4RQEA

Human seryl-trna synthetase dimer complexed with two molecules of trnasec
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
478
structure length
460
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKELSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVTSIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords Serine--tRNA ligase, cytoplasmic
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
total genus 121
structure length 460
sequence length 478
chains with identical sequence C
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqeA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqeA02
2DDZA 4CS4A 4CS3A 4LNSA 4K87A 3KFUA 3HXWA 1NYQA 3L4GB 3QTCA 1RIQA 4UP9A 5ELNA 4XTYA 4H2YA 5E3IA 4YRGA 4P75A 1SESA 4HWRA 3IG2A 2EWNA 2RHSB 2ODRD 3W3SA 3A31A 4XTWA 4CH5A 1EIYB 2ZT7A 3PCOB 3RIRA 3TEGA 4YRIA 4UPAA 4HVCA 1WQWA 4J15A 2E64A 1NJ6A 3HRIA 3A5ZA 1KOGA 3MF1A 4PG3A 2ZZFA 2DZCA 3QO5A 2I4NA 2ALYB 4YYEA 3QO8A 4H2XB 3HFZB 1SRYA 4HWPA 1ADYA 3MF2A 4WF2A 4OP0A 3VQWA 2ZT6A 1KMNA 1YFRA 4TVWA 2ZT8A 4P3NA 3IKLA 3M4PA 3RF1A 2CGHA 4DPGA 4CS2A 11ASA 2EJ9A 4YRNA 1G5IA 1NNHA 2ZCEA 3PZCA 2AKWB 4YRJA 1BBWA 4TVAA 1J5WA 1E1TA 1KMMA 1X54A 2ARUA 1N9WA 4ZIBA 4RDXA 2Q7EA 4TQFA 4XU1A 3I7FA 4XEMA 3WQZA 2DTIA 4EX5A 2DXTA 4YDQA 2DKGA 3E9IA 3VQYA 2AMCA 4WI1A 4ZTUB 2Q5HA 3RUXA 4HWTA 4L87A 2E5AA 1BIAA 3DSQA 4RMFA 3UGTA 5C52B 1E22A 4XTVA 1VQZA 1W66A 2EJGA 3HXXA 1QE0A 1ASYA 2G4CA 2RHQA 3ICAA 2XTIA 3RACA 1PYSA 3P8TA 3LSQA 5C53B 1H4SA 1X56A 1JJCA 1EOVA 2Q7HA 2DXUA 1L0WA 2E41A 1SERA 2P5IA 1WYDA 1NJ2A 4YRLA 4H2TA 3RGLA 4YRRA 2RHSA 4P3PA 2DVEA 2E10A 2J3MA 1IL2A 3L2ZA 2DEQA 2XGTA 3REXA 2E65A 3NELA 4PHCA 4P72A 1B70A 4XU2A 1NJ8A 4X5OA 4TQDA 1USYC 1WQ7A 3P8VA 2IY5A 4G84A 1EVKA 3V8KA 3RKYA 3EFSA 4H2XA 2QHSA 3OD1A 3RKWA 4WJ3M 1QF6A 3HFVA 4AH6A 4RQEA 1H4VB 4H2SA 3IALA 2CJAA 1HXDA 3HXZA 4P71A 5HGQA 4HWSA 4YRMA 2HNIA 3HRKA 1HTTA 4P74A 4TWAA 1B7YA 3TEHA 2DZ9A 2FYKA 2ARTA 4Q6GA 4WJ4A 2ODRC 2C7IA 3HTZA 4YCWA 4YRPA 2DQ3A 4YRCA 4KR2A 4P73C 4YRSA 1EFWA 1Z7MA 2PMFA 4YROA 1YFSA 4K88A 3QO7A 1H4TA 1E1OA 1G5HA 2ZGWA 1NJ1A 2CJ9A 5ELOA 2PMEA 2ARSA 1X55A 3VBBA 2DTOA 4P75C 2ZXFA 4NCXA 3A7UA 4E51A 3BJUA 2E3CA 4XU0A 3V8JA 4TVAB 4YRFA 1WNLA 1Z7NA 4TVYA 3RL6A 4YCVA 3VQXA 1X01A 2J3LA 2EL9A 2ZIMA 4KQEA 1ATIA 3VQVA 3TUPA 2CJBA 4CH6A 2AMCB 3L1AA 1GGMA 3L4GA 3V7SA 4YRTA 4OLFA 1NJ5A 2ZINA 3QNEA 3UH0A 3A7RA 3HXYA 2ZIOA 4H2UA 2ZNJA 4P71C 2ZNIA 4H02A 2ZZEA 2DU7A 12ASA 4UP7A 2RHQB 4P74C 1PYSB 3REUA 1EIYA 2ZZGA 3HXVA 3PCOA 4BWAA 4HWOA 2Q5IA 3E9HA 1JJCB 4RQFA 3IKMB 4EO4A 2EJFA 2C8MA 2ALYA 3NENA 4TTVA 3G1ZA 3HFZA 3FJPA 4XU3A 2I4LA 4H2WA 4YRKA 1WPYA 3LSSA 1B70B 1X2HA 1B8AA 2I4OA 4XEOA 2ZR2A 2DTHA 1YB3A 4G85A 2IY5B 4CH4A 5KNNA 4XTXA 4YRQA 3HXUA 3NETA 1HC7A 4XTZA 4P3OA 2AKWA 3CMQA 1YFTA 1BBUA 2DJZA 4YCUA 1WLEA 3ERRA 3P8YA 2ZTGA 3HY1A 3RKXA 5C51B 4K86A 1EQRA 2EAYA 2QHVA 4H2VA 3UGQA 5F5WA 2QHTA 2DU5A 4O2DA 3UFGA 2ZR3A 5K1PA 1X2GA 4CH3A 4KR3A 1B7YB 3V7RA 2DQ0A 3A74A 2Q7GA 3TEHB 4YREA 2ZT5A 3V8LA 1G51A 1BIBA 1USYA 1WU7A 3R07A 1YGBA 3M4QA 1FYFA 4Q15A 1H4QA 4XTUA 3A32A 4P72C 2CIMA 4DQ2A 1NYRA 1SETA 3A7AA 4YP0A 1B76A 4BW9A 1EVLA 4UP8A 1ASZA 2I4MA 1ADJA 1LYLA 1E24A 5K1XA 3V7CA 2E1HA 3MEYA 3BFMA 4HA8A 3LC0A 3EFRA 3NEMA 4ZTZB 4YPFA 1C0AA 3HY0A 2P0LA 3A5YA 2QHUA 4P73A
chains in the Genus database with same CATH superfamily
3B40A 2IJKA 1Z5WA 3KFUA 1NYQA 4YIPA 4UP9A 5KUKA 4B3SO 3M99B 3JALB 3SPGA 4XTYA 1UPGA 2YXLA 3W7XA 3CMAV 4P75A 1SESA 4HWRA 4GKKO 2NN4A 1S3JA 2EWNA 2CE4A 4IYHA 3RYFA 3SPHA 1DK1A 2A9HA 2ODRD 3OMNB 1NVPB 1QLEC 4XTWA 5CB4B 1AR4A 1BT8A 4RWUA 1ZTEA 4HVCA 1R3KC 3CMEV 2XOKG 2OYQA 1RP3B 3LSUA 4BR6A 4JPRA 2BE3A 5HFMA 1NJ6A 1KOGA 2P5OA 5FNVB 1M56B 1I5XA 4PG3A 2YEVB 5IY5C 1MSDA 1NTMH 3LDDA 3QO5A 4YYEA 4DR2B 3HFZB 1I94B 1EZJA 4FLXA 4HWPA 2HKOA 3SDLA 2ZE6A 3TXSA 1XNQO 4OP0A 5BR8B 4X64O 3D36A 3HPLC 3OUSA 1HNXO 2LFSA 4LF9O 2UXXA 4LFCB 4CS2A 3N2GA 4JI2O 1PNLA 3I55V 1I0HA 1G5IA 5EBMC 2XAFA 3A8TA 3K9AA 1VQPV 2AKWB 1TAEA 5GW7A 1BBWA 1IXBA 1FJGO 1X54A 1GAXA 2ARUA 3CC7V 4ZIBA 2Q7EA 4TQFA 3JAWA 3OM3B 4XEMA 1W59A 3WQZA 4EFBA 4EX5A 2DXTA 1B3QA 2VQFB 1M56C 4JF3A 2KB1A 5B3SB 2H3OA 4LF5B 4LVLA 5H6QA 1YCIA 4WFBV 3BPZA 4L87A 3ABKB 2JIZG 2IW5A 3F5WC 3E8HA 4YJ2B 2Y69B 2QEXV 5EC2C 3DSQA 2XAJA 1SQGA 4DV1O 5IJ0A 2YC0A 2H8PC 1VEWA 4IIJA 1ASYA 2JEXA 2Y0IA 1PYSA 4D7TA 3SYCA 3LSQA 4I0XB 2OIGA 5C8YA 1H4SA 2D3OW 1XL6A 1D5NA 1EOVA 1TVKA 2Q7HA 2CGOA 4AHCA 3ABLC 3W7TA 2ZXWC 3GWOA 1Q82W 2P5IA 1X59A 5GONB 2P90A 4YRLA 2CAZC 1RSOA 1Y74A 4LNUA 4B3MB 2EIJC 4FM0A 4CZZA 2UUAB 4P3PA 4I4TB 5KHHA 3L74H 2AZ2A 1OCOC 1VQ9V 2QTSA 5B3SC 1NTZH 2CTWA 2RDCA 4UCTA 4EKWA 3L71H 1XL4A 5LGTA 1ZUQA 4YXWG 1GN4A 4MTFA 3ABKC 4FMTA 5IE9A 2WLMA 4WF9V 4NYKA 3OEHG 2Y69C 3SR2C 1XUQA 4X5OA 4B3SB 1KKDA 4GKJO 4RUFA 1EVKA 1GM7A 5LP6C 2LFRA 3OFNG 2ZDIC 4GKKB 4H2XA 1F4MA 3OD1A 5KA5A 1NVPD 1V54B 4AH6A 1MNGA 4RQEA 4PDLA 5CBHA 4PELA 2QWNB 2YUAA 4G27B 4O4LA 5J2TB 2QGNA 3PJSK 3HXZA 3QVNA 2VWJA 5CA0A 3RW0A 1M57C 4U3JB 2HNIA 3HRKA 4P74A 2LGWA 4TWAA 2F23A 2MK3A 3EVKA 3TEHA 2AW9A 2X0LA 4JZ2A 4Q6GA 3UT5B 4WJ4A 3HTZA 4ABMA 1OCCC 3ZMZA 1MA1A 4LF4O 2PTMA 1XNQB 4DR6O 2YSUB 3G67A 4X64B 3VOUA 2PMFA 1HNXB 4UCRA 1YFSA 4YROA 4LF9B 1MG1A 4K88A 3ETQA 1KB9F 2HG5C 1H4TA 2Z5UA 4JI2B 1NJ1A 1NH2B 1SF9A 3IC9A 2ARSA 2HR3A 1X55A 2YIBD 4NCXA 3CC2V 4FVMA 3FYEB 1V54C 4E2LA 4TVAB 4YRFA 4EB6A 1Z7NA 5TISZ 5E79Z 1FJGB 3VQXA 1KC8W 4QE7A 2A06H 4FLYA 2J3LA 4JI7O 3W7UA 1S77D 4JI6O 1BZKA 3MHHC 4DR7O 5JCOC 4CH6A 3KCYA 2ZD9A 2CJBA 2F93B 3OD4A 1JQ0A 3E86A 5F2VO 1MOFA 1BHBA 1YZBA 1NBMG 3V7SA 4YRTA 2V1DA 3ZHVA 4OLFA 2P22C 3JALA 3FYIB 1UJWB 4DV1B 2EILB 4OPHA 2ZNJA 4P71C 2GBOA 1IBLO 3O9OA 1PP9H 3CX5F 1OJHA 5KHGA 2DE0X 4UP7A 2RHQB 1KP2A 5H6RA 4U3FH 3CCVV 2BTOA 5CB4A 2N04A 2QKCA 3HXVA 4WBNB 4OGQB 1YEWA 1J5EO 1Y6XA 2Q5IA 1ZWIC 3IKMB 3ZX6A 4ZI7B 1K92A 2EJFA 3ETDA 2W6IG 3SJCC 5FNVA 2PY5A 4LVMA 1RFYA 2YEVA 2C8MA 3ZHUA 2JVDA 4FFBB 4PA4A 4TTVA 1SQFA 1LUWA 1XHZA 3FJPA 3HFZA 2DW4A 3IJ4A 2WLHA 2P7TC 4UB8Z 1OV9A 3FB5C 4O2BB 2E76B 1N0JA 3E83A 4PV1B 1X2HA 2I4OA 4I55B 1K7DA 3JD4A 4EEQA 4PI2A 1US6A 4GKJB 1L0NH 2F43G 5GTHZ 4XTXA 4YRQA 2EILC 3HXUA 5FL7G 1AR5A 1HC7A 3BA9A 4XTZA 2AKWA 1YXBA 3T4ZA 2QM7A 3P30A 1Y67A 5BMVB 1B04A 3ZRVA 4XDKA 3E22B 4DV3O 1FXKC 5C51B 5KLVH 3OUFA 3ZHQA 2EJ7A 3JD0A 4H2VA 3UGQA 2UXCO 2ADPA 3TGUH 4O2DA 3UFGA 1N34O 4B7EA 5K1PA 1PPJH 4CH3A 1FAFA 3MD0A 5JJEB 1OCRB 2Q7GA 5BY1A 1PKXA 4YREA 4P9OA 2DYSB 5J2UB 4JYCA 4P9PA 3IGAC 4DV4O 1YGBA 3M4QA 4DR6B 1GM8A 3H1LH 4UVBA 1FYFA 1G6UA 3KG2A 4Q15A 2ZDIA 2DJVA 2IH1C 1QVGU 3ZRWB 4GZRB 1EZVH 4QJFB 3CRRA 4I0XA 2Q0OC 3JSLA 2ZE7A 3SPIA 1K34A 4ICGA 4YP0A 2WA3A 5EYPB 1NT2B 5A9GA 1IVSA 1B76A 1EM1A 1H38A 4BW9A 4DR3O 4J10A 3DC6A 2QJ1A 2I4MA 4MTOA 1JOYA 1LYLA 5GONA 3C3SA 4O4HB 1BHAA 1LR1A 5IWAO 3TETA 4RUEA 4JASA 2E1HA 2N74A 3RFRA 4UCOA 4DV7O 4I4TA 3N2KB 4UV8A 4JI7B 3LC0A 2PZSA 4JI6B 1KU9A 4QGPA 4YPFA 3RYHB 3HY0A 4DR7B 4CC6A 2HVJC 1OCRC 1Y66A 4X9QA 2FKXA 4CS3A 1M1KW 4LNSA 4HZ3A 2DYSC 2VRZA 5JQGB 5ELNA 4DRXB 1NS1A 1T5EA 2BSKB 1S5JA 1ENVA 5IDJA 2F4VO 5E3IA 1IBLB 3IG2A 4GYCB 4OX9O 3A31A 1Q81W 5B66Z 3PN1A 1EIYB 1PV0A 2ZT7A 5J2TA 1E79G 3PCOB 3SPJA 4YRIA 4UPAA 1J5EB 3OMAB 3E8BA 4J15A 4O2AB 4U3JA 5L3EA 3A5ZA 3BRCA 4LFCO 2ZZFA 1MZEA 3T4DA 3CS5A 3IC7A 1KKCA 3LNNA 2I4NA 4LF7O 2EBOA 4NVPA 2Z3YA 3UT5A 4H2XB 4LVKA 1SRYA 1BQZA 3OT7A 5EIBD 3SYOA 1ZX3A 1ADYA 3MF2A 3FD9A 4WF2A 2JJ2G 1AVMA 1KMNA 4LF6O 3CWBH 1X4TA 1CEZA 3RF1A 2CGHA 4N23A 4GX2A 2EJ9A 2QKAA 2UUCO 4P30A 1XOUA 3JAMN 3J80N 4R6ZA 5LYJB 4TVAA 2R70A 4HBNA 1PM9A 4LH7A 2PF4E 1N9WA 1AP6A 4I9QA 1WNSA 4DV3B 1H2NA 3CXCU 1GK9A 2QR4A 3I7FA 3T2MA 3B77A 3E89A 3S3XA 4YDQA 1FYJA 1HR0O 4RO2A 3E9IA 3VQYA 2UXCB 2Q0AA 1QLEB 4K8XA 1N34B 2YI9A 2JGDB 3FB8C 1WJZA 2KKWA 3UKMA 5B1BB 5AG2A 2WLLB 1FXVA 3LDCA 1Q8IA 2YICA 5CBFA 2B1GA 1N8RW 3KKYA 1THZA 2FMLA 1Q6UA 3FAVB 4DV4B 3UGTA 4DYLA 4XTVA 3P3PA 5IY5B 1A32A 2YI8A 1W66A 3C3TA 3ZBHA 2RHQA 4NR1A 3RVYA 3RACA 3P8TA 1M93A 4B7KA 1QVFU 1M4UA 5C53B 1WB7A 4WBNA 1H8EG 1FXKA 4FLZA 1Q90D 1VF6A 3CYOA 2DN9A 3JARB 4PDMA 2JS3A 4PI0A 5H9CA 2DXUA 4ZI7A 4DR3B 1SERA 3SJAC 1VF5B 1IX9A 3I56V 1WYDA 5IWAB 2PI5A 1XDCA 5KA6A 4FFBA 1P49A 3ZMVA 4YRRA 4LVIA 5LA6B 2RHSA 4DV7B 2XAHA 3DTUB 1SA0B 1P4RA 3MHSC 2E10A 4O2BA 1FFTB 3TK1A 2RCVA 2DEQA 1VQ7V 3NELA 3G6EV 1JJOA 5B1BC 3ASOB 1F4NA 2W6JG 4I55A 1NJ8A 1G4YB 4LWSB 4MT8A 1USYC 1AROP 1VARA 3TCUA 1L0LH 2F4VB 2CK3G 2C2AA 3RKYA 1MMMA 1H8HG 4ZKIA 4WJ3M 1SZTA 3B8MA 4OX9B 5BMVA 1S76D 1H4VB 1QNMA 3E22A 3L70H 2JGUA 5IYDO 4JI5O 5BZBA 2QDOA 3IALA 2CJAA 4FLWA 4UFZA 4LBEC 4QE9A 4W4LA 2BOCC 4UCSA 3WB0A 3FB6C 2Y4UA 3JATB 1HTTA 2RQ6A 1PD3A 1E1RG 3K5NA 2NNUA 4LF7B 3U0ZA 1YTFB 2FYKA 4MVOA 1AJQA 5J2UA 1D2DA 2C7IA 1Z2GA 4H37A 3ABLB 2ZXWB 5KHJA 2DQ3A 2LW7A 3ZMUA 4X20B 1KECA 1YITV 4X89A 4JYBA 5L3DA 4LF6B 3ASOC 4FLUA 2EIJB 3ZJZA 2L6LA 3ZRWA 3JASB 4JAUA 4HAMA 4MVQA 2ZGWA 5ELOA 1OCOB 3GB7C 3NXSA 2UUCB 4W4KA 3G6BA 5EYPA 3OR7C 4FK5C 5C93A 2Q4PA 3K03A 4XU0A 2BCCH 4O4HA 4H33A 4GX0A 4YCVA 2RMKB 1S5HC 3ETGA 4JI0O 2ZKOA 5LP6B 1L8DA 2EL9A 3THOA 3N2KA 4H13B 1HR0B 1ATIA 3SYPA 3ABUA 4X1YA 5KX5B 3TUPA 3RYHA 2ZE5A 3K0DA 3MAQA 1BCCH 4DUZO 1WP8A 4UV9A 2JJ1G 3A2FA 4H44B 1QCEA 4FJCC 3AK3A 5JQGA 3LDEA 4DRXA 1TUBB 1NJ5A 1M57B 3K59A 2BSKA 2UXBO 3K06A 4NXMO 1FXHA 2ZNIA 5L3GA 2IM9A 2ZZEA 2HEPA 12ASA 3K08A 3L9DA 4LFBO 3K0GA 4XDJA 2WWWA 4MSWC 1EIYA 1PNMA 1KUQA 2R72A 2JDIG 5LHHA 2ZZGA 3PCOA 1OCCB 4HWOA 4DV2O 2ITDC 5CA3A 4QPKA 1ZAUA 1JJCB 1Q7YW 4RQFA 2X6BA 4O2AA 4CC5A 4MVZA 1IXMA 2X7RB 5LGNA 3HKBB 1K5QA 2D2CB 4NKGB 4WFHA 1WPBA 3F7VC 2P06A 3NENA 1Q5OA 5IYZB 4F6RB 3MQZA 3H1KH 3TXQA 1K4DC 2UXDB 4H2WA 4YRKA 3L75H 3OTOO 1YI2V 4DO2A 5LXTB 1CPYA 2FB5A 3OAAG 3B2EE 1B70B 3AG2B 4XEOA 2ZR2A 1YB3A 1VQ4V 1H2KA 1J95A 3ZEDA 4CH4A 4TUYA 1O9GA 1WPXA 1XBLA 1JX9A 1W2BU 3CMQA 2XHBA 2EZOA 2M6YA 5LYJA 3B8NA 1YFTA 1BBUA 2DJZA 2V7QG 3ERRA 4JI5B 3ABTA 3HY1A 2PYJA 4K86A 1EQRA 2V4DA 3DGEA 2EAYA 2QHVA 1NKDA 5F5WA 4B3TO 2DU5A 3RWRD 1K9MW 2ZR3A 3HKDB 2JGDA 2XAGA 1K33A 3CCLV 2WLLA 1BIBA 2CH7B 3ETEA 2Z0AA 4MTGA 1USYA 4ZBMA 2E74B 3FAVA 1WU7A 1XMOB 5KAFZ 1QLNA 3DXRB 4K3AA 4JYYA 3A32A 4KFMA 1IBMO 4I9WA 3J7AU 3RGBA 1N32O 3AG2C 1P84F 3ZMTA 3OW2U 4I50B 5EZYB 4GLXA 3A7AA 2HJFC 5IYCO 3FKSG 1XREA 2HJDA 3JARA 3CRAA 2LQTA 1EVLA 4LVJA 4NTXA 3CCMV 3CP1A 2P4VA 1E24A 4JI0B 1QR9A 3V7CA 4MW3A 5LA6A 1GMGA 3ML0A 4HA8A 1SA0A 1C0AA 1BE3H 4PDRA 1EN5A 1OZ0A 4DUZB 3K5LA 2DDZA 4CS4A 1YF2A 1FXKB 3Q4HB 2UU9O 3QTCA 5B1OA 3QG5A 4LWSA 2GDSA 4ZHQB 5KMGB 3K5OA 4WFGA 2UXBB 1MZFA 2ZE8A 4NXMB 4YRGA 2Y4TA 1XNRO 2Q68A 2RHSB 2L35A 3FX7A 4LFBB 3LUTB 4CH5A 4UVAA 1KMIZ 1WAZA 3ZRXA 3TEGA 1VQOV 2FYUH 4DV2B 1Q6HA 2W0XA 1WQWA 3M8AA 4DK0A 4FLVA 4JTDB 1NTKH 2E64A 3BA8A 3JATA 4ASUG 5LHIA 2ADQB 2DZCA 1HNWO 1QR8A 5FPOA 1VQLV 2P4KA 1N36O 1H2LA 3OTOB 3VQWA 4X20A 2ZT6A 2KQXA 3CEIA 2EINC 3EHBB 2LP7A 1YFRA 4TVWA 2ZT8A 3IKLA 3M4PA 3JASA 4FZ0A 2OIEA 11ASA 1VQNV 4YRNA 1NNHA 3WB2A 3C90A 2A8EA 1TGOA 3S3WA 3PZCA 3O65A 4YRJA 1BQ0A 2BTQB 1GN2A 2QWPB 3WU2Z 2KG7B 3A0HZ 1J5WA 1KMMA 3CB2A 4RDXA 4XU1A 1NZ6A 5LP6A 3BFRA 2XUMA 1XILA 4DR1O 5KX5A 3RYCA 1OCZB 1NH2D 4B3TB 4WFAV 3HKCB 4ZTUB 1TA8A 2Q5HA 1F51A 3WFVA 2GHYA 1BIAA 4HNAB 5JJJB 5KHIA 3CD6V 1TUBA 4L8JA 4RMFA 3AG1B 1BL8A 5C52B 4TV8B 3A0RA 2JK5C 5EC1C 3HR0A 1QE0A 3ZN1A 1JVMA 3AG4B 1IBMB 1N32B 1IZ3A 1EFRG 3K5MA 2G4CA 4HT4A 2K1EA 4X1YB 1AJPA 1R3LC 3CCJV 1JFFA 1X56A 4JI8O 2ZQMA 1JJCA 1G8MA 1M5IA 2E41A 2WLJA 5L3FA 1R73A 3HKBA 2HVKC 1Y4MA 3ZS8C 1N0NA 4H2TA 4UCVA 4TV9B 1G1XB 5IYZA 4F6RA 2JRIA 5IJ9B 4FM1A 2YS8A 3L72H 1R3IC 1OCZC 1K8AW 2CDYA 2CUGA 2EIMC 2J3MA 1AJNA 1S5LZ 3L2ZA 5CA1B 2XGTA 5LXTA 1R6KA 1YVWA 1GKFA 2EZPA 4DUYO 5JH7B 2ZT9B 2A3QA 2Q6AA 2UU9B 1B70A 4XU2A 1QHTA 1VMGA 4KL1A 3NR7A 5E1AC 3AG1C 3P8VA 4XDLA 4G84A 5JCOA 4QPJA 4NXNO 3AK1A 2VS0A 3E2EA 2NLJC 1XNRB 3RKWA 4GX1A 3AG4C 3HFVA 3P3NA 3A0BZ 4PHZA 4JGSA 4WFFA 1GO3F 1K97A 3SJBC 5B1AC 1HXDA 3APQA 4P71A 4HWSA 5HGQA 3SYAA 4YHHO 5KHKA 5ITZB 1WN7A 4KP4A 1B06A 1BMFG 3HKDA 1P7BA 1HNWB 4TUYB 2DZ9A 2HHHO 1NU1H 2NR5A 3UQ8A 1R6NA 1GN6A 2CH7A 2ODRC 4Z2WA 3CPWU 1N36B 3K04A 4YCWA 2GV9A 2EIKC 4R7CA 3DXRA 4P2ZA 1VIBA 4YRCA 4KR2A 4P73C 1SKVA 1EFWA 4R8CA 1Z7MA 2P6JA 2QSAA 4J7JA 5LMNO 2PI4A 3QO7A 3ZCCA 2DMXA 4I50A 1HDJA 4C7UA 1YSCA 1E1OA 4RAIA 1G5HA 5EZYA 4X66O 5FLXN 4TT3G 3HKEB 2DTOA 3A7UA 4E51A 3B09A 4OPAA 2E3CA 3V8JA 2QE7G 3RYIB 1RPRA 3SYQA 4TVYA 2ODMA 3RL6A 4YJ3B 1N33O 4B3RO 5LHGA 2QWOB 4J9ZB 2LW1A 2YDEA 1H2SB 1CP9A 2ZIMA 4LFAO 4KQEA 5H5NA 4DR1B 2ITCC 3VQVA 3G71V 2YXYA 1YJWV 2AMCB 1QQCA 2OCCB 2EULA 4DR5O 4PJ0Z 3Q4HA 2YXHA 2CTQA 4YY3O 3CJHB 2WAMA 1Y76B 2ZINA 3K3WA 4ZHQA 5KMGA 4X65O 4PD4F 3A7RA 2WLNA 2ZIOA 2HLDG 4IGGA 4YIOA 1VP7A 4B08A 3H1HH 4KXRA 2DU7A 4AQYO 3JD2A 2UXNA 3JSNA 1K73W 4P74C 1OHHG 2UXDO 4IHJB 1VQ6V 3WG7B 4BWAA 3ZHSA 3OGIB 2WA4A 4JI8B 1XMQO 2GTSA 2DWDC 3CRMA 4EO4A 1DLBA 1E1QG 2RN9A 4JAAA 3U10A 4LP8A 2QWQB 2XT9A 3G1ZA 3SJQC 2WPDG 4NTWA 1K3EA 2O57A 3F7YC 4H0LB 4D7SA 2I4LA 3D3QA 5A2QN 3BHPA 2EJRA 2OCCC 2OTJV 4LC1A 4DUYB 1SQXH 1FS0G 2VWKA 4DR4O 2QTOA 2GTAA 4PA3A 2IY5B 1JR9A 5D5PA 2YIDA 4NXNB 1IURA 4P3OA 3DC5A 2BTQA 1F23A 4Q20A 2CTPA 2KG7A 4U7OA 1NJIW 3AEIA 3OE7G 5B5EZ 5LL6Y 2OCHA 5LOVB 3P8YA 2IH3C 3BAAA 2XNDG 4TOIA 2XASA 3WG7C 3CCRV 1XMOO 2E5LO 2ZTGA 1DGSA 4BW5A 3RKXA 1VQ5V 1KBHA 2E75B 2AHYA 4O4IB 4BIOA 1EN6A 4N21A 4YHHB 2QHTA 1HWYA 5CN0A 3HKCA 1Z5VA 1X2GA 4KR3A 4FIPC 1B7YB 2EX3A 2R9IA 1MABG 4E4EA 3IFXA 2HHHB 3V8LA 4X1IB 1NI8A 4HNAA 3SPCA 5LGUA 3JYCA 3HB3B 5CBGA 3AG3B 1XQ8A 1JA8A 4TV8A 2QA4V 4ZOLB 4XTUA 2FL4A 4P72C 4QNHB 1TUEB 5FPRA 5LMNB 3SGIA 2CIMA 4JI1O 2ATKC 4DQ2A 1NYRA 1SETA 2X6CA 3RYCB 1Q86W 4X66B 4I5SA 3B4SA 3K57A 4JZGA 2XAQA 4X1KB 3ZHTA 4UP8A 3ABMB 2KSDA 3UO3A 1ASZA 1IDSA 1ADJA 4B3RB 1N33B 2WSSG 3STLC 4BIZA 4TV9A 1ORQC 3H01A 3MEYA 4LFAB 5IJ9A 3NEMA 3CC4V 4X8AA 1ZSPA 1I5YA 2P0LA 2R9RB 2QHUA 3A5YA 5CA1A 1BGYH 4DR5B 5EBWC 4P73A 4DXWA 2QM8A 5JH7A 1AB3A 1JFFB 3CE2A 4K87A 1PNKA 3HXWA 4YY3B 4JAVA 3L4GB 1RIQA 4JI3O 4DW1A 1HNZO 3IAYA 2ZM6O 1XHXA 1H2MA 1YDXA 4X65B 1VQ8V 3AG3C 4MVMA 4WFEA 4H2YA 2P67A 2HFEC 4MS2A 2CTRA 4UVCA 3ASNB 1W0KG 4D6TH 5HFLA 4AQYB 3JD1A 4GX5A 4IT5A 3W3SA 4NTYA 4PA9A 1AILA 1FD9A 4IYIA 3RIRA 3X2QB 1ZL8B 3ICXA 3J81N 4DW0A 1XMQB 4NB5A 1GH6A 1CXZB 3ABMC 1K5SA 3WB1A 3HRIA 2LGQA 1ROPA 5ITZA 3MF1A 3KCXA 3E35A 2ALYB 3T1YO 3QO8A 3TJTA 2G38A 3OMIB 1WA8A 2FTKA 3JAKB 4FPPA 4X62O 4DK1A 1URFA 2LO1A 1WP7A 1SC5B 2N05A 1H2GA 3QF7A 4P3NA 4IL6Z 4CBCA 4DPGA 2A79B 4DR4B 5L3CA 1BS3A 1NQTA 2AHZA 5GTIZ 1EN4A 3HKEA 1PL0A 2ZCEA 1AP5A 1YTFD 2DYRB 3ASNC 3CHXA 3RYIA 2IJIA 4MVUA 1E1TA 4J9YB 3APOA 4YJ3A 3MDSA 3D8CA 3AK2A 3OTFA 3X2QC 1VQMV 2E5LB 1UFIA 1K4CC 4DV6O 4BIUA 3FFQA 2DTIA 2WLIB 2A0LA 4O4JB 2DWEC 2DKGA 5JVDB 4I7ZB 3I5DA 3JCUZ 2AMCA 4WI1A 4K0KO 2VQEO 2HP8A 1XEQA 3RUXA 4HWTA 2E5AA 3CJHA 5CMUA 2AZ0A 5LMUO 1SQQH 4TWKA 1Y76A 4OXSA 2K9PA 4J41A 1QBZA 1S0VA 1VF7A 1E22A 4JYAO 1VQZA 3AG7A 2EJGA 5DECA 1R6TA 3HXXA 1BSMA 5B1NA 3ICAA 1FFXB 4JI1B 2XTIA 5L3BA 1D5AA 1SQPH 5DM6V 2OTLV 1N4CA 4IHJA 1LUVA 2F1MA 2YIAA 4PA7A 2DYRC 2WLKA 1YJNV 2Q5ZA 1JJ2U 2EINB 1L0WA 5IT9N 4DV5O 5JWPA 4FLTA 3ZIAG 1F7YA 1NJ2A 2B9ZA 3K58A 1WB8A 3RGLA 1KQSU 4J7ZA 3RBZA 3RT3C 2PYLA 1I08A 1JPXA 4FZ1A 2BOBC 1DF5A 3UM7A 3ZHRA 1KP3A 2X6AA 2GUZB 2DVEA 1JCHA 2JEUA 1IL2A 4UB6Z 3OGCC 3G80A 3REXA 2Q8VA 2E65A 4PHCA 1EBOA 4P72A 2RJZA 3K79A 4JI3B 3RVZA 1HNZB 4JI4O 3F5TA 4TQDA 2ZM6B 1WQ7A 1I7FA 3P32A 3T1CA 2IY5A 4LF8O 4EFEA 4MVSA 4R50A 3V8KA 1S72V 3EFSA 2QHSA 1NR7A 1QF6A 2XTAA 3RYFB 3OEEG 1Q43A 1RPOA 2IU3A 5JJNB 5LOVA 2JS5A 3BVOA 4H2SA 1U97A 3H9VA 4UXNA 3N27A 5KAIZ 3M7MX 1M9NA 3W7WA 4O4IA 4AI8A 4YRMA 4J7KA 1SS3A 5J9PC 2B5UA 1SZXA 1RM1B 4K8ZA 3L73H 1YHQV 4GCZA 4LCUC 1IBKO 1B7YA 2GSMB 4KUMA 1JMKC 2YIBA 2ARTA 4X1IA 3T1YB 1Q6IA 2AXTZ 3T1HO 2F66C 5DEDA 4YRPA 4X62B 3ZRSA 1VF6C 4KHPO 4YRSA 4J11A 4ZOLA 4MW8A 2IJHA 2M7WA 2IU0A 4DV0O 3BCCH 5H2FZ 3N2GB 1QU7A 4FFKA 2CJ9A 2PMEA 1AI4A 2EIMB 3VBBA 4P75C 2ZXFA 1GM9A 3CRQA 4J42A 2UUBO 3BJUA 4X1KA 4YJ2A 4AILC 1HP8A 1DTOA 1LNQA 5EIBC 4LR3A 1WNLA 2H94A 4LF4B 1KD1W 1Q3EA 2RNBA 5EK0A 1GTOA 5LBQA 4Z1MG 3JAWB 4DV6B 3OR6C 1DF4A 1X01A 3D3IA 2Q73A 3GWKC 4G2KA 3G4SV 1RM1C 3L1AA 4K0KB 2PGGA 2VQEB 4JV5O 3UO2A 1GGMA 5B1AB 1U96A 3H1IH 3L4GA 4J80A 5LMUB 3BABA 1KYOF 3QNEA 2A7WA 2Y48A 3E8FA 3UH0A 2IJJA 3HXYA 5IJ0B 4H2UA 4JYAB 3D36C 4H02A 2QKSA 3BEHA 4LH6A 4FM2A 4IIJB 3E8GA 3LNMB 3CRCA 1PYSB 1FKAO 3REUA 3U11A 1AR1B 3UCSC 4UUJC 2EIKB 1ZL8A 5C8YB 1GN3A 3ZN0A 3E9HA 3FB7C 2NS6A 1TVKB 2Q69A 3JD3A 4DV5B 4G28B 4Z1VA 3R65A 2Y0PA 1RSOB 1Y74B 4LNUB 2ALYA 4DR2O 4XU3A 1V55B 1I94O 2Q9LA 2IBZH 3STZC 3JAKA 1WPYA 1PL4A 1SQBH 4U7NA 3CCSV 5BR8O 4XBFA 1W0JG 3LSSA 3CCUV 3ZMSA 4K35A 2QM4A 4A5UB 4F6EA 3W7SA 1MSWD 1B8AA 2DTHA 4JI4B 4G85A 4LF8B 5KNNA 4GT1A 3NETA 1L1FA 5IYBO 2OWOA 1R1BA 1AI5A 3R66A 2AGAA 1AI7A 1GRJA 1FPOA 4YCUA 1WLEA 1WA8B 4O4LB 1XI1A 2MW2B 2LJ2A 1YJ9V 5D5QA 4GUNA 4PA6A 2WLIA 1ZLZA 4O4JA 5CA0B 5JVDA 2VQFO 1SQVH 4LF5O 1YIJV 1IBKB 3V7RA 4UCUA 2DQ0A 3A74A 3KZIZ 3TEHB 3EXAA 3K9SA 2ZT5A 1G51A 1HW7A 1V9PA 2F95B 1B6QA 1R3JC 1V55C 2Q67A 3H1JH 3T1HB 2DOSA 3R07A 5DN6G 1AI6A 3CCQV 3GVMA 4KHPB 4BAYA 1H4QA 4JTAB 1P7GA 3JCZA 4DV0B 1FFXA 4JTCB 1VQKV 2OT5A 4MTXA 2PUSA 4TSFG 3CXHF 1COWG 4PDVA 2CGNA 3CSXA 2UUBB 3CCEV 2ETNA 2ILMA 4QIWF 4HYOA 2R9AA 4EB6B 3EFFK 2ARHA 5EBLC 1O9HA 3BY6A 5K1XA 4B3MO 5BXZA 4F4LA 2UUAO 3BFMA 2W0FC 3EFRA 4ZTZB 2GUZA 2QWRB 2B1IA 1NR1A 3RN4A 5KUMA 4X88A 4WCEV 4MVRA 4JV5B 1M90W
chains in the Genus database with same CATH topology
4DXWA 1OCRC 2QM8A 2DDZA 4CS4A 1Y66A 1FXKB 4CS3A 1M1KW 2IJKA 4K87A 4LNSA 3KFUA 1PNKA 3HXWA 4HZ3A 4JAVA 1NYQA 2DYSC 3L4GB 3QTCA 5B1OA 1RIQA 4UP9A 5ELNA 4WJ3M 5KUKA 3M99B 1VQ8V 3AG3C 4MVMA 4WFGA 4WFEA 1ENVA 3SPGA 4XTYA 5IDJA 2P67A 4H2YA 2HFEC 4MS2A 3W7XA 3CMAV 5E3IA 4P75A 4YRGA 1SESA 4HWRA 3IG2A 2Q68A 4UVCA 3ASNB 1S3JA 2EWNA 1W0KG 3SPHA 5HFLA 3JD1A 4GX5A 2A9HA 2RHSB 2ODRD 3W3SA 3LUTB 3OMNB 4PA9A 1QLEC 1NVPB 1Q81W 3A31A 4XTWA 4CH5A 1EIYB 4UVAA 2ZT7A 1E79G 3ZRXA 3PCOB 3RIRA 3X2QB 1VQOV 3TEGA 3SPJA 4YRIA 4UPAA 4HVCA 1WQWA 1R3KC 3OMAB 3CMEV 2XOKG 3E8BA 4JTDB 4J15A 4JPRA 5HFMA 2E64A 3ABMC 1K5SA 1NJ6A 3HRIA 5L3EA 4ASUG 3A5ZA 1KOGA 1ROPA 1M56B 3MF1A 1I5XA 4PG3A 2ZZFA 2YEVB 3T4DA 5IY5C 5LHIA 3IC7A 3E35A 2DZCA 3LDDA 3QO5A 2I4NA 2ALYB 4YYEA 1QR8A 2EBOA 3QO8A 1VQLV 2Z3YA 4H2XB 3HFZB 4LVKA 1SRYA 3OMIB 4HWPA 1EZJA 3SYOA 1ADYA 2FTKA 2HKOA 4FPPA 3MF2A 4WF2A 4OP0A 2JJ2G 3VQWA 2ZT6A 1KMNA 2EINC 3D36A 3HPLC 3OUSA 1H2GA 3EHBB 2LP7A 1YFRA 4TVWA 2ZT8A 2LFSA 4P3NA 3IKLA 1CEZA 3M4PA 4CBCA 3RF1A 2UXXA 2CGHA 2A79B 4N23A 4DPGA 5L3CA 4GX2A 4CS2A 1VQNV 11ASA 1PNLA 2EJ9A 3I55V 1NQTA 4YRNA 2AHZA 1G5IA 5EBMC 1NNHA 2XAFA 4P30A 3K9AA 1VQPV 2A8EA 1PL0A 2ZCEA 1YTFD 2DYRB 3PZCA 3ASNC 2AKWB 4YRJA 4R6ZA 5GW7A 1BBWA 4TVAA 2IJIA 4MVUA 1J5WA 1E1TA 4J9YB 1KMMA 1X54A 2ARUA 1N9WA 3CC7V 4ZIBA 3X2QC 1VQMV 2Q7EA 4RDXA 4TQFA 4XU1A 1K4CC 3OM3B 3CXCU 1GK9A 3I7FA 4XEMA 4BIUA 3WQZA 3T2MA 3B77A 3E89A 2DTIA 2WLIB 2DXTA 2A0LA 4EX5A 4YDQA 2DWEC 2DKGA 4RO2A 3E9IA 3VQYA 1OCZB 1M56C 4JF3A 1NH2D 2AMCA 4WI1A 2KB1A 1QLEB 4WFAV 5B3SB 4LVLA 5H6QA 4ZTUB 4WFBV 2Q5HA 3FB8C 1F51A 3WFVA 3RUXA 4HWTA 4L87A 2GHYA 2E5AA 3UKMA 5B1BB 1BIAA 3ABKB 2JIZG 5CMUA 2IW5A 3F5WC 2WLLB 1FXVA 3LDCA 4TWKA 3E8HA 3CD6V 5CBFA 2Y69B 2QEXV 5EC2C 4OXSA 2B1GA 3DSQA 2XAJA 1N8RW 4RMFA 3AG1B 1BL8A 1THZA 3UGTA 5C52B 1QBZA 1S0VA 1E22A 4XTVA 1VQZA 5IY5B 3A0RA 1W66A 2H8PC 2EJGA 2JK5C 5EC1C 3HXXA 1QE0A 5B1NA 1ASYA 3ZN1A 1JVMA 2JEXA 3AG4B 2G4CA 1EFRG 3RVYA 2RHQA 5L3BA 2XTIA 3RACA 4HT4A 1PYSA 5DM6V 3P8TA 2K1EA 3SYCA 3LSQA 2OTLV 1AJPA 4XEOA 1QVFU 1R3LC 5C53B 3CCJV 1H8EG 1FXKA 1H4SA 4PA7A 2D3OW 2DYRC 2WLKA 3CYOA 1YJNV 1X56A 1XL6A 1JJ2U 2ZQMA 4PDMA 1EOVA 1G8MA 2EINB 1JJCA 5H9CA 2DXUA 2E41A 2WLJA 5L3FA 2Q7HA 1L0WA 1SERA 1R73A 3ABLC 3W7TA 2ZXWC 2HVKC 3ZIAG 3GWOA 1Q82W 1Y4MA 2P5IA 3I56V 1WYDA 1NJ2A 2P90A 4YRLA 4H2TA 3RGLA 1KQSU 2PI5A 3RBZA 2EIJC 5KA6A 3ZMVA 4YRRA 4LVIA 2RHSA 1JPXA 4CZZA 4P3PA 2XAHA 2BOBC 3DTUB 1DF5A 1P4RA 3UM7A 3MHSC 1R3IC 1KP3A 2X6AA 2DVEA 1OCZC 1K8AW 1OCOC 2E10A 2EIMC 1VQ9V 1JCHA 1FFTB 2JEUA 5B3SC 1AJNA 3TK1A 2J3MA 1IL2A 3L2ZA 2DEQA 3OGCC 4EKWA 2XGTA 1XL4A 1R6KA 5LGTA 1VQ7V 3REXA 1GKFA 2EZPA 2E65A 3NELA 4YXWG 4PHCA 1EBOA 4MTFA 5B1BC 2Q6AA 3ABKC 4FMTA 3ASOB 1F4NA 3G6EV 1B70A 4P72A 4XU2A 2WLMA 4WF9V 2W6JG 3OEHG 2Y69C 3K79A 1NJ8A 1G4YB 3RVZA 4MT8A 4TQDA 4X5OA 5E1AC 1USYC 3AG1C 1AROP 3P32A 3T1CA 1KKDA 4XDLA 4RUFA 1WQ7A 3P8VA 3TCUA 2IY5A 4G84A 4MVSA 4R50A 1GM7A 4QPJA 1EVKA 2CK3G 3E2EA 3V8KA 1S72V 2C2AA 2LFRA 3OFNG 3RKYA 2ZDIC 1H8HG 2NLJC 3EFSA 1F4MA 4ZKIA 2QHSA 4GX1A 1NR7A 1SZTA 3B8MA 5KA5A 3OD1A 3RKWA 1NVPD 3AG4C 3OEEG 3HFVA 1QF6A 1RPOA 2IU3A 1V54B 1S76D 4AH6A 4RQEA 4PDLA 5CBHA 4JGSA 4PELA 4WFFA 1H4VB 4H2SA 4G27B 5IYDO 5BZBA 1GO3F 1K97A 3IALA 4UXNA 3PJSK 2CJAA 5B1AC 1HXDA 3HXZA 4LBEC 4QE9A 4P71A 4HWSA 5HGQA 1M9NA 2BOCC 3RW0A 3W7WA 1M57C 4YRMA 3FB6C 3SYAA 5J9PC 2HNIA 3HRKA 1HTTA 4P74A 2B5UA 1RM1B 1PD3A 4KP4A 1YHQV 1BMFG 1E1RG 1P7BA 4GCZA 4LCUC 2MK3A 4TWAA 1B7YA 2GSMB 4KUMA 2NNUA 3TEHA 1YTFB 2DZ9A 2X0LA 2FYKA 2ARTA 4MVOA 4Q6GA 1AJQA 4WJ4A 1R6NA 2ODRC 3CPWU 2C7IA 4H37A 3HTZA 1OCCC 3K04A 3ABLB 4YCWA 2ZXWB 3ZMZA 2EIKC 4YRPA 4R7CA 2DQ3A 3ZRSA 3ZMUA 4P2ZA 4YRCA 2YSUB 4KR2A 1KECA 4P73C 4YRSA 1YITV 4X89A 4MW8A 2IJHA 1EFWA 2M7WA 3VOUA 4JYBA 4R8CA 5L3DA 2IU0A 3ASOC 1Z7MA 2PMFA 2EIJB 2P6JA 4YROA 1YFSA 1MG1A 4K88A 3ZJZA 2PI4A 3ZRWA 2HG5C 3QO7A 4JAUA 3ZCCA 1H4TA 2Z5UA 4HAMA 1E1OA 1YSCA 4MVQA 4RAIA 1G5HA 2ZGWA 1NJ1A 1NH2B 2CJ9A 5ELOA 2PMEA 2ARSA 1AI4A 4TT3G 1OCOB 2HR3A 2EIMB 3GB7C 3NXSA 1X55A 3VBBA 2DTOA 4P75C 2ZXFA 1GM9A 3OR7C 4FK5C 4NCXA 3A7UA 4E51A 5C93A 3CC2V 3BJUA 3FYEB 2E3CA 3K03A 4XU0A 3V8JA 2QE7G 1V54C 4E2LA 4TVAB 4YRFA 1DTOA 1LNQA 1RPRA 3SYQA 1WNLA 1Z7NA 2H94A 4TVYA 1KD1W 3RL6A 4H33A 4GX0A 4YCVA 1S5HC 1KC8W 3VQXA 4QE7A 3ETGA 5EK0A 1GTOA 5LBQA 4Z1MG 4J9ZB 5LHGA 3OR6C 1DF4A 1X01A 2J3LA 3D3IA 2EL9A 1CP9A 2ZIMA 4KQEA 1ATIA 3W7UA 2ITCC 3ABUA 4G2KA 3SYPA 3G71V 1S77D 3VQVA 3TUPA 3MHHC 1YJWV 3G4SV 2CJBA 1RM1C 2ZD9A 2AMCB 3L1AA 4CH6A 3K0DA 2OCCB 1JQ0A 3E86A 4UV9A 1GGMA 2JJ1G 1MOFA 1BHBA 5B1AB 1NBMG 1QCEA 3L4GA 2WAMA 3V7SA 4FJCC 4YRTA 3LDEA 2V1DA 4OLFA 1NJ5A 2ZINA 3K3WA 3QNEA 1M57B 2I4OA 2Y48A 3FYIB 3E8FA 3UH0A 1UJWB 3A7RA 2IJJA 3K06A 2WLNA 3HXYA 2ZIOA 4H2UA 1FXHA 2EILB 2HLDG 2ZNJA 4P71C 2ZNIA 4H02A 5L3GA 3ICAA 2QKSA 2ZZEA 2DU7A 3BEHA 12ASA 3JD2A 4UP7A 2RHQB 1KP2A 2UXNA 3E8GA 3K08A 3LNMB 5H6RA 1K73W 4P74C 3CCVV 3K0GA 4XDJA 2WWWA 1PYSB 1OHHG 3REUA 4MSWC 1EIYA 1AR1B 1PNMA 5LHHA 2JDIG 1VQ6V 3WG7B 2ZZGA 3HXVA 1OCCB 4UUJC 3PCOA 4BWAA 4HWOA 2EIKB 2ITDC 5CA3A 2Q5IA 1ZWIC 3ZN0A 4QPKA 3E9HA 3FB7C 1Q7YW 4RQFA 1JJCB 2X6BA 2NS6A 3IKMB 2DWDC 1K92A 2Q69A 4EO4A 4MVZA 1IXMA 2X7RB 3JD3A 5LGNA 3ETDA 2W6IG 2EJFA 1DLBA 1K5QA 1E1QG 4LVMA 4G28B 2YEVA 4WFHA 3R65A 2C8MA 4LP8A 2ALYA 3F7VC 4PA4A 3NENA 4TTVA 3G1ZA 3HFZA 3SJQC 3FJPA 3MQZA 4XU3A 2WPDG 1V55B 2DW4A 1K3EA 2WLHA 3F7YC 1K4DC 3STZC 2I4LA 2P7TC 4H2WA 4YRKA 3FB5C 1WPYA 2OCCC 2EJRA 4U7NA 1YI2V 2OTJV 3CCSV 4DO2A 4LC1A 1CPYA 4XBFA 1W0JG 3LSSA 3CCUV 3E83A 3ZMSA 3OAAG 1B70B 1FS0G 3AG2B 3W7SA 1MSWD 1B8AA 1X2HA 2ZR2A 1K7DA 2QTOA 3JD4A 1YB3A 2DTHA 4G85A 4PA3A 1VQ4V 1J95A 2IY5B 4CH4A 5KNNA 2F43G 4XTXA 4YRQA 2EILC 4GT1A 3HXUA 3NETA 5FL7G 1L1FA 1HC7A 5IYBO 4XTZA 4P3OA 1WPXA 1JX9A 2AKWA 1W2BU 3CMQA 1AI5A 3T4ZA 2EZOA 1F23A 2QM7A 3B8NA 4Q20A 3P30A 1YFTA 1AI7A 1BBUA 4U7OA 2DJZA 2V7QG 3ZRVA 4XDKA 4YCUA 1NJIW 3AEIA 3OE7G 1WLEA 3ERRA 3P8YA 2IH3C 2XNDG 3WG7C 2XASA 3CCRV 2ZTGA 1FXKC 1YJ9V 3ABTA 4BW5A 3HY1A 3OUFA 3RKXA 1VQ5V 5C51B 4K86A 4PA6A 1EQRA 2WLIA 3JD0A 3DGEA 2AHYA 2EAYA 2QHVA 4H2VA 1NKDA 3UGQA 4N21A 5F5WA 2QHTA 1HWYA 2DU5A 5CN0A 4O2DA 1K9MW 3UFGA 2ZR3A 1YIJV 5K1PA 1X2GA 4CH3A 4KR3A 3MD0A 4FIPC 1B7YB 2XAGA 2R9IA 3V7RA 1MABG 2DQ0A 1OCRB 2Q7GA 3A74A 3TEHB 4YREA 1PKXA 3IFXA 1K33A 2ZT5A 1G51A 3V8LA 3CCLV 4P9OA 2WLLA 1B6QA 1BIBA 2DYSB 1R3JC 1V55C 3SPCA 2Q67A 5LGUA 3ETEA 3JYCA 4MTGA 3HB3B 4JYCA 4P9PA 3IGAC 4ZBMA 5CBGA 1USYA 1WU7A 3AG3B 3R07A 1YGBA 5DN6G 3M4QA 1AI6A 1GM8A 1QLNA 4UVBA 3CCQV 2QA4V 1FYFA 4Q15A 3KG2A 4BAYA 1H4QA 4XTUA 2ZDIA 3A32A 4P72C 4KFMA 4QNHB 1TUEB 4JTAB 3JCZA 2CIMA 4I9WA 2IH1C 4JTCB 3AG2C 2ATKC 1VQKV 3ZRWB 3ZMTA 4QJFB 2OT5A 4MTXA 3OW2U 1QVGU 1NYRA 4DQ2A 1SETA 2X6CA 1Q86W 4I5SA 3A7AA 2HJFC 5IYCO 4TSFG 3SPIA 1COWG 1K34A 3FKSG 4YP0A 4PDVA 3CCEV 1B76A 1H38A 2XAQA 4QIWF 4BW9A 4HYOA 1EVLA 4UP8A 3ABMB 3EFFK 4LVJA 1ASZA 2I4MA 4MTOA 5EBLC 3CCMV 1JOYA 1ADJA 3CP1A 1BHAA 1LYLA 2WSSG 3BY6A 3TETA 1E24A 4RUEA 3STLC 5K1XA 1QR9A 4BIZA 4JASA 3V7CA 1ORQC 2E1HA 3H01A 4MW3A 1GMGA 3BFMA 3ML0A 4F4LA 3MEYA 2W0FC 4HA8A 4H2XA 4UV8A 3LC0A 3EFRA 3NEMA 4ZTZB 4YPFA 1C0AA 3CC4V 2B1IA 4X8AA 3HY0A 1NR1A 4PDRA 5KUMA 1I5YA 2P0LA 2R9RB 2QHUA 4X88A 3A5YA 4WCEV 4MVRA 5EBWC 2HVJC 1OZ0A 1M90W 4P73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DDZ A;  4CS4 A;  4CS3 A;  4LNS A;  4K87 A;  3KFU A;  3HXW A;  1NYQ A;  3L4G B;  3QTC A;  1RIQ A;  4UP9 A;  5ELN A;  4XTY A;  4H2Y A;  5E3I A;  4YRG A;  4P75 A;  1SES A;  4HWR A;  3IG2 A;  2EWN A;  2RHS B;  2ODR D;  3W3S A;  3A31 A;  4XTW A;  4CH5 A;  1EIY B;  2ZT7 A;  3PCO B;  3RIR A;  3TEG A;  4YRI A;  4UPA A;  4HVC A;  1WQW A;  4J15 A;  2E64 A;  1NJ6 A;  3HRI A;  3A5Z A;  1KOG A;  3MF1 A;  4PG3 A;  2ZZF A;  2DZC A;  3QO5 A;  2I4N A;  2ALY B;  4YYE A;  3QO8 A;  4H2X B;  3HFZ B;  1SRY A;  4HWP A;  1ADY A;  3MF2 A;  4WF2 A;  4OP0 A;  3VQW A;  2ZT6 A;  1KMN A;  1YFR A;  4TVW A;  2ZT8 A;  4P3N A;  3IKL A;  3M4P A;  3RF1 A;  2CGH A;  4DPG A;  4CS2 A;  11AS A;  2EJ9 A;  4YRN A;  1G5I A;  1NNH A;  2ZCE A;  3PZC A;  2AKW B;  4YRJ A;  1BBW A;  4TVA A;  1J5W A;  1E1T A;  1KMM A;  1X54 A;  2ARU A;  1N9W A;  4ZIB A;  4RDX A;  2Q7E A;  4TQF A;  4XU1 A;  3I7F A;  4XEM A;  3WQZ A;  2DTI A;  4EX5 A;  2DXT A;  4YDQ A;  2DKG A;  3E9I A;  3VQY A;  2AMC A;  4WI1 A;  4ZTU B;  2Q5H A;  3RUX A;  4HWT A;  4L87 A;  2E5A A;  1BIA A;  3DSQ A;  4RMF A;  3UGT A;  5C52 B;  1E22 A;  4XTV A;  1VQZ A;  1W66 A;  2EJG A;  3HXX A;  1QE0 A;  1ASY A;  2G4C A;  2RHQ A;  3ICA A;  2XTI A;  3RAC A;  1PYS A;  3P8T A;  3LSQ A;  5C53 B;  1H4S A;  1X56 A;  1JJC A;  1EOV A;  2Q7H A;  2DXU A;  1L0W A;  2E41 A;  1SER A;  2P5I A;  1WYD A;  1NJ2 A;  4YRL A;  4H2T A;  3RGL A;  4YRR A;  2RHS A;  4P3P A;  2DVE A;  2E10 A;  2J3M A;  1IL2 A;  3L2Z A;  2DEQ A;  2XGT A;  3REX A;  2E65 A;  3NEL A;  4PHC A;  4P72 A;  1B70 A;  4XU2 A;  1NJ8 A;  4X5O A;  4TQD A;  1USY C;  1WQ7 A;  3P8V A;  2IY5 A;  4G84 A;  1EVK A;  3V8K A;  3RKY A;  3EFS A;  4H2X A;  2QHS A;  3OD1 A;  3RKW A;  4WJ3 M;  1QF6 A;  3HFV A;  4AH6 A;  4RQE A;  1H4V B;  4H2S A;  3IAL A;  2CJA A;  1HXD A;  3HXZ A;  4P71 A;  5HGQ A;  4HWS A;  4YRM A;  2HNI A;  3HRK A;  1HTT A;  4P74 A;  4TWA A;  1B7Y A;  3TEH A;  2DZ9 A;  2FYK A;  2ART A;  4Q6G A;  4WJ4 A;  2ODR C;  2C7I A;  3HTZ A;  4YCW A;  4YRP A;  2DQ3 A;  4YRC A;  4KR2 A;  4P73 C;  4YRS A;  1EFW A;  1Z7M A;  2PMF A;  4YRO A;  1YFS A;  4K88 A;  3QO7 A;  1H4T A;  1E1O A;  1G5H A;  2ZGW A;  1NJ1 A;  2CJ9 A;  5ELO A;  2PME A;  2ARS A;  1X55 A;  3VBB A;  2DTO A;  4P75 C;  2ZXF A;  4NCX A;  3A7U A;  4E51 A;  3BJU A;  2E3C A;  4XU0 A;  3V8J A;  4TVA B;  4YRF A;  1WNL A;  1Z7N A;  4TVY A;  3RL6 A;  4YCV A;  3VQX A;  1X01 A;  2J3L A;  2EL9 A;  2ZIM A;  4KQE A;  1ATI A;  3VQV A;  3TUP A;  2CJB A;  4CH6 A;  2AMC B;  3L1A A;  1GGM A;  3L4G A;  3V7S A;  4YRT A;  4OLF A;  1NJ5 A;  2ZIN A;  3QNE A;  3UH0 A;  3A7R A;  3HXY A;  2ZIO A;  4H2U A;  2ZNJ A;  4P71 C;  2ZNI A;  4H02 A;  2ZZE A;  2DU7 A;  12AS A;  4UP7 A;  2RHQ B;  4P74 C;  1PYS B;  3REU A;  1EIY A;  2ZZG A;  3HXV A;  3PCO A;  4BWA A;  4HWO A;  2Q5I A;  3E9H A;  1JJC B;  4RQF A;  3IKM B;  4EO4 A;  2EJF A;  2C8M A;  2ALY A;  3NEN A;  4TTV A;  3G1Z A;  3HFZ A;  3FJP A;  4XU3 A;  2I4L A;  4H2W A;  4YRK A;  1WPY A;  3LSS A;  1B70 B;  1X2H A;  1B8A A;  2I4O A;  4XEO A;  2ZR2 A;  2DTH A;  1YB3 A;  4G85 A;  2IY5 B;  4CH4 A;  5KNN A;  4XTX A;  4YRQ A;  3HXU A;  3NET A;  1HC7 A;  4XTZ A;  4P3O A;  2AKW A;  3CMQ A;  1YFT A;  1BBU A;  2DJZ A;  4YCU A;  1WLE A;  3ERR A;  3P8Y A;  2ZTG A;  3HY1 A;  3RKX A;  5C51 B;  4K86 A;  1EQR A;  2EAY A;  2QHV A;  4H2V A;  3UGQ A;  5F5W A;  2QHT A;  2DU5 A;  4O2D A;  3UFG A;  2ZR3 A;  5K1P A;  1X2G A;  4CH3 A;  4KR3 A;  1B7Y B;  3V7R A;  2DQ0 A;  3A74 A;  2Q7G A;  3TEH B;  4YRE A;  2ZT5 A;  3V8L A;  1G51 A;  1BIB A;  1USY A;  1WU7 A;  3R07 A;  1YGB A;  3M4Q A;  1FYF A;  4Q15 A;  1H4Q A;  4XTU A;  3A32 A;  4P72 C;  2CIM A;  4DQ2 A;  1NYR A;  1SET A;  3A7A A;  4YP0 A;  1B76 A;  4BW9 A;  1EVL A;  4UP8 A;  1ASZ A;  2I4M A;  1ADJ A;  1LYL A;  1E24 A;  5K1X A;  3V7C A;  2E1H A;  3MEY A;  3BFM A;  4HA8 A;  3LC0 A;  3EFR A;  3NEM A;  4ZTZ B;  4YPF A;  1C0A A;  3HY0 A;  2P0L A;  3A5Y A;  2QHU A;  4P73 A; 
#chains in the Genus database with same CATH topology
 3B40 A;  2IJK A;  1Z5W A;  3KFU A;  1NYQ A;  4YIP A;  4UP9 A;  5KUK A;  4B3S O;  3M99 B;  3JAL B;  3SPG A;  4XTY A;  1UPG A;  2YXL A;  3W7X A;  3CMA V;  4P75 A;  1SES A;  4HWR A;  4GKK O;  2NN4 A;  1S3J A;  2EWN A;  2CE4 A;  4IYH A;  3RYF A;  3SPH A;  1DK1 A;  2A9H A;  2ODR D;  3OMN B;  1NVP B;  1QLE C;  4XTW A;  5CB4 B;  1AR4 A;  1BT8 A;  4RWU A;  1ZTE A;  4HVC A;  1R3K C;  3CME V;  2XOK G;  2OYQ A;  1RP3 B;  3LSU A;  4BR6 A;  4JPR A;  2BE3 A;  5HFM A;  1NJ6 A;  1KOG A;  2P5O A;  5FNV B;  1M56 B;  1I5X A;  4PG3 A;  2YEV B;  5IY5 C;  1MSD A;  1NTM H;  3LDD A;  3QO5 A;  4YYE A;  4DR2 B;  3HFZ B;  1I94 B;  1EZJ A;  4FLX A;  4HWP A;  2HKO A;  3SDL A;  2ZE6 A;  3TXS A;  1XNQ O;  4OP0 A;  5BR8 B;  4X64 O;  3D36 A;  3HPL C;  3OUS A;  1HNX O;  2LFS A;  4LF9 O;  2UXX A;  4LFC B;  4CS2 A;  3N2G A;  4JI2 O;  1PNL A;  3I55 V;  1I0H A;  1G5I A;  5EBM C;  2XAF A;  3A8T A;  3K9A A;  1VQP V;  2AKW B;  1TAE A;  5GW7 A;  1BBW A;  1IXB A;  1FJG O;  1X54 A;  1GAX A;  2ARU A;  3CC7 V;  4ZIB A;  2Q7E A;  4TQF A;  3JAW A;  3OM3 B;  4XEM A;  1W59 A;  3WQZ A;  4EFB A;  4EX5 A;  2DXT A;  1B3Q A;  2VQF B;  1M56 C;  4JF3 A;  2KB1 A;  5B3S B;  2H3O A;  4LF5 B;  4LVL A;  5H6Q A;  1YCI A;  4WFB V;  3BPZ A;  4L87 A;  3ABK B;  2JIZ G;  2IW5 A;  3F5W C;  3E8H A;  4YJ2 B;  2Y69 B;  2QEX V;  5EC2 C;  3DSQ A;  2XAJ A;  1SQG A;  4DV1 O;  5IJ0 A;  2YC0 A;  2H8P C;  1VEW A;  4IIJ A;  1ASY A;  2JEX A;  2Y0I A;  1PYS A;  4D7T A;  3SYC A;  3LSQ A;  4I0X B;  2OIG A;  5C8Y A;  1H4S A;  2D3O W;  1XL6 A;  1D5N A;  1EOV A;  1TVK A;  2Q7H A;  2CGO A;  4AHC A;  3ABL C;  3W7T A;  2ZXW C;  3GWO A;  1Q82 W;  2P5I A;  1X59 A;  5GON B;  2P90 A;  4YRL A;  2CAZ C;  1RSO A;  1Y74 A;  4LNU A;  4B3M B;  2EIJ C;  4FM0 A;  4CZZ A;  2UUA B;  4P3P A;  4I4T B;  5KHH A;  3L74 H;  2AZ2 A;  1OCO C;  1VQ9 V;  2QTS A;  5B3S C;  1NTZ H;  2CTW A;  2RDC A;  4UCT A;  4EKW A;  3L71 H;  1XL4 A;  5LGT A;  1ZUQ A;  4YXW G;  1GN4 A;  4MTF A;  3ABK C;  4FMT A;  5IE9 A;  2WLM A;  4WF9 V;  4NYK A;  3OEH G;  2Y69 C;  3SR2 C;  1XUQ A;  4X5O A;  4B3S B;  1KKD A;  4GKJ O;  4RUF A;  1EVK A;  1GM7 A;  5LP6 C;  2LFR A;  3OFN G;  2ZDI C;  4GKK B;  4H2X A;  1F4M A;  3OD1 A;  5KA5 A;  1NVP D;  1V54 B;  4AH6 A;  1MNG A;  4RQE A;  4PDL A;  5CBH A;  4PEL A;  2QWN B;  2YUA A;  4G27 B;  4O4L A;  5J2T B;  2QGN A;  3PJS K;  3HXZ A;  3QVN A;  2VWJ A;  5CA0 A;  3RW0 A;  1M57 C;  4U3J B;  2HNI A;  3HRK A;  4P74 A;  2LGW A;  4TWA A;  2F23 A;  2MK3 A;  3EVK A;  3TEH A;  2AW9 A;  2X0L A;  4JZ2 A;  4Q6G A;  3UT5 B;  4WJ4 A;  3HTZ A;  4ABM A;  1OCC C;  3ZMZ A;  1MA1 A;  4LF4 O;  2PTM A;  1XNQ B;  4DR6 O;  2YSU B;  3G67 A;  4X64 B;  3VOU A;  2PMF A;  1HNX B;  4UCR A;  1YFS A;  4YRO A;  4LF9 B;  1MG1 A;  4K88 A;  3ETQ A;  1KB9 F;  2HG5 C;  1H4T A;  2Z5U A;  4JI2 B;  1NJ1 A;  1NH2 B;  1SF9 A;  3IC9 A;  2ARS A;  2HR3 A;  1X55 A;  2YIB D;  4NCX A;  3CC2 V;  4FVM A;  3FYE B;  1V54 C;  4E2L A;  4TVA B;  4YRF A;  4EB6 A;  1Z7N A;  5TIS Z;  5E79 Z;  1FJG B;  3VQX A;  1KC8 W;  4QE7 A;  2A06 H;  4FLY A;  2J3L A;  4JI7 O;  3W7U A;  1S77 D;  4JI6 O;  1BZK A;  3MHH C;  4DR7 O;  5JCO C;  4CH6 A;  3KCY A;  2ZD9 A;  2CJB A;  2F93 B;  3OD4 A;  1JQ0 A;  3E86 A;  5F2V O;  1MOF A;  1BHB A;  1YZB A;  1NBM G;  3V7S A;  4YRT A;  2V1D A;  3ZHV A;  4OLF A;  2P22 C;  3JAL A;  3FYI B;  1UJW B;  4DV1 B;  2EIL B;  4OPH A;  2ZNJ A;  4P71 C;  2GBO A;  1IBL O;  3O9O A;  1PP9 H;  3CX5 F;  1OJH A;  5KHG A;  2DE0 X;  4UP7 A;  2RHQ B;  1KP2 A;  5H6R A;  4U3F H;  3CCV V;  2BTO A;  5CB4 A;  2N04 A;  2QKC A;  3HXV A;  4WBN B;  4OGQ B;  1YEW A;  1J5E O;  1Y6X A;  2Q5I A;  1ZWI C;  3IKM B;  3ZX6 A;  4ZI7 B;  1K92 A;  2EJF A;  3ETD A;  2W6I G;  3SJC C;  5FNV A;  2PY5 A;  4LVM A;  1RFY A;  2YEV A;  2C8M A;  3ZHU A;  2JVD A;  4FFB B;  4PA4 A;  4TTV A;  1SQF A;  1LUW A;  1XHZ A;  3FJP A;  3HFZ A;  2DW4 A;  3IJ4 A;  2WLH A;  2P7T C;  4UB8 Z;  1OV9 A;  3FB5 C;  4O2B B;  2E76 B;  1N0J A;  3E83 A;  4PV1 B;  1X2H A;  2I4O A;  4I55 B;  1K7D A;  3JD4 A;  4EEQ A;  4PI2 A;  1US6 A;  4GKJ B;  1L0N H;  2F43 G;  5GTH Z;  4XTX A;  4YRQ A;  2EIL C;  3HXU A;  5FL7 G;  1AR5 A;  1HC7 A;  3BA9 A;  4XTZ A;  2AKW A;  1YXB A;  3T4Z A;  2QM7 A;  3P30 A;  1Y67 A;  5BMV B;  1B04 A;  3ZRV A;  4XDK A;  3E22 B;  4DV3 O;  1FXK C;  5C51 B;  5KLV H;  3OUF A;  3ZHQ A;  2EJ7 A;  3JD0 A;  4H2V A;  3UGQ A;  2UXC O;  2ADP A;  3TGU H;  4O2D A;  3UFG A;  1N34 O;  4B7E A;  5K1P A;  1PPJ H;  4CH3 A;  1FAF A;  3MD0 A;  5JJE B;  1OCR B;  2Q7G A;  5BY1 A;  1PKX A;  4YRE A;  4P9O A;  2DYS B;  5J2U B;  4JYC A;  4P9P A;  3IGA C;  4DV4 O;  1YGB A;  3M4Q A;  4DR6 B;  1GM8 A;  3H1L H;  4UVB A;  1FYF A;  1G6U A;  3KG2 A;  4Q15 A;  2ZDI A;  2DJV A;  2IH1 C;  1QVG U;  3ZRW B;  4GZR B;  1EZV H;  4QJF B;  3CRR A;  4I0X A;  2Q0O C;  3JSL A;  2ZE7 A;  3SPI A;  1K34 A;  4ICG A;  4YP0 A;  2WA3 A;  5EYP B;  1NT2 B;  5A9G A;  1IVS A;  1B76 A;  1EM1 A;  1H38 A;  4BW9 A;  4DR3 O;  4J10 A;  3DC6 A;  2QJ1 A;  2I4M A;  4MTO A;  1JOY A;  1LYL A;  5GON A;  3C3S A;  4O4H B;  1BHA A;  1LR1 A;  5IWA O;  3TET A;  4RUE A;  4JAS A;  2E1H A;  2N74 A;  3RFR A;  4UCO A;  4DV7 O;  4I4T A;  3N2K B;  4UV8 A;  4JI7 B;  3LC0 A;  2PZS A;  4JI6 B;  1KU9 A;  4QGP A;  4YPF A;  3RYH B;  3HY0 A;  4DR7 B;  4CC6 A;  2HVJ C;  1OCR C;  1Y66 A;  4X9Q A;  2FKX A;  4CS3 A;  1M1K W;  4LNS A;  4HZ3 A;  2DYS C;  2VRZ A;  5JQG B;  5ELN A;  4DRX B;  1NS1 A;  1T5E A;  2BSK B;  1S5J A;  1ENV A;  5IDJ A;  2F4V O;  5E3I A;  1IBL B;  3IG2 A;  4GYC B;  4OX9 O;  3A31 A;  1Q81 W;  5B66 Z;  3PN1 A;  1EIY B;  1PV0 A;  2ZT7 A;  5J2T A;  1E79 G;  3PCO B;  3SPJ A;  4YRI A;  4UPA A;  1J5E B;  3OMA B;  3E8B A;  4J15 A;  4O2A B;  4U3J A;  5L3E A;  3A5Z A;  3BRC A;  4LFC O;  2ZZF A;  1MZE A;  3T4D A;  3CS5 A;  3IC7 A;  1KKC A;  3LNN A;  2I4N A;  4LF7 O;  2EBO A;  4NVP A;  2Z3Y A;  3UT5 A;  4H2X B;  4LVK A;  1SRY A;  1BQZ A;  3OT7 A;  5EIB D;  3SYO A;  1ZX3 A;  1ADY A;  3MF2 A;  3FD9 A;  4WF2 A;  2JJ2 G;  1AVM A;  1KMN A;  4LF6 O;  3CWB H;  1X4T A;  1CEZ A;  3RF1 A;  2CGH A;  4N23 A;  4GX2 A;  2EJ9 A;  2QKA A;  2UUC O;  4P30 A;  1XOU A;  3JAM N;  3J80 N;  4R6Z A;  5LYJ B;  4TVA A;  2R70 A;  4HBN A;  1PM9 A;  4LH7 A;  2PF4 E;  1N9W A;  1AP6 A;  4I9Q A;  1WNS A;  4DV3 B;  1H2N A;  3CXC U;  1GK9 A;  2QR4 A;  3I7F A;  3T2M A;  3B77 A;  3E89 A;  3S3X A;  4YDQ A;  1FYJ A;  1HR0 O;  4RO2 A;  3E9I A;  3VQY A;  2UXC B;  2Q0A A;  1QLE B;  4K8X A;  1N34 B;  2YI9 A;  2JGD B;  3FB8 C;  1WJZ A;  2KKW A;  3UKM A;  5B1B B;  5AG2 A;  2WLL B;  1FXV A;  3LDC A;  1Q8I A;  2YIC A;  5CBF A;  2B1G A;  1N8R W;  3KKY A;  1THZ A;  2FML A;  1Q6U A;  3FAV B;  4DV4 B;  3UGT A;  4DYL A;  4XTV A;  3P3P A;  5IY5 B;  1A32 A;  2YI8 A;  1W66 A;  3C3T A;  3ZBH A;  2RHQ A;  4NR1 A;  3RVY A;  3RAC A;  3P8T A;  1M93 A;  4B7K A;  1QVF U;  1M4U A;  5C53 B;  1WB7 A;  4WBN A;  1H8E G;  1FXK A;  4FLZ A;  1Q90 D;  1VF6 A;  3CYO A;  2DN9 A;  3JAR B;  4PDM A;  2JS3 A;  4PI0 A;  5H9C A;  2DXU A;  4ZI7 A;  4DR3 B;  1SER A;  3SJA C;  1VF5 B;  1IX9 A;  3I56 V;  1WYD A;  5IWA B;  2PI5 A;  1XDC A;  5KA6 A;  4FFB A;  1P49 A;  3ZMV A;  4YRR A;  4LVI A;  5LA6 B;  2RHS A;  4DV7 B;  2XAH A;  3DTU B;  1SA0 B;  1P4R A;  3MHS C;  2E10 A;  4O2B A;  1FFT B;  3TK1 A;  2RCV A;  2DEQ A;  1VQ7 V;  3NEL A;  3G6E V;  1JJO A;  5B1B C;  3ASO B;  1F4N A;  2W6J G;  4I55 A;  1NJ8 A;  1G4Y B;  4LWS B;  4MT8 A;  1USY C;  1ARO P;  1VAR A;  3TCU A;  1L0L H;  2F4V B;  2CK3 G;  2C2A A;  3RKY A;  1MMM A;  1H8H G;  4ZKI A;  4WJ3 M;  1SZT A;  3B8M A;  4OX9 B;  5BMV A;  1S76 D;  1H4V B;  1QNM A;  3E22 A;  3L70 H;  2JGU A;  5IYD O;  4JI5 O;  5BZB A;  2QDO A;  3IAL A;  2CJA A;  4FLW A;  4UFZ A;  4LBE C;  4QE9 A;  4W4L A;  2BOC C;  4UCS A;  3WB0 A;  3FB6 C;  2Y4U A;  3JAT B;  1HTT A;  2RQ6 A;  1PD3 A;  1E1R G;  3K5N A;  2NNU A;  4LF7 B;  3U0Z A;  1YTF B;  2FYK A;  4MVO A;  1AJQ A;  5J2U A;  1D2D A;  2C7I A;  1Z2G A;  4H37 A;  3ABL B;  2ZXW B;  5KHJ A;  2DQ3 A;  2LW7 A;  3ZMU A;  4X20 B;  1KEC A;  1YIT V;  4X89 A;  4JYB A;  5L3D A;  4LF6 B;  3ASO C;  4FLU A;  2EIJ B;  3ZJZ A;  2L6L A;  3ZRW A;  3JAS B;  4JAU A;  4HAM A;  4MVQ A;  2ZGW A;  5ELO A;  1OCO B;  3GB7 C;  3NXS A;  2UUC B;  4W4K A;  3G6B A;  5EYP A;  3OR7 C;  4FK5 C;  5C93 A;  2Q4P A;  3K03 A;  4XU0 A;  2BCC H;  4O4H A;  4H33 A;  4GX0 A;  4YCV A;  2RMK B;  1S5H C;  3ETG A;  4JI0 O;  2ZKO A;  5LP6 B;  1L8D A;  2EL9 A;  3THO A;  3N2K A;  4H13 B;  1HR0 B;  1ATI A;  3SYP A;  3ABU A;  4X1Y A;  5KX5 B;  3TUP A;  3RYH A;  2ZE5 A;  3K0D A;  3MAQ A;  1BCC H;  4DUZ O;  1WP8 A;  4UV9 A;  2JJ1 G;  3A2F A;  4H44 B;  1QCE A;  4FJC C;  3AK3 A;  5JQG A;  3LDE A;  4DRX A;  1TUB B;  1NJ5 A;  1M57 B;  3K59 A;  2BSK A;  2UXB O;  3K06 A;  4NXM O;  1FXH A;  2ZNI A;  5L3G A;  2IM9 A;  2ZZE A;  2HEP A;  12AS A;  3K08 A;  3L9D A;  4LFB O;  3K0G A;  4XDJ A;  2WWW A;  4MSW C;  1EIY A;  1PNM A;  1KUQ A;  2R72 A;  2JDI G;  5LHH A;  2ZZG A;  3PCO A;  1OCC B;  4HWO A;  4DV2 O;  2ITD C;  5CA3 A;  4QPK A;  1ZAU A;  1JJC B;  1Q7Y W;  4RQF A;  2X6B A;  4O2A A;  4CC5 A;  4MVZ A;  1IXM A;  2X7R B;  5LGN A;  3HKB B;  1K5Q A;  2D2C B;  4NKG B;  4WFH A;  1WPB A;  3F7V C;  2P06 A;  3NEN A;  1Q5O A;  5IYZ B;  4F6R B;  3MQZ A;  3H1K H;  3TXQ A;  1K4D C;  2UXD B;  4H2W A;  4YRK A;  3L75 H;  3OTO O;  1YI2 V;  4DO2 A;  5LXT B;  1CPY A;  2FB5 A;  3OAA G;  3B2E E;  1B70 B;  3AG2 B;  4XEO A;  2ZR2 A;  1YB3 A;  1VQ4 V;  1H2K A;  1J95 A;  3ZED A;  4CH4 A;  4TUY A;  1O9G A;  1WPX A;  1XBL A;  1JX9 A;  1W2B U;  3CMQ A;  2XHB A;  2EZO A;  2M6Y A;  5LYJ A;  3B8N A;  1YFT A;  1BBU A;  2DJZ A;  2V7Q G;  3ERR A;  4JI5 B;  3ABT A;  3HY1 A;  2PYJ A;  4K86 A;  1EQR A;  2V4D A;  3DGE A;  2EAY A;  2QHV A;  1NKD A;  5F5W A;  4B3T O;  2DU5 A;  3RWR D;  1K9M W;  2ZR3 A;  3HKD B;  2JGD A;  2XAG A;  1K33 A;  3CCL V;  2WLL A;  1BIB A;  2CH7 B;  3ETE A;  2Z0A A;  4MTG A;  1USY A;  4ZBM A;  2E74 B;  3FAV A;  1WU7 A;  1XMO B;  5KAF Z;  1QLN A;  3DXR B;  4K3A A;  4JYY A;  3A32 A;  4KFM A;  1IBM O;  4I9W A;  3J7A U;  3RGB A;  1N32 O;  3AG2 C;  1P84 F;  3ZMT A;  3OW2 U;  4I50 B;  5EZY B;  4GLX A;  3A7A A;  2HJF C;  5IYC O;  3FKS G;  1XRE A;  2HJD A;  3JAR A;  3CRA A;  2LQT A;  1EVL A;  4LVJ A;  4NTX A;  3CCM V;  3CP1 A;  2P4V A;  1E24 A;  4JI0 B;  1QR9 A;  3V7C A;  4MW3 A;  5LA6 A;  1GMG A;  3ML0 A;  4HA8 A;  1SA0 A;  1C0A A;  1BE3 H;  4PDR A;  1EN5 A;  1OZ0 A;  4DUZ B;  3K5L A;  2DDZ A;  4CS4 A;  1YF2 A;  1FXK B;  3Q4H B;  2UU9 O;  3QTC A;  5B1O A;  3QG5 A;  4LWS A;  2GDS A;  4ZHQ B;  5KMG B;  3K5O A;  4WFG A;  2UXB B;  1MZF A;  2ZE8 A;  4NXM B;  4YRG A;  2Y4T A;  1XNR O;  2Q68 A;  2RHS B;  2L35 A;  3FX7 A;  4LFB B;  3LUT B;  4CH5 A;  4UVA A;  1KMI Z;  1WAZ A;  3ZRX A;  3TEG A;  1VQO V;  2FYU H;  4DV2 B;  1Q6H A;  2W0X A;  1WQW A;  3M8A A;  4DK0 A;  4FLV A;  4JTD B;  1NTK H;  2E64 A;  3BA8 A;  3JAT A;  4ASU G;  5LHI A;  2ADQ B;  2DZC A;  1HNW O;  1QR8 A;  5FPO A;  1VQL V;  2P4K A;  1N36 O;  1H2L A;  3OTO B;  3VQW A;  4X20 A;  2ZT6 A;  2KQX A;  3CEI A;  2EIN C;  3EHB B;  2LP7 A;  1YFR A;  4TVW A;  2ZT8 A;  3IKL A;  3M4P A;  3JAS A;  4FZ0 A;  2OIE A;  11AS A;  1VQN V;  4YRN A;  1NNH A;  3WB2 A;  3C90 A;  2A8E A;  1TGO A;  3S3W A;  3PZC A;  3O65 A;  4YRJ A;  1BQ0 A;  2BTQ B;  1GN2 A;  2QWP B;  3WU2 Z;  2KG7 B;  3A0H Z;  1J5W A;  1KMM A;  3CB2 A;  4RDX A;  4XU1 A;  1NZ6 A;  5LP6 A;  3BFR A;  2XUM A;  1XIL A;  4DR1 O;  5KX5 A;  3RYC A;  1OCZ B;  1NH2 D;  4B3T B;  4WFA V;  3HKC B;  4ZTU B;  1TA8 A;  2Q5H A;  1F51 A;  3WFV A;  2GHY A;  1BIA A;  4HNA B;  5JJJ B;  5KHI A;  3CD6 V;  1TUB A;  4L8J A;  4RMF A;  3AG1 B;  1BL8 A;  5C52 B;  4TV8 B;  3A0R A;  2JK5 C;  5EC1 C;  3HR0 A;  1QE0 A;  3ZN1 A;  1JVM A;  3AG4 B;  1IBM B;  1N32 B;  1IZ3 A;  1EFR G;  3K5M A;  2G4C A;  4HT4 A;  2K1E A;  4X1Y B;  1AJP A;  1R3L C;  3CCJ V;  1JFF A;  1X56 A;  4JI8 O;  2ZQM A;  1JJC A;  1G8M A;  1M5I A;  2E41 A;  2WLJ A;  5L3F A;  1R73 A;  3HKB A;  2HVK C;  1Y4M A;  3ZS8 C;  1N0N A;  4H2T A;  4UCV A;  4TV9 B;  1G1X B;  5IYZ A;  4F6R A;  2JRI A;  5IJ9 B;  4FM1 A;  2YS8 A;  3L72 H;  1R3I C;  1OCZ C;  1K8A W;  2CDY A;  2CUG A;  2EIM C;  2J3M A;  1AJN A;  1S5L Z;  3L2Z A;  5CA1 B;  2XGT A;  5LXT A;  1R6K A;  1YVW A;  1GKF A;  2EZP A;  4DUY O;  5JH7 B;  2ZT9 B;  2A3Q A;  2Q6A A;  2UU9 B;  1B70 A;  4XU2 A;  1QHT A;  1VMG A;  4KL1 A;  3NR7 A;  5E1A C;  3AG1 C;  3P8V A;  4XDL A;  4G84 A;  5JCO A;  4QPJ A;  4NXN O;  3AK1 A;  2VS0 A;  3E2E A;  2NLJ C;  1XNR B;  3RKW A;  4GX1 A;  3AG4 C;  3HFV A;  3P3N A;  3A0B Z;  4PHZ A;  4JGS A;  4WFF A;  1GO3 F;  1K97 A;  3SJB C;  5B1A C;  1HXD A;  3APQ A;  4P71 A;  4HWS A;  5HGQ A;  3SYA A;  4YHH O;  5KHK A;  5ITZ B;  1WN7 A;  4KP4 A;  1B06 A;  1BMF G;  3HKD A;  1P7B A;  1HNW B;  4TUY B;  2DZ9 A;  2HHH O;  1NU1 H;  2NR5 A;  3UQ8 A;  1R6N A;  1GN6 A;  2CH7 A;  2ODR C;  4Z2W A;  3CPW U;  1N36 B;  3K04 A;  4YCW A;  2GV9 A;  2EIK C;  4R7C A;  3DXR A;  4P2Z A;  1VIB A;  4YRC A;  4KR2 A;  4P73 C;  1SKV A;  1EFW A;  4R8C A;  1Z7M A;  2P6J A;  2QSA A;  4J7J A;  5LMN O;  2PI4 A;  3QO7 A;  3ZCC A;  2DMX A;  4I50 A;  1HDJ A;  4C7U A;  1YSC A;  1E1O A;  4RAI A;  1G5H A;  5EZY A;  4X66 O;  5FLX N;  4TT3 G;  3HKE B;  2DTO A;  3A7U A;  4E51 A;  3B09 A;  4OPA A;  2E3C A;  3V8J A;  2QE7 G;  3RYI B;  1RPR A;  3SYQ A;  4TVY A;  2ODM A;  3RL6 A;  4YJ3 B;  1N33 O;  4B3R O;  5LHG A;  2QWO B;  4J9Z B;  2LW1 A;  2YDE A;  1H2S B;  1CP9 A;  2ZIM A;  4LFA O;  4KQE A;  5H5N A;  4DR1 B;  2ITC C;  3VQV A;  3G71 V;  2YXY A;  1YJW V;  2AMC B;  1QQC A;  2OCC B;  2EUL A;  4DR5 O;  4PJ0 Z;  3Q4H A;  2YXH A;  2CTQ A;  4YY3 O;  3CJH B;  2WAM A;  1Y76 B;  2ZIN A;  3K3W A;  4ZHQ A;  5KMG A;  4X65 O;  4PD4 F;  3A7R A;  2WLN A;  2ZIO A;  2HLD G;  4IGG A;  4YIO A;  1VP7 A;  4B08 A;  3H1H H;  4KXR A;  2DU7 A;  4AQY O;  3JD2 A;  2UXN A;  3JSN A;  1K73 W;  4P74 C;  1OHH G;  2UXD O;  4IHJ B;  1VQ6 V;  3WG7 B;  4BWA A;  3ZHS A;  3OGI B;  2WA4 A;  4JI8 B;  1XMQ O;  2GTS A;  2DWD C;  3CRM A;  4EO4 A;  1DLB A;  1E1Q G;  2RN9 A;  4JAA A;  3U10 A;  4LP8 A;  2QWQ B;  2XT9 A;  3G1Z A;  3SJQ C;  2WPD G;  4NTW A;  1K3E A;  2O57 A;  3F7Y C;  4H0L B;  4D7S A;  2I4L A;  3D3Q A;  5A2Q N;  3BHP A;  2EJR A;  2OCC C;  2OTJ V;  4LC1 A;  4DUY B;  1SQX H;  1FS0 G;  2VWK A;  4DR4 O;  2QTO A;  2GTA A;  4PA3 A;  2IY5 B;  1JR9 A;  5D5P A;  2YID A;  4NXN B;  1IUR A;  4P3O A;  3DC5 A;  2BTQ A;  1F23 A;  4Q20 A;  2CTP A;  2KG7 A;  4U7O A;  1NJI W;  3AEI A;  3OE7 G;  5B5E Z;  5LL6 Y;  2OCH A;  5LOV B;  3P8Y A;  2IH3 C;  3BAA A;  2XND G;  4TOI A;  2XAS A;  3WG7 C;  3CCR V;  1XMO O;  2E5L O;  2ZTG A;  1DGS A;  4BW5 A;  3RKX A;  1VQ5 V;  1KBH A;  2E75 B;  2AHY A;  4O4I B;  4BIO A;  1EN6 A;  4N21 A;  4YHH B;  2QHT A;  1HWY A;  5CN0 A;  3HKC A;  1Z5V A;  1X2G A;  4KR3 A;  4FIP C;  1B7Y B;  2EX3 A;  2R9I A;  1MAB G;  4E4E A;  3IFX A;  2HHH B;  3V8L A;  4X1I B;  1NI8 A;  4HNA A;  3SPC A;  5LGU A;  3JYC A;  3HB3 B;  5CBG A;  3AG3 B;  1XQ8 A;  1JA8 A;  4TV8 A;  2QA4 V;  4ZOL B;  4XTU A;  2FL4 A;  4P72 C;  4QNH B;  1TUE B;  5FPR A;  5LMN B;  3SGI A;  2CIM A;  4JI1 O;  2ATK C;  4DQ2 A;  1NYR A;  1SET A;  2X6C A;  3RYC B;  1Q86 W;  4X66 B;  4I5S A;  3B4S A;  3K57 A;  4JZG A;  2XAQ A;  4X1K B;  3ZHT A;  4UP8 A;  3ABM B;  2KSD A;  3UO3 A;  1ASZ A;  1IDS A;  1ADJ A;  4B3R B;  1N33 B;  2WSS G;  3STL C;  4BIZ A;  4TV9 A;  1ORQ C;  3H01 A;  3MEY A;  4LFA B;  5IJ9 A;  3NEM A;  3CC4 V;  4X8A A;  1ZSP A;  1I5Y A;  2P0L A;  2R9R B;  2QHU A;  3A5Y A;  5CA1 A;  1BGY H;  4DR5 B;  5EBW C;  4P73 A;  4DXW A;  2QM8 A;  5JH7 A;  1AB3 A;  1JFF B;  3CE2 A;  4K87 A;  1PNK A;  3HXW A;  4YY3 B;  4JAV A;  3L4G B;  1RIQ A;  4JI3 O;  4DW1 A;  1HNZ O;  3IAY A;  2ZM6 O;  1XHX A;  1H2M A;  1YDX A;  4X65 B;  1VQ8 V;  3AG3 C;  4MVM A;  4WFE A;  4H2Y A;  2P67 A;  2HFE C;  4MS2 A;  2CTR A;  4UVC A;  3ASN B;  1W0K G;  4D6T H;  5HFL A;  4AQY B;  3JD1 A;  4GX5 A;  4IT5 A;  3W3S A;  4NTY A;  4PA9 A;  1AIL A;  1FD9 A;  4IYI A;  3RIR A;  3X2Q B;  1ZL8 B;  3ICX A;  3J81 N;  4DW0 A;  1XMQ B;  4NB5 A;  1GH6 A;  1CXZ B;  3ABM C;  1K5S A;  3WB1 A;  3HRI A;  2LGQ A;  1ROP A;  5ITZ A;  3MF1 A;  3KCX A;  3E35 A;  2ALY B;  3T1Y O;  3QO8 A;  3TJT A;  2G38 A;  3OMI B;  1WA8 A;  2FTK A;  3JAK B;  4FPP A;  4X62 O;  4DK1 A;  1URF A;  2LO1 A;  1WP7 A;  1SC5 B;  2N05 A;  1H2G A;  3QF7 A;  4P3N A;  4IL6 Z;  4CBC A;  4DPG A;  2A79 B;  4DR4 B;  5L3C A;  1BS3 A;  1NQT A;  2AHZ A;  5GTI Z;  1EN4 A;  3HKE A;  1PL0 A;  2ZCE A;  1AP5 A;  1YTF D;  2DYR B;  3ASN C;  3CHX A;  3RYI A;  2IJI A;  4MVU A;  1E1T A;  4J9Y B;  3APO A;  4YJ3 A;  3MDS A;  3D8C A;  3AK2 A;  3OTF A;  3X2Q C;  1VQM V;  2E5L B;  1UFI A;  1K4C C;  4DV6 O;  4BIU A;  3FFQ A;  2DTI A;  2WLI B;  2A0L A;  4O4J B;  2DWE C;  2DKG A;  5JVD B;  4I7Z B;  3I5D A;  3JCU Z;  2AMC A;  4WI1 A;  4K0K O;  2VQE O;  2HP8 A;  1XEQ A;  3RUX A;  4HWT A;  2E5A A;  3CJH A;  5CMU A;  2AZ0 A;  5LMU O;  1SQQ H;  4TWK A;  1Y76 A;  4OXS A;  2K9P A;  4J41 A;  1QBZ A;  1S0V A;  1VF7 A;  1E22 A;  4JYA O;  1VQZ A;  3AG7 A;  2EJG A;  5DEC A;  1R6T A;  3HXX A;  1BSM A;  5B1N A;  3ICA A;  1FFX B;  4JI1 B;  2XTI A;  5L3B A;  1D5A A;  1SQP H;  5DM6 V;  2OTL V;  1N4C A;  4IHJ A;  1LUV A;  2F1M A;  2YIA A;  4PA7 A;  2DYR C;  2WLK A;  1YJN V;  2Q5Z A;  1JJ2 U;  2EIN B;  1L0W A;  5IT9 N;  4DV5 O;  5JWP A;  4FLT A;  3ZIA G;  1F7Y A;  1NJ2 A;  2B9Z A;  3K58 A;  1WB8 A;  3RGL A;  1KQS U;  4J7Z A;  3RBZ A;  3RT3 C;  2PYL A;  1I08 A;  1JPX A;  4FZ1 A;  2BOB C;  1DF5 A;  3UM7 A;  3ZHR A;  1KP3 A;  2X6A A;  2GUZ B;  2DVE A;  1JCH A;  2JEU A;  1IL2 A;  4UB6 Z;  3OGC C;  3G80 A;  3REX A;  2Q8V A;  2E65 A;  4PHC A;  1EBO A;  4P72 A;  2RJZ A;  3K79 A;  4JI3 B;  3RVZ A;  1HNZ B;  4JI4 O;  3F5T A;  4TQD A;  2ZM6 B;  1WQ7 A;  1I7F A;  3P32 A;  3T1C A;  2IY5 A;  4LF8 O;  4EFE A;  4MVS A;  4R50 A;  3V8K A;  1S72 V;  3EFS A;  2QHS A;  1NR7 A;  1QF6 A;  2XTA A;  3RYF B;  3OEE G;  1Q43 A;  1RPO A;  2IU3 A;  5JJN B;  5LOV A;  2JS5 A;  3BVO A;  4H2S A;  1U97 A;  3H9V A;  4UXN A;  3N27 A;  5KAI Z;  3M7M X;  1M9N A;  3W7W A;  4O4I A;  4AI8 A;  4YRM A;  4J7K A;  1SS3 A;  5J9P C;  2B5U A;  1SZX A;  1RM1 B;  4K8Z A;  3L73 H;  1YHQ V;  4GCZ A;  4LCU C;  1IBK O;  1B7Y A;  2GSM B;  4KUM A;  1JMK C;  2YIB A;  2ART A;  4X1I A;  3T1Y B;  1Q6I A;  2AXT Z;  3T1H O;  2F66 C;  5DED A;  4YRP A;  4X62 B;  3ZRS A;  1VF6 C;  4KHP O;  4YRS A;  4J11 A;  4ZOL A;  4MW8 A;  2IJH A;  2M7W A;  2IU0 A;  4DV0 O;  3BCC H;  5H2F Z;  3N2G B;  1QU7 A;  4FFK A;  2CJ9 A;  2PME A;  1AI4 A;  2EIM B;  3VBB A;  4P75 C;  2ZXF A;  1GM9 A;  3CRQ A;  4J42 A;  2UUB O;  3BJU A;  4X1K A;  4YJ2 A;  4AIL C;  1HP8 A;  1DTO A;  1LNQ A;  5EIB C;  4LR3 A;  1WNL A;  2H94 A;  4LF4 B;  1KD1 W;  1Q3E A;  2RNB A;  5EK0 A;  1GTO A;  5LBQ A;  4Z1M G;  3JAW B;  4DV6 B;  3OR6 C;  1DF4 A;  1X01 A;  3D3I A;  2Q73 A;  3GWK C;  4G2K A;  3G4S V;  1RM1 C;  3L1A A;  4K0K B;  2PGG A;  2VQE B;  4JV5 O;  3UO2 A;  1GGM A;  5B1A B;  1U96 A;  3H1I H;  3L4G A;  4J80 A;  5LMU B;  3BAB A;  1KYO F;  3QNE A;  2A7W A;  2Y48 A;  3E8F A;  3UH0 A;  2IJJ A;  3HXY A;  5IJ0 B;  4H2U A;  4JYA B;  3D36 C;  4H02 A;  2QKS A;  3BEH A;  4LH6 A;  4FM2 A;  4IIJ B;  3E8G A;  3LNM B;  3CRC A;  1PYS B;  1FKA O;  3REU A;  3U11 A;  1AR1 B;  3UCS C;  4UUJ C;  2EIK B;  1ZL8 A;  5C8Y B;  1GN3 A;  3ZN0 A;  3E9H A;  3FB7 C;  2NS6 A;  1TVK B;  2Q69 A;  3JD3 A;  4DV5 B;  4G28 B;  4Z1V A;  3R65 A;  2Y0P A;  1RSO B;  1Y74 B;  4LNU B;  2ALY A;  4DR2 O;  4XU3 A;  1V55 B;  1I94 O;  2Q9L A;  2IBZ H;  3STZ C;  3JAK A;  1WPY A;  1PL4 A;  1SQB H;  4U7N A;  3CCS V;  5BR8 O;  4XBF A;  1W0J G;  3LSS A;  3CCU V;  3ZMS A;  4K35 A;  2QM4 A;  4A5U B;  4F6E A;  3W7S A;  1MSW D;  1B8A A;  2DTH A;  4JI4 B;  4G85 A;  4LF8 B;  5KNN A;  4GT1 A;  3NET A;  1L1F A;  5IYB O;  2OWO A;  1R1B A;  1AI5 A;  3R66 A;  2AGA A;  1AI7 A;  1GRJ A;  1FPO A;  4YCU A;  1WLE A;  1WA8 B;  4O4L B;  1XI1 A;  2MW2 B;  2LJ2 A;  1YJ9 V;  5D5Q A;  4GUN A;  4PA6 A;  2WLI A;  1ZLZ A;  4O4J A;  5CA0 B;  5JVD A;  2VQF O;  1SQV H;  4LF5 O;  1YIJ V;  1IBK B;  3V7R A;  4UCU A;  2DQ0 A;  3A74 A;  3KZI Z;  3TEH B;  3EXA A;  3K9S A;  2ZT5 A;  1G51 A;  1HW7 A;  1V9P A;  2F95 B;  1B6Q A;  1R3J C;  1V55 C;  2Q67 A;  3H1J H;  3T1H B;  2DOS A;  3R07 A;  5DN6 G;  1AI6 A;  3CCQ V;  3GVM A;  4KHP B;  4BAY A;  1H4Q A;  4JTA B;  1P7G A;  3JCZ A;  4DV0 B;  1FFX A;  4JTC B;  1VQK V;  2OT5 A;  4MTX A;  2PUS A;  4TSF G;  3CXH F;  1COW G;  4PDV A;  2CGN A;  3CSX A;  2UUB B;  3CCE V;  2ETN A;  2ILM A;  4QIW F;  4HYO A;  2R9A A;  4EB6 B;  3EFF K;  2ARH A;  5EBL C;  1O9H A;  3BY6 A;  5K1X A;  4B3M O;  5BXZ A;  4F4L A;  2UUA O;  3BFM A;  2W0F C;  3EFR A;  4ZTZ B;  2GUZ A;  2QWR B;  2B1I A;  1NR1 A;  3RN4 A;  5KUM A;  4X88 A;  4WCE V;  4MVR A;  4JV5 B;  1M90 W; 
#chains in the Genus database with same CATH homology
 4DXW A;  1OCR C;  2QM8 A;  2DDZ A;  4CS4 A;  1Y66 A;  1FXK B;  4CS3 A;  1M1K W;  2IJK A;  4K87 A;  4LNS A;  3KFU A;  1PNK A;  3HXW A;  4HZ3 A;  4JAV A;  1NYQ A;  2DYS C;  3L4G B;  3QTC A;  5B1O A;  1RIQ A;  4UP9 A;  5ELN A;  4WJ3 M;  5KUK A;  3M99 B;  1VQ8 V;  3AG3 C;  4MVM A;  4WFG A;  4WFE A;  1ENV A;  3SPG A;  4XTY A;  5IDJ A;  2P67 A;  4H2Y A;  2HFE C;  4MS2 A;  3W7X A;  3CMA V;  5E3I A;  4P75 A;  4YRG A;  1SES A;  4HWR A;  3IG2 A;  2Q68 A;  4UVC A;  3ASN B;  1S3J A;  2EWN A;  1W0K G;  3SPH A;  5HFL A;  3JD1 A;  4GX5 A;  2A9H A;  2RHS B;  2ODR D;  3W3S A;  3LUT B;  3OMN B;  4PA9 A;  1QLE C;  1NVP B;  1Q81 W;  3A31 A;  4XTW A;  4CH5 A;  1EIY B;  4UVA A;  2ZT7 A;  1E79 G;  3ZRX A;  3PCO B;  3RIR A;  3X2Q B;  1VQO V;  3TEG A;  3SPJ A;  4YRI A;  4UPA A;  4HVC A;  1WQW A;  1R3K C;  3OMA B;  3CME V;  2XOK G;  3E8B A;  4JTD B;  4J15 A;  4JPR A;  5HFM A;  2E64 A;  3ABM C;  1K5S A;  1NJ6 A;  3HRI A;  5L3E A;  4ASU G;  3A5Z A;  1KOG A;  1ROP A;  1M56 B;  3MF1 A;  1I5X A;  4PG3 A;  2ZZF A;  2YEV B;  3T4D A;  5IY5 C;  5LHI A;  3IC7 A;  3E35 A;  2DZC A;  3LDD A;  3QO5 A;  2I4N A;  2ALY B;  4YYE A;  1QR8 A;  2EBO A;  3QO8 A;  1VQL V;  2Z3Y A;  4H2X B;  3HFZ B;  4LVK A;  1SRY A;  3OMI B;  4HWP A;  1EZJ A;  3SYO A;  1ADY A;  2FTK A;  2HKO A;  4FPP A;  3MF2 A;  4WF2 A;  4OP0 A;  2JJ2 G;  3VQW A;  2ZT6 A;  1KMN A;  2EIN C;  3D36 A;  3HPL C;  3OUS A;  1H2G A;  3EHB B;  2LP7 A;  1YFR A;  4TVW A;  2ZT8 A;  2LFS A;  4P3N A;  3IKL A;  1CEZ A;  3M4P A;  4CBC A;  3RF1 A;  2UXX A;  2CGH A;  2A79 B;  4N23 A;  4DPG A;  5L3C A;  4GX2 A;  4CS2 A;  1VQN V;  11AS A;  1PNL A;  2EJ9 A;  3I55 V;  1NQT A;  4YRN A;  2AHZ A;  1G5I A;  5EBM C;  1NNH A;  2XAF A;  4P30 A;  3K9A A;  1VQP V;  2A8E A;  1PL0 A;  2ZCE A;  1YTF D;  2DYR B;  3PZC A;  3ASN C;  2AKW B;  4YRJ A;  4R6Z A;  5GW7 A;  1BBW A;  4TVA A;  2IJI A;  4MVU A;  1J5W A;  1E1T A;  4J9Y B;  1KMM A;  1X54 A;  2ARU A;  1N9W A;  3CC7 V;  4ZIB A;  3X2Q C;  1VQM V;  2Q7E A;  4RDX A;  4TQF A;  4XU1 A;  1K4C C;  3OM3 B;  3CXC U;  1GK9 A;  3I7F A;  4XEM A;  4BIU A;  3WQZ A;  3T2M A;  3B77 A;  3E89 A;  2DTI A;  2WLI B;  2DXT A;  2A0L A;  4EX5 A;  4YDQ A;  2DWE C;  2DKG A;  4RO2 A;  3E9I A;  3VQY A;  1OCZ B;  1M56 C;  4JF3 A;  1NH2 D;  2AMC A;  4WI1 A;  2KB1 A;  1QLE B;  4WFA V;  5B3S B;  4LVL A;  5H6Q A;  4ZTU B;  4WFB V;  2Q5H A;  3FB8 C;  1F51 A;  3WFV A;  3RUX A;  4HWT A;  4L87 A;  2GHY A;  2E5A A;  3UKM A;  5B1B B;  1BIA A;  3ABK B;  2JIZ G;  5CMU A;  2IW5 A;  3F5W C;  2WLL B;  1FXV A;  3LDC A;  4TWK A;  3E8H A;  3CD6 V;  5CBF A;  2Y69 B;  2QEX V;  5EC2 C;  4OXS A;  2B1G A;  3DSQ A;  2XAJ A;  1N8R W;  4RMF A;  3AG1 B;  1BL8 A;  1THZ A;  3UGT A;  5C52 B;  1QBZ A;  1S0V A;  1E22 A;  4XTV A;  1VQZ A;  5IY5 B;  3A0R A;  1W66 A;  2H8P C;  2EJG A;  2JK5 C;  5EC1 C;  3HXX A;  1QE0 A;  5B1N A;  1ASY A;  3ZN1 A;  1JVM A;  2JEX A;  3AG4 B;  2G4C A;  1EFR G;  3RVY A;  2RHQ A;  5L3B A;  2XTI A;  3RAC A;  4HT4 A;  1PYS A;  5DM6 V;  3P8T A;  2K1E A;  3SYC A;  3LSQ A;  2OTL V;  1AJP A;  4XEO A;  1QVF U;  1R3L C;  5C53 B;  3CCJ V;  1H8E G;  1FXK A;  1H4S A;  4PA7 A;  2D3O W;  2DYR C;  2WLK A;  3CYO A;  1YJN V;  1X56 A;  1XL6 A;  1JJ2 U;  2ZQM A;  4PDM A;  1EOV A;  1G8M A;  2EIN B;  1JJC A;  5H9C A;  2DXU A;  2E41 A;  2WLJ A;  5L3F A;  2Q7H A;  1L0W A;  1SER A;  1R73 A;  3ABL C;  3W7T A;  2ZXW C;  2HVK C;  3ZIA G;  3GWO A;  1Q82 W;  1Y4M A;  2P5I A;  3I56 V;  1WYD A;  1NJ2 A;  2P90 A;  4YRL A;  4H2T A;  3RGL A;  1KQS U;  2PI5 A;  3RBZ A;  2EIJ C;  5KA6 A;  3ZMV A;  4YRR A;  4LVI A;  2RHS A;  1JPX A;  4CZZ A;  4P3P A;  2XAH A;  2BOB C;  3DTU B;  1DF5 A;  1P4R A;  3UM7 A;  3MHS C;  1R3I C;  1KP3 A;  2X6A A;  2DVE A;  1OCZ C;  1K8A W;  1OCO C;  2E10 A;  2EIM C;  1VQ9 V;  1JCH A;  1FFT B;  2JEU A;  5B3S C;  1AJN A;  3TK1 A;  2J3M A;  1IL2 A;  3L2Z A;  2DEQ A;  3OGC C;  4EKW A;  2XGT A;  1XL4 A;  1R6K A;  5LGT A;  1VQ7 V;  3REX A;  1GKF A;  2EZP A;  2E65 A;  3NEL A;  4YXW G;  4PHC A;  1EBO A;  4MTF A;  5B1B C;  2Q6A A;  3ABK C;  4FMT A;  3ASO B;  1F4N A;  3G6E V;  1B70 A;  4P72 A;  4XU2 A;  2WLM A;  4WF9 V;  2W6J G;  3OEH G;  2Y69 C;  3K79 A;  1NJ8 A;  1G4Y B;  3RVZ A;  4MT8 A;  4TQD A;  4X5O A;  5E1A C;  1USY C;  3AG1 C;  1ARO P;  3P32 A;  3T1C A;  1KKD A;  4XDL A;  4RUF A;  1WQ7 A;  3P8V A;  3TCU A;  2IY5 A;  4G84 A;  4MVS A;  4R50 A;  1GM7 A;  4QPJ A;  1EVK A;  2CK3 G;  3E2E A;  3V8K A;  1S72 V;  2C2A A;  2LFR A;  3OFN G;  3RKY A;  2ZDI C;  1H8H G;  2NLJ C;  3EFS A;  1F4M A;  4ZKI A;  2QHS A;  4GX1 A;  1NR7 A;  1SZT A;  3B8M A;  5KA5 A;  3OD1 A;  3RKW A;  1NVP D;  3AG4 C;  3OEE G;  3HFV A;  1QF6 A;  1RPO A;  2IU3 A;  1V54 B;  1S76 D;  4AH6 A;  4RQE A;  4PDL A;  5CBH A;  4JGS A;  4PEL A;  4WFF A;  1H4V B;  4H2S A;  4G27 B;  5IYD O;  5BZB A;  1GO3 F;  1K97 A;  3IAL A;  4UXN A;  3PJS K;  2CJA A;  5B1A C;  1HXD A;  3HXZ A;  4LBE C;  4QE9 A;  4P71 A;  4HWS A;  5HGQ A;  1M9N A;  2BOC C;  3RW0 A;  3W7W A;  1M57 C;  4YRM A;  3FB6 C;  3SYA A;  5J9P C;  2HNI A;  3HRK A;  1HTT A;  4P74 A;  2B5U A;  1RM1 B;  1PD3 A;  4KP4 A;  1YHQ V;  1BMF G;  1E1R G;  1P7B A;  4GCZ A;  4LCU C;  2MK3 A;  4TWA A;  1B7Y A;  2GSM B;  4KUM A;  2NNU A;  3TEH A;  1YTF B;  2DZ9 A;  2X0L A;  2FYK A;  2ART A;  4MVO A;  4Q6G A;  1AJQ A;  4WJ4 A;  1R6N A;  2ODR C;  3CPW U;  2C7I A;  4H37 A;  3HTZ A;  1OCC C;  3K04 A;  3ABL B;  4YCW A;  2ZXW B;  3ZMZ A;  2EIK C;  4YRP A;  4R7C A;  2DQ3 A;  3ZRS A;  3ZMU A;  4P2Z A;  4YRC A;  2YSU B;  4KR2 A;  1KEC A;  4P73 C;  4YRS A;  1YIT V;  4X89 A;  4MW8 A;  2IJH A;  1EFW A;  2M7W A;  3VOU A;  4JYB A;  4R8C A;  5L3D A;  2IU0 A;  3ASO C;  1Z7M A;  2PMF A;  2EIJ B;  2P6J A;  4YRO A;  1YFS A;  1MG1 A;  4K88 A;  3ZJZ A;  2PI4 A;  3ZRW A;  2HG5 C;  3QO7 A;  4JAU A;  3ZCC A;  1H4T A;  2Z5U A;  4HAM A;  1E1O A;  1YSC A;  4MVQ A;  4RAI A;  1G5H A;  2ZGW A;  1NJ1 A;  1NH2 B;  2CJ9 A;  5ELO A;  2PME A;  2ARS A;  1AI4 A;  4TT3 G;  1OCO B;  2HR3 A;  2EIM B;  3GB7 C;  3NXS A;  1X55 A;  3VBB A;  2DTO A;  4P75 C;  2ZXF A;  1GM9 A;  3OR7 C;  4FK5 C;  4NCX A;  3A7U A;  4E51 A;  5C93 A;  3CC2 V;  3BJU A;  3FYE B;  2E3C A;  3K03 A;  4XU0 A;  3V8J A;  2QE7 G;  1V54 C;  4E2L A;  4TVA B;  4YRF A;  1DTO A;  1LNQ A;  1RPR A;  3SYQ A;  1WNL A;  1Z7N A;  2H94 A;  4TVY A;  1KD1 W;  3RL6 A;  4H33 A;  4GX0 A;  4YCV A;  1S5H C;  1KC8 W;  3VQX A;  4QE7 A;  3ETG A;  5EK0 A;  1GTO A;  5LBQ A;  4Z1M G;  4J9Z B;  5LHG A;  3OR6 C;  1DF4 A;  1X01 A;  2J3L A;  3D3I A;  2EL9 A;  1CP9 A;  2ZIM A;  4KQE A;  1ATI A;  3W7U A;  2ITC C;  3ABU A;  4G2K A;  3SYP A;  3G71 V;  1S77 D;  3VQV A;  3TUP A;  3MHH C;  1YJW V;  3G4S V;  2CJB A;  1RM1 C;  2ZD9 A;  2AMC B;  3L1A A;  4CH6 A;  3K0D A;  2OCC B;  1JQ0 A;  3E86 A;  4UV9 A;  1GGM A;  2JJ1 G;  1MOF A;  1BHB A;  5B1A B;  1NBM G;  1QCE A;  3L4G A;  2WAM A;  3V7S A;  4FJC C;  4YRT A;  3LDE A;  2V1D A;  4OLF A;  1NJ5 A;  2ZIN A;  3K3W A;  3QNE A;  1M57 B;  2I4O A;  2Y48 A;  3FYI B;  3E8F A;  3UH0 A;  1UJW B;  3A7R A;  2IJJ A;  3K06 A;  2WLN A;  3HXY A;  2ZIO A;  4H2U A;  1FXH A;  2EIL B;  2HLD G;  2ZNJ A;  4P71 C;  2ZNI A;  4H02 A;  5L3G A;  3ICA A;  2QKS A;  2ZZE A;  2DU7 A;  3BEH A;  12AS A;  3JD2 A;  4UP7 A;  2RHQ B;  1KP2 A;  2UXN A;  3E8G A;  3K08 A;  3LNM B;  5H6R A;  1K73 W;  4P74 C;  3CCV V;  3K0G A;  4XDJ A;  2WWW A;  1PYS B;  1OHH G;  3REU A;  4MSW C;  1EIY A;  1AR1 B;  1PNM A;  5LHH A;  2JDI G;  1VQ6 V;  3WG7 B;  2ZZG A;  3HXV A;  1OCC B;  4UUJ C;  3PCO A;  4BWA A;  4HWO A;  2EIK B;  2ITD C;  5CA3 A;  2Q5I A;  1ZWI C;  3ZN0 A;  4QPK A;  3E9H A;  3FB7 C;  1Q7Y W;  4RQF A;  1JJC B;  2X6B A;  2NS6 A;  3IKM B;  2DWD C;  1K92 A;  2Q69 A;  4EO4 A;  4MVZ A;  1IXM A;  2X7R B;  3JD3 A;  5LGN A;  3ETD A;  2W6I G;  2EJF A;  1DLB A;  1K5Q A;  1E1Q G;  4LVM A;  4G28 B;  2YEV A;  4WFH A;  3R65 A;  2C8M A;  4LP8 A;  2ALY A;  3F7V C;  4PA4 A;  3NEN A;  4TTV A;  3G1Z A;  3HFZ A;  3SJQ C;  3FJP A;  3MQZ A;  4XU3 A;  2WPD G;  1V55 B;  2DW4 A;  1K3E A;  2WLH A;  3F7Y C;  1K4D C;  3STZ C;  2I4L A;  2P7T C;  4H2W A;  4YRK A;  3FB5 C;  1WPY A;  2OCC C;  2EJR A;  4U7N A;  1YI2 V;  2OTJ V;  3CCS V;  4DO2 A;  4LC1 A;  1CPY A;  4XBF A;  1W0J G;  3LSS A;  3CCU V;  3E83 A;  3ZMS A;  3OAA G;  1B70 B;  1FS0 G;  3AG2 B;  3W7S A;  1MSW D;  1B8A A;  1X2H A;  2ZR2 A;  1K7D A;  2QTO A;  3JD4 A;  1YB3 A;  2DTH A;  4G85 A;  4PA3 A;  1VQ4 V;  1J95 A;  2IY5 B;  4CH4 A;  5KNN A;  2F43 G;  4XTX A;  4YRQ A;  2EIL C;  4GT1 A;  3HXU A;  3NET A;  5FL7 G;  1L1F A;  1HC7 A;  5IYB O;  4XTZ A;  4P3O A;  1WPX A;  1JX9 A;  2AKW A;  1W2B U;  3CMQ A;  1AI5 A;  3T4Z A;  2EZO A;  1F23 A;  2QM7 A;  3B8N A;  4Q20 A;  3P30 A;  1YFT A;  1AI7 A;  1BBU A;  4U7O A;  2DJZ A;  2V7Q G;  3ZRV A;  4XDK A;  4YCU A;  1NJI W;  3AEI A;  3OE7 G;  1WLE A;  3ERR A;  3P8Y A;  2IH3 C;  2XND G;  3WG7 C;  2XAS A;  3CCR V;  2ZTG A;  1FXK C;  1YJ9 V;  3ABT A;  4BW5 A;  3HY1 A;  3OUF A;  3RKX A;  1VQ5 V;  5C51 B;  4K86 A;  4PA6 A;  1EQR A;  2WLI A;  3JD0 A;  3DGE A;  2AHY A;  2EAY A;  2QHV A;  4H2V A;  1NKD A;  3UGQ A;  4N21 A;  5F5W A;  2QHT A;  1HWY A;  2DU5 A;  5CN0 A;  4O2D A;  1K9M W;  3UFG A;  2ZR3 A;  1YIJ V;  5K1P A;  1X2G A;  4CH3 A;  4KR3 A;  3MD0 A;  4FIP C;  1B7Y B;  2XAG A;  2R9I A;  3V7R A;  1MAB G;  2DQ0 A;  1OCR B;  2Q7G A;  3A74 A;  3TEH B;  4YRE A;  1PKX A;  3IFX A;  1K33 A;  2ZT5 A;  1G51 A;  3V8L A;  3CCL V;  4P9O A;  2WLL A;  1B6Q A;  1BIB A;  2DYS B;  1R3J C;  1V55 C;  3SPC A;  2Q67 A;  5LGU A;  3ETE A;  3JYC A;  4MTG A;  3HB3 B;  4JYC A;  4P9P A;  3IGA C;  4ZBM A;  5CBG A;  1USY A;  1WU7 A;  3AG3 B;  3R07 A;  1YGB A;  5DN6 G;  3M4Q A;  1AI6 A;  1GM8 A;  1QLN A;  4UVB A;  3CCQ V;  2QA4 V;  1FYF A;  4Q15 A;  3KG2 A;  4BAY A;  1H4Q A;  4XTU A;  2ZDI A;  3A32 A;  4P72 C;  4KFM A;  4QNH B;  1TUE B;  4JTA B;  3JCZ A;  2CIM A;  4I9W A;  2IH1 C;  4JTC B;  3AG2 C;  2ATK C;  1VQK V;  3ZRW B;  3ZMT A;  4QJF B;  2OT5 A;  4MTX A;  3OW2 U;  1QVG U;  1NYR A;  4DQ2 A;  1SET A;  2X6C A;  1Q86 W;  4I5S A;  3A7A A;  2HJF C;  5IYC O;  4TSF G;  3SPI A;  1COW G;  1K34 A;  3FKS G;  4YP0 A;  4PDV A;  3CCE V;  1B76 A;  1H38 A;  2XAQ A;  4QIW F;  4BW9 A;  4HYO A;  1EVL A;  4UP8 A;  3ABM B;  3EFF K;  4LVJ A;  1ASZ A;  2I4M A;  4MTO A;  5EBL C;  3CCM V;  1JOY A;  1ADJ A;  3CP1 A;  1BHA A;  1LYL A;  2WSS G;  3BY6 A;  3TET A;  1E24 A;  4RUE A;  3STL C;  5K1X A;  1QR9 A;  4BIZ A;  4JAS A;  3V7C A;  1ORQ C;  2E1H A;  3H01 A;  4MW3 A;  1GMG A;  3BFM A;  3ML0 A;  4F4L A;  3MEY A;  2W0F C;  4HA8 A;  4H2X A;  4UV8 A;  3LC0 A;  3EFR A;  3NEM A;  4ZTZ B;  4YPF A;  1C0A A;  3CC4 V;  2B1I A;  4X8A A;  3HY0 A;  1NR1 A;  4PDR A;  5KUM A;  1I5Y A;  2P0L A;  2R9R B;  2QHU A;  4X88 A;  3A5Y A;  4WCE V;  4MVR A;  5EBW C;  2HVJ C;  1OZ0 A;  1M90 W;  4P73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...