;  1ADY A;  2Q7E A;  3TEG A;  4XTV A;  3PCO A;  1W66 A;  4TVW A;  4OLF A;  4P74 C;  2Q5H A;  4H2T A;  4TQF A;  4G84 A;  1X55 A;  3HY1 A;  4UP9 A;  4H2Y A;  1FYF A;  2I4L A;  4BW9 A;  2ZT6 A;  4YDQ A;  1KMN A;  2DQ0 A;  2ARU A;  2J3L A;  4LNS A;  2DTO A;  3A7A A;  1EIY B;  4Q6G A;  2Q7G A;  1WLE A;  4CS4 A;  2RHS B;  4KR3 A;  1USY C;  2ZR2 A;  4YYE A;  4P3N A;  4X5O A;  3TEH A;  1B70 B;  1EQR A;  2E64 A;  4YRF A;  4YCV A;  4YRN A;  2E5A A;  4H2U A;  3MEY A;  4P72 A;  3L2Z A;  1E22 A;  1WU7 A;  3EFR A;  1VQZ A;  4YPF A;  3BFM A;  3HXX A;  1H4S A;  4XEO A;  3LSQ A;  2ZIN A;  3HTZ A;  1YFR A;  2ZIM A;  2QHU A;  3MF2 A;  3V8K A;  3IKL A;  3HRK A;  4XU1 A;  4TVY A;  1NJ2 A;  2ZT7 A;  3BJU A;  2ZIO A;  3I7F A;  4P75 A;  11AS A;  3A7R A;  4K88 A;  3A5Z A;  3HXV A;  2ZXF A;  3ERR A;  4CH3 A;  1EIY A;  1NNH A;  1RIQ A;  2EJF A;  2RHS A;  4PG3 A;  2CIM A;  3VQY A;  4RQE A;  1B70 A;  3VQX A;  2ZTG A;  3DSQ A;  1WNL A;  4YRL A;  2ALY B;  1NJ1 A;  2ZNJ A;  4YCU A;  4UP7 A;  4P73 A;  4TWA A;  1WPY A;  4RMF A;  4XTW A;  2HNI A;  3KFU A;  1G51 A;  1BIA A;  1E1T A;  2FYK A;  4OP0 A;  2PME A;  4WI1 A;  1YGB A;  3QNE A;  3UH0 A;  4P71 A;  1YFT A;  2DU5 A;  3PZC A;  3HXZ A;  3RKX A;  1B7Y A;  2ZZF A;  5E3I A;  4YRP A;  2DEQ A;  2EJ9 A;  3P8Y A;  3NEL A;  2E10 A;  1EFW A;  5F5W A;  1YFS A;  2G4C A;  3HRI A;  1ADJ A;  1E1O A;  2DTH A;  4HVC A;  2ODR C;  1Z7M A;  12AS A;  2ZCE A;  1X56 A;  3V8J A;  3QO8 A;  3RUX A;  2DJZ A;  4AH6 A;  3NEM A;  1BBW A;  2EL9 A;  3V8L A;  4CS3 A;  1ASZ A;  2ALY A;  1B8A A;  2CGH A;  4P73 C;  2QHT A;  4K87 A;  1QE0 A;  2ZZG A;  4HWS A;  2DZ9 A;  4WJ4 A;  4YRT A;  2CJ9 A;  2DKG A;  4H2W A;  1NJ5 A;  3VQW A;  3RIR A;  2E1H A;  3HY0 A;  4O2D A;  3E9H A;  2AKW B;  3LSS A;  4HWP A;  3RGL A; 
#chains in the Genus database with same CATH topology
 4BWA A;  3TUP A;  1ORQ C;  3RFR A;  1URF A;  3CRQ A;  3FB8 C;  3LDD A;  4XTZ A;  2JK5 C;  4N21 A;  4GKK B;  1MG1 A;  2RQ6 A;  2AZ2 A;  2RCV A;  3JD0 A;  3N2G A;  2DXT A;  5K1X A;  2EWN A;  3ZMS A;  1W0J G;  1VF5 B;  2N05 A;  1XHZ A;  1MZE A;  1D5A A;  5IJ9 B;  3APQ A;  3BRC A;  1H4T A;  2V7Q G;  1F7Y A;  1X4T A;  4F6R A;  4FZ0 A;  1K4D C;  4UXN A;  4QPK A;  3E86 A;  2LFR A;  5ELN A;  4LBE C;  2WA3 A;  4NTW A;  3LDC A;  1GN3 A;  2OTJ V;  4EO4 A;  5LGT A;  1O9H A;  2XAJ A;  1JJC A;  3CD6 V;  3ETG A;  4NTY A;  5J2T A;  3K08 A;  4BR6 A;  1RPR A;  3A74 A;  1E1R G;  4UVB A;  4K86 A;  2E3C A;  1ZL8 B;  4P72 C;  1FKA O;  1P84 F;  1GO3 F;  1OCR C;  4JTA B;  4LF5 O;  3K06 A;  2ARS A;  4XDK A;  1NH2 B;  1BHB A;  4L87 A;  2YEV B;  2DZC A;  3RWR D;  4J7J A;  1Q8I A;  1R1B A;  3E9I A;  1RSO A;  4JF3 A;  3FYI B;  3E83 A;  4J15 A;  1US6 A;  5JQG A;  3WG7 B;  1J5E O;  1U96 A;  3G71 V;  4DV7 B;  3NXS A;  2XTA A;  1QVF U;  4YY3 O;  4BAY A;  4FZ1 A;  5CBH A;  2DOS A;  3ZMU A;  1QQC A;  2A7W A;  3L4G A;  4P9O A;  1IZ3 A;  3JAR A;  2ARH A;  2J3M A;  5LP6 B;  4DR6 O;  2Q0O C;  5IYB O;  2GBO A;  2RN9 A;  3REU A;  2LW7 A;  4GX1 A;  3JCU Z;  4NXN O;  3TK1 A;  2Y0I A;  3CMQ A;  1JJC B;  4XU0 A;  2A0L A;  3W7W A;  4YJ3 A;  1BL8 A;  3IJ4 A;  1LYL A;  1IDS A;  4BIO A;  2P0L A;  3IKM B;  3T1C A;  4P3O A;  1EN6 A;  2DXU A;  2A3Q A;  4K3A A;  1NT2 B;  3ZMV A;  4Z2W A;  2W0X A;  5CA1 A;  3PJS K;  2EJG A;  4I50 A;  4B7E A;  4LF5 B;  3W3S A;  3UCS C;  1YJN V;  3A7U A;  1ZTE A;  4B08 A;  2EZO A;  3MAQ A;  3CRC A;  3FYE B;  5B3S B;  5JQG B;  1VAR A;  1VQL V;  2P7T C;  5LHH A;  3S3W A;  1QU7 A;  5EK0 A;  2DYR B;  3A5Y A;  1MSD A;  2IY5 A;  4TOI A;  4TVA A;  4OX9 O;  1ARO P;  1J5E B;  1F51 A;  2F66 C;  2Y0P A;  2OYQ A;  1PM9 A;  1NYQ A;  1R3K C;  5A2Q N;  1I7F A;  3M4Q A;  2ETN A;  3HFZ B;  4YY3 B;  2ZT5 A;  4CH4 A;  2F93 B;  1CPY A;  1NU1 H;  2OCC B;  3OMN B;  3CE2 A;  1IBM O;  4A5U B;  1YZB A;  3PCO B;  2WAM A;  2ZR3 A;  4TSF G;  4YRG A;  3SYA A;  2P5I A;  2UXN A;  1M57 B;  2BOB C;  1J5W A;  4DR6 B;  4EX5 A;  1JCH A;  4GT1 A;  4DV6 O;  4TV9 B;  2ADQ B;  1SQQ H;  4NTX A;  2F4V O;  3RYF A;  4I5S A;  4G2K A;  3M8A A;  4LVK A;  3W7U A;  4NXN B;  3HXY A;  1FYJ A;  2HFE C;  2I4M A;  2IM9 A;  3WQZ A;  1AR4 A;  1GRJ A;  2GUZ A;  1S5H C;  4QJF B;  4YRJ A;  3WG7 C;  4KQE A;  4CH6 A;  4KR2 A;  2MK3 A;  4RAI A;  1NJ8 A;  2DTI A;  4FLV A;  3G1Z A;  4FLU A;  1WYD A;  1KMM A;  4YRM A;  4YRO A;  5LMN O;  1X54 A;  2QKC A;  2C7I A;  4FK5 C;  2ZQM A;  2DWD C;  3TEH B;  1QLN A;  1NH2 D;  2JGU A;  2OIG A;  4UCV A;  3IAL A;  4YIP A;  3BY6 A;  4LR3 A;  5LP6 C;  1IX9 A;  1Y66 A;  4WFE A;  2IY5 B;  4TVA B;  3K5L A;  5A9G A;  1ZUQ A;  3E8H A;  2Q5I A;  3ETE A;  2JIZ G;  4YRK A;  4PA6 A;  1JFF A;  3RW0 A;  4U7N A;  3JSL A;  5B66 Z;  4GX2 A;  2DW4 A;  1ADY A;  2Q7E A;  3TEG A;  4O4J A;  1SF9 A;  3UT5 A;  4TVW A;  4P74 C;  3THO A;  3OUS A;  4H2T A;  1YHQ V;  1SQV H;  4TQF A;  1DTO A;  5JVD B;  4R50 A;  1VQ4 V;  4G84 A;  1X55 A;  3HY1 A;  2BTO A;  5EBM C;  2LW1 A;  1IBM B;  1M9N A;  1PNM A;  1L0L H;  1KMN A;  2ARU A;  1QNM A;  3APO A;  1Q3E A;  4TT3 G;  2BSK A;  1DF4 A;  3B4S A;  4DV6 B;  4X1Y B;  5B3S C;  2F4V B;  1YF2 A;  3C3S A;  4FVM A;  2FB5 A;  3E8F A;  4ZKI A;  2UUB O;  2UXD O;  2DYR C;  3G6E V;  1EQR A;  2E64 A;  3GB7 C;  1F23 A;  3E89 A;  1FXK A;  1G8M A;  1LUW A;  1PL4 A;  1YVW A;  2ZDI A;  3S3X A;  3EFR A;  4DR4 O;  2D2C B;  4YPF A;  1K92 A;  1KKD A;  5LMN B;  3P3P A;  5IYZ A;  2OCC C;  1KEC A;  4ABM A;  3TXS A;  5LA6 B;  1ZLZ A;  4WFA V;  1JFF B;  2R72 A;  3ZHS A;  2EJ7 A;  1M57 C;  4I9W A;  3A2F A;  3V8K A;  3IKL A;  3HRK A;  1NJ2 A;  4XDL A;  4O4I B;  1A32 A;  3EXA A;  4NVP A;  3SPJ A;  4U3F H;  4K88 A;  1R3L C;  3HXV A;  4PA3 A;  4G28 B;  3OE7 G;  4CH3 A;  1EIY A;  1BQ0 A;  2JRI A;  3QVN A;  2YIB D;  4DW0 A;  3RYC B;  1K3E A;  2BSK B;  4HNA A;  1RM1 B;  2ODM A;  1K5Q A;  1B70 A;  3DGE A;  2HR3 A;  3DSQ A;  1VMG A;  2DE0 X;  1FFT B;  2Y4U A;  1GMG A;  3ZHV A;  3CC7 V;  4FMT A;  2RMK B;  2YI9 A;  4DK0 A;  3FD9 A;  1AIL A;  4P73 A;  2MW2 B;  4YXW G;  5KAF Z;  1XMQ O;  4TWA A;  1IVS A;  1WAZ A;  2UUB B;  4PJ0 Z;  2UXD B;  4HBN A;  2YDE A;  1R3I C;  2VS0 A;  3ABT A;  1BIA A;  3F7Y C;  3H1L H;  3QNE A;  1TVK A;  2DU5 A;  4DR4 B;  3R65 A;  1XNQ O;  3T4D A;  1Q6U A;  4B3M O;  5E3I A;  1I08 A;  3ABM B;  3HKB A;  2HVK C;  4YRP A;  3BEH A;  3UO2 A;  2BE3 A;  1HNZ O;  2DEQ A;  4PEL A;  1EFW A;  3P30 A;  3SPI A;  2WLK A;  4I55 B;  1UPG A;  3EHB B;  4LFB O;  3UKM A;  4E4E A;  5LOV A;  1EFR G;  1J95 A;  2R9R B;  4BW5 A;  1X56 A;  4LH7 A;  3RUX A;  2DJZ A;  4I4T A;  4AH6 A;  1FD9 A;  1Z5W A;  1K7D A;  4CS3 A;  1B8A A;  5L3G A;  4HNA B;  1OCO B;  1YSC A;  3RYI B;  5JH7 A;  5E1A C;  4JI4 O;  1MMM A;  2IBZ H;  4YJ2 B;  1JR9 A;  4J7Z A;  3ZJZ A;  4AIL C;  2JS5 A;  2P4V A;  3D8C A;  2CJ9 A;  2DKG A;  3OTO O;  2QA4 V;  1EZJ A;  1V54 B;  2AKW B;  1Q7Y W;  3ZHR A;  3VOU A;  5ITZ A;  2QE7 G;  3W7X A;  3RGL A;  1PNK A;  2AW9 A;  4LWS B;  3K3W A;  3ZED A;  5KMG B;  5JWP A;  4YRI A;  4DV4 O;  5BR8 O;  1HTT A;  1XMQ B;  3P8T A;  3CCL V;  3I55 V;  4X1K B;  1PL0 A;  4XTX A;  1X01 A;  4LVL A;  1EM1 A;  5EC2 C;  1H8E G;  3OEH G;  1Q90 D;  5L3B A;  3ASO B;  3K04 A;  3UFG A;  4H2X B;  3HKB B;  4QNH B;  3SYO A;  1C0A A;  4PHC A;  3Q4H B;  1XNQ B;  4H02 A;  1Y74 A;  4GX0 A;  5J2U A;  1XQ8 A;  4B3M B;  1RM1 C;  4TUY A;  1XRE A;  1Y76 A;  5JJJ B;  4QGP A;  2NN4 A;  5LOV B;  2RHQ B;  1HNZ B;  3CCS V;  3HKC B;  3DXR B;  1BE3 H;  4LFB B;  2CH7 A;  2Y69 B;  2A79 B;  5H5N A;  4CBC A;  1WN7 A;  1NYR A;  1M56 B;  4U7O A;  2CJB A;  3G4S V;  4WF2 A;  3MHS C;  2XGT A;  1GGM A;  3L9D A;  4C7U A;  2AXT Z;  3LC0 A;  3UGQ A;  1PYS A;  1PPJ H;  4JI4 B;  1N9W A;  3A0B Z;  3VBB A;  3EFS A;  3MF1 A;  1BS3 A;  2QJ1 A;  1R6K A;  3ABM C;  1SA0 A;  3RKY A;  3OTO B;  1USY A;  1XL6 A;  3NR7 A;  4MVO A;  4Q15 A;  4DV4 B;  2FTK A;  2A06 H;  2CTW A;  5BR8 B;  2Y4T A;  1XOU A;  1D5N A;  3SPG A;  3CPW U;  4JV5 O;  1ENV A;  3OAA G;  1CXZ B;  3FX7 A;  4PA7 A;  5KHH A;  3HXW A;  2Z3Y A;  4H2S A;  2Q9L A;  2C2A A;  1OCO C;  4TUY B;  2IH1 C;  5CN0 A;  4CH5 A;  3B2E E;  4XTY A;  2QWR B;  5C93 A;  1V54 C;  3OM3 B;  1EN4 A;  4ZIB A;  4WJ3 M;  2ZXW B;  1VF7 A;  2YEV A;  3FB7 C;  4E2L A;  1OJH A;  4OGQ B;  2ITD C;  1NBM G;  3OUF A;  1H2N A;  2WSS G;  2Q0A A;  3U0Z A;  4BIU A;  1G1X B;  1PYS B;  3RYH A;  1YJ9 V;  2WPD G;  1H38 A;  2AGA A;  3AG4 B;  3BPZ A;  2QHS A;  5GTI Z;  3L75 H;  2FKX A;  3ASO C;  2E76 B;  1SA0 B;  2I4N A;  2ATK C;  1B76 A;  3MHH C;  3O65 A;  4G85 A;  4WBN B;  2QTO A;  4DV0 O;  1YB3 A;  3CCR V;  3G80 A;  3QO7 A;  1OCZ B;  4YRR A;  2JJ2 G;  1KMI Z;  5CBG A;  2C8M A;  2AHZ A;  1N33 O;  5LP6 A;  1HP8 A;  4O2B B;  2OIE A;  2GV9 A;  5EC1 C;  3E35 A;  2Y69 C;  4NB5 A;  1ATI A;  4AQY O;  1MZF A;  4FM2 A;  2AMC B;  1KC8 W;  1M56 C;  1S77 D;  3RF1 A;  3RL6 A;  2K9P A;  3BA8 A;  4PDR A;  4JV5 B;  4OPA A;  2ZE8 A;  4IT5 A;  4EFE A;  4P74 A;  4PDL A;  1CEZ A;  2PMF A;  4X8A A;  4HWR A;  4MVZ A;  2XAF A;  1GK9 A;  1VF6 C;  1FXV A;  4DPG A;  1PKX A;  2F95 B;  5C53 B;  4JTD B;  2UXB O;  4MTG A;  2X6A A;  3ZRW B;  4QE7 A;  2Q7H A;  3F5T A;  3ZBH A;  1YI2 V;  1AI6 A;  3I5D A;  2XAS A;  1L0W A;  3RYH B;  4XU2 A;  2QTS A;  4E51 A;  3OD1 A;  4KL1 A;  1UFI A;  4JYA O;  1WPB A;  3KCX A;  1HNX O;  2RJZ A;  1EOV A;  2NS6 A;  1KOG A;  3CC2 V;  4ZTU B;  5TIS Z;  1AP6 A;  1BHA A;  5EIB C;  1AI7 A;  5JCO A;  2XHB A;  4JI7 O;  4IYI A;  3SJQ C;  1KP2 A;  4DR5 O;  3SYP A;  1HR0 O;  1H4V B;  3AG7 A;  5EZY B;  1Q43 A;  1Q5O A;  4UCO A;  4MW8 A;  4NCX A;  3CX5 F;  3HFZ A;  4YP0 A;  1VQK V;  3K03 A;  4FM0 A;  2Q67 A;  3V7S A;  2CE4 A;  3J81 N;  2XUM A;  2I4O A;  2YIB A;  1MA1 A;  1H8H G;  5L3E A;  4KUM A;  4DV0 B;  2HHH O;  3PCO A;  1N33 B;  3DC6 A;  2WLI B;  4Q20 A;  2ZXW C;  2JGD B;  3P3N A;  5LXT A;  2UXC O;  4TV9 A;  3K0D A;  5FLX N;  4AQY B;  1JJ2 U;  3E22 A;  4N23 A;  4DV5 O;  4UP9 A;  5EIB D;  4O4L B;  1TAE A;  4YHH O;  4H2Y A;  1FYF A;  2I4L A;  3WFV A;  2DQ0 A;  3ICX A;  2W6J G;  1XI1 A;  3AG4 C;  2GTA A;  3H1I H;  5JJE B;  2X6B A;  1WLE A;  4CS4 A;  2E75 B;  2RHS B;  1USY C;  4DR3 O;  2ZR2 A;  3J80 N;  3TEH A;  4FLY A;  2UXB B;  1QCE A;  2O57 A;  4JAV A;  4DV3 O;  4YRF A;  1K9M W;  2Z0A A;  1OCZ C;  1VQ8 V;  3MEY A;  3L2Z A;  2JEU A;  2P5O A;  4Z1V A;  3N2K A;  3BFM A;  4HYO A;  1PP9 H;  4FLT A;  5KUM A;  5AG2 A;  4JYA B;  3GVM A;  5LHI A;  4R8C A;  2IJJ A;  3E8G A;  1HNX B;  3ZHU A;  1KQS U;  1Q81 W;  4JI7 B;  3KKY A;  4DR5 B;  1HR0 B;  2YIA A;  5GON B;  2Y48 A;  4TVY A;  5JVD A;  2UUC O;  2ADP A;  4JAA A;  3JCZ A;  2QR4 A;  2G38 A;  3CME V;  2ZIO A;  3L71 H;  3DC5 A;  4UCR A;  3AK3 A;  5LXT B;  1IBK O;  1P49 A;  4B7K A;  4P75 A;  2LO1 A;  2QWQ B;  11AS A;  2QM7 A;  1IUR A;  2HHH B;  1JMK C;  3E22 B;  1KBH A;  4X1I B;  4J80 A;  1N0J A;  2ZXF A;  3F7V C;  4X1Y A;  2UXC B;  1NNH A;  1RIQ A;  3E2E A;  4LVI A;  1YTF B;  1DGS A;  4DV5 B;  4I7Z B;  1BZK A;  4MTX A;  4YHH B;  2CIM A;  3VQX A;  4RQE A;  2Q73 A;  1NZ6 A;  1GM9 A;  3JD1 A;  4K8X A;  4YRL A;  2ALY B;  1NJ1 A;  4FLW A;  1SKV A;  4YCU A;  4LNU A;  1QVG U;  5IE9 A;  1NI8 A;  1XDC A;  1AR1 B;  2VQF O;  4KFM A;  4XTW A;  4DR3 B;  1BMF G;  1V55 B;  4JI3 O;  4DR7 O;  3AK2 A;  3N2K B;  4DV3 B;  1G51 A;  1E1T A;  2PME A;  5LA6 A;  3FKS G;  4PV1 B;  3UH0 A;  2IJH A;  5DN6 G;  2B1G A;  1K97 A;  3HXZ A;  2Q4P A;  4UV9 A;  5IYD O;  5DEC A;  5BZB A;  2ZZF A;  3JAS B;  4DK1 A;  1BGY H;  4DR1 O;  4O4I A;  4MSW C;  1JX9 A;  3BA9 A;  1DK1 A;  3D3Q A;  2EJ9 A;  3NEL A;  2H94 A;  2IJK A;  3G67 A;  5F5W A;  4X88 A;  1RP3 B;  3IFX A;  1YFS A;  2XAQ A;  3B77 A;  3HRI A;  4IIJ B;  4PA4 A;  4NKG B;  4DR2 O;  2ODR C;  1K33 A;  4JI1 O;  12AS A;  1VQ7 V;  2ZCE A;  5LHG A;  2UUC B;  2PI4 A;  3RYC A;  5H6Q A;  3JAK A;  4EKW A;  1FJG O;  3NEM A;  3HR0 A;  1BBW A;  3ZN0 A;  2FL4 A;  1IBK B;  2PTM A;  2EL9 A;  3V8L A;  1B3Q A;  4ICG A;  1COW G;  4B3S O;  2QHT A;  1P7B A;  3CB2 A;  3OGI B;  1JQ0 A;  4MTO A;  2ZE7 A;  1QE0 A;  2ZZG A;  4UVA A;  3LSU A;  2B5U A;  5HFM A;  3D3I A;  4QIW F;  4I9Q A;  4DRX B;  4JYY A;  5JCO C;  2PYL A;  4LNU B;  5KAI Z;  3RIR A;  2LP7 A;  2E1H A;  2H8P C;  3PN1 A;  3U10 A;  3E8B A;  3V7C A;  4P71 C;  1CP9 A;  2ODR D;  3QTC A;  4XTU A;  1T5E A;  5LGU A;  1GTO A;  2P06 A;  2VQF B;  1JA8 A;  4J7K A;  2YID A;  3CXC U;  4TTV A;  2BCC H;  2QWO B;  4JI3 B;  4DR7 B;  1YDX A;  3UGT A;  5KUK A;  2DU7 A;  2PUS A;  3RT3 C;  1I5Y A;  1S3J A;  3L72 H;  4I55 A;  4X64 O;  2VWJ A;  2FML A;  1S5L Z;  1WB8 A;  5FPO A;  2LJ2 A;  2KG7 B;  4I0X A;  3A32 A;  4DR1 B;  4MVS A;  1L8D A;  1Z2G A;  3K79 A;  1Q86 W;  2WWW A;  2XTI A;  5IJ0 B;  2QHV A;  1ZX3 A;  2UUA O;  4JI6 O;  1XIL A;  5IWA O;  5EYP B;  4ZHQ A;  3JAK B;  1FAF A;  2ZT8 A;  3RYI A;  1I94 O;  1JOY A;  1TUE B;  3EVK A;  1WPX A;  4YJ2 A;  4DR2 B;  4JI1 B;  4PDV A;  4JI2 O;  3FAV A;  4NYK A;  1QBZ A;  1V55 C;  3D36 A;  1FJG B;  4ZTZ B;  2AKW A;  4JPR A;  1HXD A;  1N32 O;  2HJD A;  4KHP O;  4B3S B;  4LWS A;  5KMG A;  1Q6I A;  1YTF D;  1AR5 A;  4AI8 A;  4WCE V;  1GN6 A;  1LR1 A;  1H2M A;  4O4H B;  4JYB A;  2D3O W;  2EIN B;  2EIM B;  1BBU A;  3NEN A;  3ZS8 C;  4X1K A;  3M4P A;  1M93 A;  1SET A;  3CHX A;  1XUQ A;  1GM8 A;  2YS8 A;  4J42 A;  4H2V A;  3RKW A;  4CC6 A;  3JAT B;  3ZMZ A;  1VQP V;  4UP8 A;  1SZX A;  2UXX A;  2CGN A;  4H2X A;  2XAH A;  2P90 A;  4RWU A;  2LGQ A;  2LQT A;  3FJP A;  4P75 C;  3Q4H A;  3QO5 A;  2P67 A;  5C8Y B;  1P7G A;  1GAX A;  2X6C A;  1S72 V;  3JAM N;  3ETQ A;  5HGQ A;  3SYQ A;  2RHQ A;  5E79 Z;  2OT5 A;  3HKC A;  4KP4 A;  4I0X B;  3DXR A;  4X64 B;  5EBW C;  4JI0 O;  3A8T A;  1K8A W;  1SES A;  4WFG A;  1NR1 A;  2V4D A;  5J9P C;  4ZHQ B;  4PHZ A;  3AG2 B;  2UUA B;  4JI6 B;  3HKE B;  5KA5 A;  4P2Z A;  1HC7 A;  4LF7 O;  3SGI A;  5IWA B;  1QF6 A;  3FAV B;  1IL2 A;  4YCW A;  1I94 B;  1VF6 A;  1XMO O;  3FB6 C;  3A31 A;  4JI2 B;  4EB6 A;  1SC5 B;  3ML0 A;  5D5Q A;  3GWK C;  2E41 A;  1G5H A;  3T2M A;  4UB6 Z;  1N32 B;  1PV0 A;  4JGS A;  4KHP B;  2ITC C;  3B40 A;  3I56 V;  2PZS A;  1V9P A;  2X7R B;  3RVY A;  4ZOL A;  1VQN V;  1GH6 A;  1K34 A;  4WFH A;  1X2G A;  2CAZ C;  2GHY A;  2ART A;  2JEX A;  1K73 W;  4J9Y B;  2JDI G;  3JAL B;  5CA0 B;  5CA3 A;  2ZZE A;  4P3P A;  2M7W A;  2E74 B;  2EX3 A;  1NS1 A;  1Y4M A;  5B5E Z;  4XEM A;  1R3J C;  1O9G A;  1H2S B;  4F6E A;  1ZWI C;  5LL6 Y;  2R9A A;  4K0K O;  2HG5 C;  1NJI W;  2Z5U A;  4HWT A;  3ZHQ A;  5F2V O;  3TGU H;  3IC7 A;  1WP7 A;  5IY5 B;  1SRY A;  3VQV A;  3K9A A;  2P22 C;  4JI0 B;  2N74 A;  1QHT A;  2EIN C;  2EIM C;  4JI5 O;  4YRC A;  3RGB A;  1EVL A;  1NVP B;  1VQ6 V;  5C52 B;  1WQW A;  4OXS A;  3CRM A;  4RDX A;  4WFB V;  2DWE C;  1E79 G;  1FPO A;  2IH3 C;  2F1M A;  3HKD A;  3CCQ V;  2A8E A;  3H01 A;  5L3F A;  1N34 O;  3ABK B;  4LF7 B;  1WQ7 A;  4EB6 B;  4K8Z A;  1SQG A;  3O9O A;  2DVE A;  1AP5 A;  3TJT A;  1XMO B;  1LNQ A;  3SJC C;  3WB2 A;  2HEP A;  3AG1 B;  2HVJ C;  3BAB A;  1KU9 A;  2R70 A;  3C90 A;  4PA9 A;  4ZOL B;  4WBN A;  1GN4 A;  2IJI A;  2WLM A;  4FIP C;  2Q5Z A;  3OMI B;  4LC1 A;  4O2B A;  2Q8V A;  3L73 H;  1HNW O;  4RO2 A;  4J9Z B;  2Q6A A;  2L6L A;  2AMC A;  1SQX H;  4DUZ O;  5H2F Z;  3CS5 A;  1NTK H;  5D5P A;  3B8M A;  4XTV A;  3AG2 C;  4UVC A;  5L3D A;  1YIT V;  1TGO A;  4FLZ A;  4OLF A;  4DV2 O;  2YI8 A;  4CZZ A;  4TWK A;  3K58 A;  3D36 C;  1H2L A;  5LBQ A;  2W0F C;  3K57 A;  3L70 H;  2ILM A;  3QF7 A;  4PI2 A;  4BW9 A;  3OEE G;  4P9P A;  3CCE V;  4K0K B;  3WB0 A;  1XHX A;  3W7T A;  3ZRW A;  1Q6H A;  2CTP A;  3OMA B;  2J3L A;  3RVZ A;  4LNS A;  2DTO A;  2P4K A;  1M90 W;  3A7A A;  4J11 A;  2Q7G A;  2DJV A;  2X0L A;  2E5L O;  4F4L A;  3HKD B;  4QE9 A;  3CCV V;  4LP8 A;  4G27 B;  4YYE A;  4JI5 B;  5B1A B;  4YCV A;  4YRN A;  5JJN B;  2JVD A;  1E22 A;  1N34 B;  2N04 A;  3SDL A;  1B6Q A;  4IHJ B;  3K5O A;  5EZY A;  4GZR B;  5FNV B;  1H4S A;  5KX5 B;  4XEO A;  3K9S A;  5B1N A;  1VQM V;  2CTR A;  4IL6 Z;  2HLD G;  2VWK A;  1AI4 A;  2ZIM A;  2H3O A;  2QHU A;  1D2D A;  2WLI A;  1IBL O;  2JS3 A;  5IYC O;  2CDY A;  1SZT A;  3H1J H;  2JGD A;  5IY5 C;  4LF8 O;  1HNW B;  2HJF C;  2ZT7 A;  3BJU A;  4MVM A;  3WB1 A;  4EFB A;  4O4L A;  4UCU A;  4DUZ B;  3I7F A;  1L0N H;  2EZP A;  4GCZ A;  4ZBM A;  3A5Z A;  4DV2 B;  3ABK C;  3CJH A;  2GDS A;  3LUT B;  1MSW D;  1YXB A;  2NNU A;  2EJF A;  3P32 A;  2RHS A;  1K5S A;  1NTM H;  3JD2 A;  3OTF A;  3ZN1 A;  3AG1 C;  1BSM A;  3VQY A;  2ZTG A;  1WNL A;  1VQ5 V;  1AI5 A;  2QKA A;  2PF4 E;  3TET A;  3JYC A;  4UP7 A;  3CEI A;  3IC9 A;  4X89 A;  1M4U A;  1WPY A;  4FFB A;  2F23 A;  3UO3 A;  1NVP D;  2E5L B;  4ZI7 A;  2ZKO A;  4U3J A;  1NTZ H;  1QLE B;  2ZM6 O;  4LFA O;  3KZI Z;  4D7T A;  4OP0 A;  3GWO A;  4JZG A;  1YGB A;  4P71 A;  4TV8 A;  5H9C A;  5GON A;  3SYC A;  1EZV H;  3PZC A;  1YEW A;  4PDM A;  5EBL C;  4DV1 O;  1KD1 W;  1B7Y A;  5KLV H;  4OPH A;  4PD4 F;  5CMU A;  2RDC A;  5LGN A;  3N2G B;  1FXH A;  2EJR A;  2M6Y A;  4WF9 V;  1NR7 A;  4HAM A;  4X1I A;  1IBL B;  2G4C A;  1VIB A;  1G4Y B;  4DO2 A;  3BAA A;  5CB4 A;  1QR8 A;  4F6R B;  4LF8 B;  4HVC A;  4MW3 A;  1Z7M A;  3V8J A;  1KKC A;  3QO8 A;  2CUG A;  3H1K H;  5B1A C;  3CJH B;  4ASU G;  4YIO A;  5DED A;  3SR2 C;  2ALY A;  1AJQ A;  3OR7 C;  2CGH A;  4K35 A;  5J2T B;  4K87 A;  2KKW A;  1JJO A;  4UCS A;  4HWS A;  2QSA A;  1GN2 A;  4H2W A;  1TUB A;  1LUV A;  2YSU B;  2XOK G;  4MVQ A;  1YCI A;  3B8N A;  4HWP A;  1QR9 A;  4FFB B;  3OW2 U;  4ZI7 B;  3L1A A;  1M5I A;  4U3J B;  1RFY A;  4LFC O;  1SER A;  4J41 A;  5KNN A;  1RSO B;  1Y6X A;  1WJZ A;  4DQ2 A;  2ZM6 B;  4GUN A;  3JAS A;  4MVR A;  4TV8 B;  4YRS A;  4TQD A;  3F5W C;  3FB5 C;  4PI0 A;  2YXL A;  4UCT A;  4LFA B;  3V7R A;  5KA6 A;  1M1K W;  1WNS A;  5CBF A;  1B7Y B;  3ETD A;  3HPL C;  3CWB H;  4IIJ A;  3ZRS A;  1BCC H;  4GKJ O;  4DV1 B;  1ASY A;  2QWN B;  1B06 A;  2XT9 A;  2CJA A;  1X2H A;  4FM1 A;  3L4G B;  1R73 A;  1GKF A;  1TA8 A;  4B3R O;  3JAR B;  1AB3 A;  5CB4 B;  1EN5 A;  3T1Y O;  1OCC B;  4JTC B;  5C51 B;  4O2A A;  1F4N A;  2FYU H;  1XEQ A;  4EEQ A;  3CXH F;  3SJA C;  2EAY A;  4HA8 A;  4X65 O;  1FFX A;  4B3T O;  5ELO A;  1I5X A;  4DRX A;  2IU3 A;  1AJN A;  1QLE C;  2YXY A;  5FL7 G;  1XBL A;  2EIJ B;  1X59 A;  5LYJ A;  1YJW V;  4XU3 A;  4YJ3 B;  2Q68 A;  3JD4 A;  3JSN A;  3MQZ A;  3ICA A;  3REX A;  3JD3 A;  4UPA A;  4JYC A;  2PYJ A;  2WLL A;  1N0N A;  1TUB B;  3K0G A;  3U11 A;  5CA1 B;  1BIB A;  4I50 B;  5KHG A;  3QG5 A;  5KHJ A;  3RN4 A;  1AVM A;  5HFL A;  4W4K A;  2ZGW A;  3SPC A;  2WLJ A;  4LFC B;  3BVO A;  4X62 O;  4J10 A;  4LH6 A;  1BT8 A;  4LVM A;  3K5N A;  2KG7 A;  2YXH A;  4IGG A;  1KB9 F;  3CRA A;  3UM7 A;  3W7S A;  1H2K A;  4BIZ A;  3HXU A;  5IJ0 A;  3IG2 A;  1VQO V;  4YRQ A;  2HP8 A;  3A0H Z;  4OX9 B;  5EYP A;  3R07 A;  3EFF K;  2AHY A;  4JI8 O;  4GKJ B;  2CGO A;  4FJC C;  3RAC A;  4O2A B;  1S5J A;  3KCY A;  3C3T A;  4B3R B;  2DYS B;  1FS0 G;  1FFX B;  2IU0 A;  3CSX A;  3T1Y B;  4RQF A;  2E65 A;  1E24 A;  4MVU A;  4GX5 A;  3X2Q B;  4H37 A;  3RYF B;  5LYJ B;  1Z7N A;  3CP1 A;  3BFR A;  3T4Z A;  1SS3 A;  4X65 B;  2KQX A;  2KB1 A;  2QDO A;  4B3T B;  2YUA A;  4O4H A;  1NJ6 A;  2GUZ B;  1HW7 A;  1P4R A;  2WLL B;  2LGW A;  3R66 A;  2DQ3 A;  1NKD A;  3MDS A;  4CS2 A;  4DUY O;  5B1O A;  1W59 A;  2WLH A;  2ZNI A;  4HWO A;  1H4Q A;  3JAT A;  5BXZ A;  3ASN B;  4NXM O;  1OHH G;  4XDJ A;  5KHI A;  3MD0 A;  1OV9 A;  1DF5 A;  2OCH A;  3B09 A;  3M99 B;  4KXR A;  5C8Y A;  1SQF A;  4LF4 O;  1S76 D;  4RUF A;  5L3C A;  2VQE O;  4X9Q A;  1VEW A;  1IXM A;  1OZ0 A;  1WB7 A;  1XL4 A;  3ABL B;  3AG3 B;  1OCC C;  1GM7 A;  1SQB H;  2CTQ A;  5IDJ A;  3A0R A;  4H0L B;  1G5I A;  3CCM V;  1EVK A;  1ZAU A;  4R7C A;  2XND G;  4LCU C;  2HKO A;  2JJ1 G;  5B1B B;  4X62 B;  3LNM B;  1Y67 A;  3IGA C;  2DN9 A;  2W6I G;  4L8J A;  4D6T H;  3P8V A;  4DXW A;  4O4J B;  2EIJ C;  2V1D A;  1YIJ V;  3UT5 B;  3OD4 A;  1W2B U;  3TCU A;  3OGC C;  3T1H O;  2RNB A;  1WA8 A;  3HKE A;  5BY1 A;  2EIK B;  1L1F A;  2ZT9 B;  2KSD A;  3TXQ A;  1N36 O;  1G6U A;  4JI8 B;  2UU9 O;  5GTH Z;  1MNG A;  4GYC B;  1SQP H;  2NR5 A;  1DLB A;  1I0H A;  1HWY A;  1U97 A;  3ABU A;  3CCJ V;  4FLX A;  2EIL B;  3KG2 A;  1PNL A;  2GSM B;  3CCU V;  4AHC A;  3NET A;  3BHP A;  4LF9 O;  4YRE A;  2QM4 A;  4CC5 A;  1FXK B;  4DUY B;  4WFF A;  1E1Q G;  3JAL A;  5K1P A;  2Q69 A;  5CA0 A;  2QEX V;  4NXM B;  5IYZ B;  2DDZ A;  3HFV A;  3ZCC A;  3IAY A;  4QPJ A;  2GTS A;  2EUL A;  4LF4 B;  2BTQ A;  2VQE B;  3OR6 C;  2DYS C;  1W66 A;  2F43 G;  5KHK A;  4MTF A;  2Q5H A;  3ZIA G;  4D7S A;  3G6B A;  4JZ2 A;  3X2Q C;  4DYL A;  2XAG A;  4HZ3 A;  2CK3 G;  4GLX A;  1WA8 B;  3J7A U;  3CYO A;  2ZD9 A;  2OTL V;  2ZT6 A;  4YDQ A;  1Q82 W;  2ZE5 A;  3T1H B;  3CMA V;  3CC4 V;  2YIC A;  5GW7 A;  1BQZ A;  2IW5 A;  1EIY B;  1VP7 A;  2DMX A;  4Q6G A;  3ASN C;  1N36 B;  1KP3 A;  2AZ0 A;  1K4C C;  4KR3 A;  4H33 A;  1EBO A;  2UU9 B;  3BCC H;  1RPO A;  4P3N A;  4X5O A;  2ZE6 A;  1B70 B;  4P30 A;  2NLJ C;  3N27 A;  1N4C A;  3H1H H;  2E5A A;  1UJW B;  3ZRX A;  4H2U A;  4P72 A;  3ABL C;  4X66 O;  3AG3 C;  4LVJ A;  1WU7 A;  1JPX A;  1VQZ A;  1F4M A;  3H9V A;  4UV8 A;  3HXX A;  3OFN G;  5B1B C;  4X20 A;  2R9I A;  3LSQ A;  5BMV A;  4LF9 B;  2ZIN A;  3STZ C;  1XNR O;  3HTZ A;  3HB3 B;  5H6R A;  4FPP A;  1TVK B;  1YFR A;  3MF2 A;  3SJB C;  2EIK C;  1VQ9 V;  4RUE A;  4XU1 A;  1R6T A;  1H2G A;  3K59 A;  1ROP A;  4H13 B;  3LDE A;  2BTQ B;  1MAB G;  2OWO A;  3WU2 Z;  4MT8 A;  2BOC C;  4JAS A;  3CRR A;  1JVM A;  5LMU O;  3A7R A;  2EIL C;  2A9H A;  5FPR A;  4UB8 Z;  3ERR A;  2YC0 A;  3RBZ A;  4LF6 O;  1KYO F;  2QKS A;  2B1I A;  4I4T B;  5IT9 N;  1HDJ A;  3FFQ A;  4MS2 A;  4PG3 A;  2B9Z A;  3M7M X;  4HT4 A;  1B04 A;  3JAW A;  2WLN A;  2ZNJ A;  1FXK C;  4DW1 A;  2ZDI C;  3DTU B;  5JH7 B;  2PGG A;  4IHJ A;  1MOF A;  1R6N A;  4GKK O;  2WA4 A;  5FNV A;  4RMF A;  5KX5 A;  4JAU A;  1OCR B;  3AK1 A;  1NQT A;  2HNI A;  1W0K G;  3KFU A;  5ITZ B;  1WP8 A;  4Z1M G;  2FYK A;  3LNN A;  4WI1 A;  4X20 B;  4X66 B;  1YFT A;  5BMV B;  2L35 A;  4UUJ C;  2K1E A;  2EBO A;  3RKX A;  1S0V A;  4IYH A;  3ZRV A;  2VRZ A;  3OT7 A;  2P6J A;  2QWP B;  5IJ9 A;  4H44 B;  1XNR B;  2PI5 A;  4XBF A;  2QM8 A;  2QGN A;  3P8Y A;  2E10 A;  2PY5 A;  3UQ8 A;  1ADJ A;  1AJP A;  1E1O A;  2DTH A;  1THZ A;  1Y74 B;  5J2U B;  4W4L A;  1KUQ A;  1Y76 B;  1PD3 A;  1ZL8 A;  1Z5V A;  1ASZ A;  5LMU B;  3AEI A;  1ZSP A;  4FFK A;  4P73 C;  3ZMT A;  2CH7 B;  3SPH A;  4R6Z A;  3ZHT A;  4NR1 A;  5DM6 V;  4LF6 B;  3JAW B;  4UFZ A;  3STL C;  1IXB A;  3K5M A;  2DZ9 A;  4WJ4 A;  1N8R W;  2LFS A;  4YRT A;  3VQW A;  3ZX6 A;  1NJ5 A;  3HY0 A;  4O2D A;  3E9H A;  3LSS A;  3L74 H;  4DV7 O; 
#chains in the Genus database with same CATH homology
 3E8B A;  3OW2 U;  3L1A A;  3K3W A;  4P71 C;  3V7C A;  1ORQ C;  4BWA A;  3TUP A;  1CP9 A;  2ODR D;  4YRI A;  1HTT A;  1SER A;  3QTC A;  3FB8 C;  3LDD A;  4XTU A;  4XTZ A;  5KNN A;  2JK5 C;  3P8T A;  5LGU A;  4N21 A;  3RGL A;  1GTO A;  1MG1 A;  3CCL V;  3I55 V;  1PL0 A;  4XTX A;  1X01 A;  4LVL A;  4DQ2 A;  3CXC U;  4TTV A;  4MVR A;  4YRS A;  5EC2 C;  1H8E G;  4TQD A;  3F5W C;  3FB5 C;  3JD0 A;  3V7R A;  2DXT A;  5KA6 A;  3UGT A;  5K1X A;  5KUK A;  1M1K W;  3OEH G;  5CBF A;  2DU7 A;  2EWN A;  3ZMS A;  1B7Y B;  5L3B A;  1W0J G;  3ETD A;  1I5Y A;  1S3J A;  3ASO B;  3HPL C;  3K04 A;  3UFG A;  4H2X B;  5CBG A;  4QNH B;  3SYO A;  1C0A A;  3ZRS A;  4PHC A;  1H4T A;  2V7Q G;  1ASY A;  4H02 A;  2CJA A;  1K4D C;  4GX0 A;  4UXN A;  1X2H A;  4QPK A;  3A32 A;  1R73 A;  1RM1 C;  3E86 A;  3L4G B;  2LFR A;  1GKF A;  4LBE C;  4MVS A;  5ELN A;  3K79 A;  1Q86 W;  2WWW A;  2XTI A;  3LDC A;  2QHV A;  2RHQ B;  2OTJ V;  4EO4 A;  1OCC B;  5LGT A;  3CCS V;  2XAJ A;  4JTC B;  5C51 B;  1JJC A;  1F4N A;  3CD6 V;  3ETG A;  2ZT8 A;  2Y69 B;  2A79 B;  2EAY A;  3K08 A;  1JOY A;  4HA8 A;  1TUE B;  1RPR A;  3A74 A;  4CBC A;  1E1R G;  1WPX A;  4UVB A;  4K86 A;  2E3C A;  5ELO A;  1I5X A;  1NYR A;  1M56 B;  4PDV A;  4U7O A;  4P72 C;  2CJB A;  2IU3 A;  1AJN A;  1QLE C;  3G4S V;  5FL7 G;  1GO3 F;  3MHS C;  2XGT A;  4WF2 A;  1OCR C;  2EIJ B;  4JTA B;  1YJW V;  1QBZ A;  1GGM A;  3K06 A;  1V55 C;  3D36 A;  4XDK A;  2ARS A;  4XU3 A;  2Q68 A;  3JD4 A;  1NH2 B;  3MQZ A;  2AKW A;  4ZTZ B;  4JPR A;  1HXD A;  1BHB A;  3ICA A;  3REX A;  3JD3 A;  4L87 A;  3LC0 A;  4JYC A;  4UPA A;  3UGQ A;  2YEV B;  2DZC A;  1PYS A;  2WLL A;  1YTF D;  1N9W A;  4WCE V;  3K0G A;  3VBB A;  3EFS A;  3MF1 A;  3E9I A;  4JF3 A;  3FYI B;  3E83 A;  4JYB A;  2EIN B;  2EIM B;  2D3O W;  1BBU A;  1BIB A;  3NEN A;  4J15 A;  1R6K A;  4P3P A;  3M4P A;  3ABM C;  3WG7 B;  3RKY A;  1SET A;  5HFL A;  1GM8 A;  3G71 V;  1USY A;  2ZGW A;  3SPC A;  4H2V A;  3RKW A;  1XL6 A;  3NXS A;  4MVO A;  2WLJ A;  3ZMZ A;  1VQP V;  4UP8 A;  4Q15 A;  2UXX A;  2FTK A;  1QVF U;  4H2X A;  2XAH A;  2P90 A;  4BAY A;  5CBH A;  3FJP A;  4P75 C;  4LVJ A;  3ZMU A;  3QO5 A;  3SPG A;  3L4G A;  2P67 A;  4LVM A;  2X6C A;  4P9O A;  1S72 V;  3W7S A;  3UM7 A;  3CPW U;  4BIZ A;  2J3M A;  3HXU A;  3SYQ A;  3IG2 A;  1VQO V;  1ENV A;  2RHQ A;  4YRQ A;  3OAA G;  3HXW A;  4PA7 A;  2Z3Y A;  2OT5 A;  5IYB O;  4H2S A;  4KP4 A;  2C2A A;  1OCO C;  3REU A;  3R07 A;  3EFF K;  2AHY A;  5EBW C;  1K8A W;  2IH1 C;  4GX1 A;  3VOU A;  1SES A;  3TK1 A;  4FJC C;  5CN0 A;  3RAC A;  4WFG A;  3CMQ A;  4XTY A;  1NR1 A;  5J9P C;  4CH5 A;  1JJC B;  5C93 A;  4XU0 A;  2A0L A;  3AG2 B;  3W7W A;  1V54 C;  2DYS B;  3OM3 B;  1BL8 A;  1FS0 G;  2IU0 A;  4ZIB A;  1LYL A;  4RQF A;  5KA5 A;  2E65 A;  4P2Z A;  1HC7 A;  4WJ3 M;  2ZXW B;  1E24 A;  4MVU A;  4GX5 A;  3X2Q B;  2P0L A;  4H37 A;  2YEV A;  3FB7 C;  3T1C A;  4E2L A;  1Z7N A;  3CP1 A;  2DXU A;  3IKM B;  4P3O A;  2ITD C;  4YCW A;  1IL2 A;  1NBM G;  3T4Z A;  3OUF A;  4YRR A;  2WSS G;  2KB1 A;  3ZMV A;  1NJ6 A;  4BIU A;  3FB6 C;  3A31 A;  3PJS K;  2EJG A;  1PYS B;  1P4R A;  2WLL B;  3ML0 A;  3W3S A;  1YJ9 V;  1YJN V;  2DQ3 A;  1NKD A;  2E41 A;  1G5H A;  2WPD G;  3T2M A;  3A7U A;  4CS2 A;  2EZO A;  1H38 A;  3AG4 B;  5B1O A;  2QHS A;  2WLH A;  4JGS A;  2ZNI A;  4HWO A;  2ITC C;  1H4Q A;  3FYE B;  5B3S B;  3ASO C;  3ASN B;  1OHH G;  4XDJ A;  3I56 V;  2X7R B;  3RVY A;  3MD0 A;  1VQL V;  2P7T C;  1VQN V;  5LHH A;  2I4N A;  1K34 A;  5EK0 A;  1DF5 A;  4WFH A;  2ATK C;  1X2G A;  1B76 A;  2DYR B;  3A5Y A;  3M99 B;  2IY5 A;  4TVA A;  3MHH C;  1ARO P;  4G85 A;  2QTO A;  1S76 D;  4RUF A;  5L3C A;  3CCR V;  1YB3 A;  1F51 A;  3QO7 A;  1IXM A;  1OCZ B;  1OZ0 A;  1XL4 A;  2GHY A;  3AG3 B;  2AHZ A;  1OCC C;  2JEX A;  1GM7 A;  2JDI G;  2JJ2 G;  4J9Y B;  5IDJ A;  3A0R A;  1K73 W;  1G5I A;  1NYQ A;  3CCM V;  1R3K C;  1EVK A;  5CA3 A;  4R7C A;  2ZZE A;  2XND G;  3M4Q A;  4LCU C;  2HKO A;  3E35 A;  2Y69 C;  2JJ1 G;  2M7W A;  5EC1 C;  5B1B B;  3LNM B;  3HFZ B;  1ATI A;  2ZT5 A;  4CH4 A;  1Y4M A;  3IGA C;  1CPY A;  2OCC B;  2W6I G;  2AMC B;  1KC8 W;  1M56 C;  3OMN B;  1S77 D;  3P8V A;  4XEM A;  1R3J C;  3RF1 A;  3RL6 A;  4DXW A;  1ZWI C;  2EIJ C;  2V1D A;  2HG5 C;  1NJI W;  1YIJ V;  3PCO B;  2WAM A;  2ZR3 A;  3TCU A;  1W2B U;  4PDR A;  4TSF G;  4YRG A;  3OGC C;  3SYA A;  2P5I A;  2UXN A;  2Z5U A;  1M57 B;  2BOB C;  1J5W A;  4P74 A;  4EX5 A;  1JCH A;  4GT1 A;  4PDL A;  1CEZ A;  2PMF A;  2EIK B;  4HWT A;  4X8A A;  1L1F A;  3IC7 A;  5IY5 B;  4HWR A;  4MVZ A;  2XAF A;  1GK9 A;  4I5S A;  4G2K A;  1SRY A;  4LVK A;  1FXV A;  3K9A A;  3VQV A;  3W7U A;  4DPG A;  1PKX A;  2EIN C;  2EIM C;  3HXY A;  4YRC A;  2HFE C;  1EVL A;  2I4M A;  5C53 B;  4JTD B;  1NVP B;  1VQ6 V;  3WQZ A;  4MTG A;  1S5H C;  2X6A A;  4QJF B;  1WQW A;  4OXS A;  3WG7 C;  4YRJ A;  4RDX A;  4WFB V;  5C52 B;  1DLB A;  1E79 G;  2DWE C;  2IH3 C;  3ZRW B;  3CCQ V;  1HWY A;  4QE7 A;  2A8E A;  4KQE A;  3ABU A;  4CH6 A;  4KR2 A;  2MK3 A;  3H01 A;  4RAI A;  5L3F A;  2EIL B;  3CCJ V;  1NJ8 A;  2Q7H A;  3ABK B;  2DTI A;  1YI2 V;  3KG2 A;  1AI6 A;  1PNL A;  2GSM B;  2XAS A;  1WQ7 A;  1L0W A;  3CCU V;  3G1Z A;  1WYD A;  4XU2 A;  1KMM A;  4YRM A;  4YRO A;  4E51 A;  3ABL B;  3NET A;  1X54 A;  2C7I A;  3OD1 A;  2DVE A;  4FK5 C;  2ZQM A;  2DWD C;  3TEH B;  1LNQ A;  1QLN A;  1NH2 D;  3AG1 B;  4YRE A;  2HVJ C;  3IAL A;  1EOV A;  2NS6 A;  1KOG A;  3CC2 V;  4ZTU B;  3BY6 A;  1BHA A;  1AI7 A;  4PA9 A;  3SJQ C;  1FXK B;  2IJI A;  1KP2 A;  2WLM A;  4FIP C;  3SYP A;  3OMI B;  1H4V B;  1Y66 A;  4WFE A;  4WFF A;  1E1Q G;  2IY5 B;  4LC1 A;  4TVA B;  5K1P A;  2Q69 A;  2QEX V;  3E8H A;  4MW8 A;  2Q5I A;  3ETE A;  4NCX A;  2JIZ G;  4YRK A;  4RO2 A;  4J9Z B;  4PA6 A;  2Q6A A;  1VQK V;  3K03 A;  3HFZ A;  4YP0 A;  2Q67 A;  2DDZ A;  3RW0 A;  4U7N A;  3V7S A;  3HFV A;  3ZCC A;  2AMC A;  4GX2 A;  2DW4 A;  2C8M A;  4QPJ A;  2I4O A;  1ADY A;  1H8H G;  2Q7E A;  5L3E A;  3B8M A;  4XTV A;  3AG2 C;  4KUM A;  3TEG A;  3OR6 C;  3PCO A;  2DYS C;  1W66 A;  4TVW A;  2F43 G;  4UVC A;  5L3D A;  1YIT V;  4OLF A;  4MTF A;  2WLI B;  3ZIA G;  4Q20 A;  2Q5H A;  4P74 C;  3OUS A;  4H2T A;  1YHQ V;  4TQF A;  2ZXW C;  1DTO A;  3X2Q C;  4CZZ A;  2XAG A;  4TWK A;  4HZ3 A;  2CK3 G;  3K0D A;  4R50 A;  1JJ2 U;  4N23 A;  5LBQ A;  1VQ4 V;  2ART A;  2W0F C;  1X55 A;  3HY1 A;  4G84 A;  5EBM C;  4UP9 A;  3CYO A;  1M9N A;  1PNM A;  1FYF A;  2ZD9 A;  2OTL V;  2I4L A;  2ZT6 A;  4H2Y A;  3OEE G;  4P9P A;  3CCE V;  1Q82 W;  4BW9 A;  3WFV A;  4YDQ A;  1KMN A;  2DQ0 A;  2ARU A;  2W6J G;  4TT3 G;  3W7T A;  3ZRW A;  3CMA V;  3CC4 V;  3OMA B;  1DF4 A;  3AG4 C;  2J3L A;  5GW7 A;  3RVZ A;  4LNS A;  2DTO A;  1M90 W;  3A7A A;  2IW5 A;  1EIY B;  5B3S C;  4Q6G A;  3ASN C;  2Q7G A;  1KP3 A;  2X6B A;  1WLE A;  2X0L A;  3W7X A;  4CS4 A;  3E8F A;  4F4L A;  1K4C C;  2RHS B;  4ZKI A;  4QE9 A;  3CCV V;  4KR3 A;  4LP8 A;  4H33 A;  1USY C;  1EBO A;  2ZR2 A;  2DYR C;  4G27 B;  1RPO A;  4P3N A;  3G6E V;  4X5O A;  3TEH A;  5B1A B;  1B70 B;  4YYE A;  1QCE A;  4P30 A;  4JAV A;  2NLJ C;  1EQR A;  2E64 A;  4YRF A;  1K9M W;  3GB7 C;  4YCV A;  4YRN A;  1F23 A;  2E5A A;  1UJW B;  3ZRX A;  1OCZ C;  3E89 A;  3ABL C;  1VQ8 V;  3MEY A;  3AG3 C;  4H2U A;  4P72 A;  1FXK A;  3L2Z A;  1G8M A;  2JEU A;  1E22 A;  1JPX A;  2ZDI A;  1VQZ A;  1WU7 A;  1B6Q A;  3EFR A;  1QF6 A;  1F4M A;  4YPF A;  4UV8 A;  3BFM A;  3HXX A;  3OFN G;  1K92 A;  5B1B C;  4HYO A;  1H4S A;  1KKD A;  4XEO A;  5KUM A;  2OCC C;  5LHI A;  5B1N A;  4R8C A;  2IJJ A;  2R9I A;  1KEC A;  3E8G A;  3LSQ A;  2ZIN A;  3STZ C;  1VQM V;  3HTZ A;  1KQS U;  3HB3 B;  2HLD G;  5H6R A;  4WFA V;  1Q81 W;  1AI4 A;  4FPP A;  1YFR A;  1Z7M A;  2ZIM A;  2QHU A;  1M57 C;  4I9W A;  2WLI A;  3MF2 A;  3V8K A;  3IKL A;  2EIK C;  1VQ9 V;  4RUE A;  5IYC O;  3HRK A;  4XU1 A;  1SZT A;  1H2G A;  2Y48 A;  4TVY A;  5IY5 C;  1ROP A;  3LDE A;  1MAB G;  1NJ2 A;  2HJF C;  3JCZ A;  4XDL A;  3CME V;  2ZT7 A;  4MVM A;  2ZIO A;  3BJU A;  4MT8 A;  3I7F A;  2BOC C;  2EZP A;  4P75 A;  4JAS A;  4GCZ A;  11AS A;  2QM7 A;  3SPJ A;  1JVM A;  4ZBM A;  3A7R A;  4K88 A;  3A5Z A;  1R3L C;  2EIL C;  3HXV A;  2ZXF A;  3ABK C;  2A9H A;  3F7V C;  4PA3 A;  4G28 B;  3ERR A;  3LUT B;  3OE7 G;  3RBZ A;  1MSW D;  1NNH A;  4CH3 A;  1EIY A;  2NNU A;  1RIQ A;  3E2E A;  3P32 A;  2EJF A;  4LVI A;  2QKS A;  1YTF B;  2B1I A;  1K3E A;  1RM1 B;  2RHS A;  1K5S A;  3JD2 A;  4MS2 A;  3ZN1 A;  4PG3 A;  3AG1 C;  4MTX A;  2CIM A;  3VQY A;  1K5Q A;  4HT4 A;  4RQE A;  1B70 A;  3DGE A;  2HR3 A;  2ZTG A;  3VQX A;  3DSQ A;  1GM9 A;  3JD1 A;  1VQ5 V;  1WNL A;  4YRL A;  1AI5 A;  1FFT B;  2WLN A;  2ALY B;  1GMG A;  3CC7 V;  1NJ1 A;  4FMT A;  2ZNJ A;  1FXK C;  3TET A;  3JYC A;  4YCU A;  2ZDI C;  3DTU B;  1QVG U;  4UP7 A;  4P73 A;  4X89 A;  4YXW G;  1MOF A;  4TWA A;  1R6N A;  1WPY A;  1AR1 B;  1NVP D;  4RMF A;  4KFM A;  1QLE B;  4XTW A;  4JAU A;  1OCR B;  2HNI A;  1NQT A;  1BMF G;  1V55 B;  1W0K G;  1R3I C;  3KFU A;  1G51 A;  3ABT A;  4Z1M G;  1BIA A;  1E1T A;  2FYK A;  4OP0 A;  3F7Y C;  2PME A;  4WI1 A;  3GWO A;  1YGB A;  3QNE A;  3FKS G;  3UH0 A;  4P71 A;  1YFT A;  2IJH A;  5H9C A;  2DU5 A;  5DN6 G;  2B1G A;  3SYC A;  4UUJ C;  3PZC A;  1K97 A;  2K1E A;  2EBO A;  3R65 A;  3HXZ A;  3RKX A;  4PDM A;  4UV9 A;  5EBL C;  3T4D A;  5IYD O;  1S0V A;  1KD1 W;  5BZB A;  1B7Y A;  2ZZF A;  3ZRV A;  5CMU A;  5E3I A;  3ABM B;  2HVK C;  2P6J A;  4MSW C;  5LGN A;  4YRP A;  3BEH A;  1JX9 A;  1FXH A;  2DEQ A;  2EJR A;  4PEL A;  4XBF A;  2PI5 A;  4WF9 V;  2QM8 A;  2EJ9 A;  3P8Y A;  3NEL A;  2E10 A;  2H94 A;  2IJK A;  5F5W A;  1EFW A;  4X88 A;  1NR7 A;  3IFX A;  1YFS A;  2XAQ A;  3B77 A;  3P30 A;  4HAM A;  2WLK A;  3SPI A;  2G4C A;  3HRI A;  3EHB B;  1ADJ A;  1G4Y B;  3UKM A;  1AJP A;  4DO2 A;  4PA4 A;  1EFR G;  1E1O A;  1QR8 A;  2DTH A;  4HVC A;  2ODR C;  4MW3 A;  1J95 A;  1K33 A;  1THZ A;  2R9R B;  4BW5 A;  1VQ7 V;  5LHG A;  12AS A;  2PI4 A;  1X56 A;  2ZCE A;  3V8J A;  3QO8 A;  3RUX A;  2DJZ A;  5H6Q A;  4AH6 A;  5B1A C;  4EKW A;  3NEM A;  1BBW A;  3ZN0 A;  4ASU G;  2EL9 A;  3V8L A;  1K7D A;  1PD3 A;  4CS3 A;  1ASZ A;  2ALY A;  1COW G;  1AJQ A;  3AEI A;  3OR7 C;  1B8A A;  2CGH A;  5L3G A;  4P73 C;  2QHT A;  1OCO B;  1P7B A;  1YSC A;  3SPH A;  3ZMT A;  5E1A C;  4K87 A;  4R6Z A;  1JQ0 A;  4MTO A;  1QE0 A;  2ZZG A;  5DM6 V;  4UVA A;  2B5U A;  5HFM A;  3STL C;  3ZJZ A;  3D3I A;  4QIW F;  5HGQ A;  4HWS A;  2DZ9 A;  4WJ4 A;  1N8R W;  2LFS A;  4YRT A;  2CJ9 A;  2DKG A;  4H2W A;  1NJ5 A;  3VQW A;  3RIR A;  2LP7 A;  2E1H A;  3HY0 A;  4O2D A;  3E9H A;  2YSU B;  2QA4 V;  1EZJ A;  1V54 B;  2H8P C;  2XOK G;  4MVQ A;  2AKW B;  3LSS A;  3B8N A;  1Q7Y W;  4HWP A;  1QR9 A;  2QE7 G;  1PNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...