4RQEA

Human seryl-trna synthetase dimer complexed with two molecules of trnasec
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
478
structure length
460
Chain Sequence
b'VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKELSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVTSIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine--tRNA ligase, cytoplasmic
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
total genus 121
structure length 460
sequence length 478
chains with identical sequence C
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqeA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqeA02
2P0LA 2ZTGA 3HRIA 1NNHA 2QHTA 2CJ9A 1EQRA 4YRCA 2E64A 1G5HA 1YFRA 2ZCEA 4TVYA 2DQ3A 2ZNJA 4H2VA 4H2YA 4XTVA 4YROA 1BBWA 1YFSA 2CJAA 1HXDA 2DTIA 3QO5A 3ICAA 1HTTA 4PG3A 2DU5A 1RIQA 1WLEA 4HWPA 3L4GB 4YRFA 1NJ2A 4X5OA 2CGHA 2P5IA 4WF2A 4CH5A 1NYQA 2I4NA 2Q7HA 3A74A 4CS3A 2ZT8A 4G85A 1NYRA 1X2HA 1YFTA 4KQEA 4BWAA 2QHUA 2G4CA 4CS4A 3PZCA 1X55A 3CMQA 4P75C 1E22A 5C53B 3PCOA 4WI1A 1WYDA 3NETA 3NENA 3IG2A 1QE0A 3UH0A 1N9WA 2ZR3A 1E24A 3NEMA 2RHSB 5C52B 4EX5A 3RACA 2ZNIA 3V7CA 2ALYA 5KNNA 3UGTA 1IL2A 2I4LA 4AH6A 4HWOA 2DJZA 1EOVA 1ASYA 2RHQB 4OP0A 2CJBA 2ZIOA 2ZIMA 3A7UA 4RMFA 3HTZA 3OD1A 4XU0A 4KR3A 3R07A 2EJ9A 3RIRA 5ELNA 1EVKA 4TWAA 4RDXA 1X01A 4UPAA 2E41A 3TEHA 1SETA 2DZCA 3HXWA 11ASA 4YREA 4TVWA 4XTZA 3RUXA 1WU7A 2QHVA 4YPFA 2XTIA 3E9IA 5K1PA 4EO4A 3RGLA 3V8LA 4E51A 4H2TA 2EAYA 2DVEA 2Q5HA 4Q6GA 3TEGA 1W66A 1NJ5A 3UGQA 4YYEA 4PHCA 3V7RA 4P74A 1B70B 2J3MA 2CIMA 3RKYA 4ZTUB 3A5ZA 1FYFA 4CS2A 1BIAA 4G84A 4CH6A 3ERRA 2DXTA 1X54A 1VQZA 4YRSA 1EVLA 4P3PA 2AKWB 4YCUA 4YP0A 1B7YB 1J5WA 2ZZFA 3QO7A 4ZTZB 2ARSA 4YRJA 4XTWA 4XEOA 1JJCB 1ADJA 2QHSA 4YRNA 5C51B 4XTYA 4YCWA 2ZZEA 4H2XB 4TQDA 3HXXA 4YRTA 3QTCA 4DPGA 3A7RA 4O2DA 3HY0A 3VQWA 2ARUA 3A32A 1G51A 2DZ9A 1GGMA 3VQXA 3RL6A 2E65A 2I4MA 2Q7EA 1ADYA 2IY5A 3IKMB 5ELOA 3HY1A 4XTUA 2E5AA 3TUPA 2DDZA 2RHSA 5F5WA 4YCVA 4YRLA 4OLFA 1E1OA 4WJ3M 4L87A 1NJ8A 2J3LA 4K88A 2FYKA 3BFMA 4WJ4A 2HNIA 3G1ZA 3L2ZA 4DQ2A 2DQ0A 3IKLA 12ASA 1ATIA 4BW9A 3HFZA 1SRYA 1PYSB 4YRIA 3HXYA 1H4TA 3HXUA 2ZXFA 3M4PA 3LC0A 5E3IA 4XTXA 4HWSA 3PCOB 3QNEA 4YRKA 4YRMA 4P75A 1EIYA 4TVAA 4LNSA 5HGQA 2ODRD 1WQ7A 1NJ6A 2ALYB 3LSSA 4XU1A 3UFGA 4TTVA 1B8AA 4P73C 1WNLA 3REXA 4J15A 4H2SA 4HA8A 3L1AA 3P8VA 2AKWA 4K86A 4XU2A 2EL9A 3A7AA 3TEHB 4P72C 2EJGA 1YGBA 4Q15A 3WQZA 3L4GA 2PMEA 1SESA 2Q7GA 3MF2A 4YRGA 1BIBA 3RKWA 2ZR2A 2ZZGA 3VQYA 4YDQA 2AMCB 1KMNA 3V8KA 2E1HA 1ASZA 4P71C 4H2WA 2DXUA 4NCXA 1G5IA 4P73A 1HC7A 4UP8A 2ZT5A 4YRQA 3LSQA 2Q5IA 4RQFA 4P3OA 2EJFA 5K1XA 4K87A 2PMFA 3HXZA 4H02A 3BJUA 1H4QA 1KMMA 2ZT6A 3M4QA 4P72A 1USYC 2ZINA 3EFRA 1EFWA 3V7SA 1PYSA 3A5YA 3I7FA 3FJPA 4HVCA 2RHQA 3W3SA 4ZIBA 4RQEA 4P71A 4XEMA 2ZT7A 4TQFA 3HFVA 2DEQA 3VQVA 2ZGWA 3HXVA 4YRRA 1QF6A 1BBUA 2IY5B 2I4OA 4P3NA 2E10A 4UP9A 1C0AA 2ARTA 1Z7MA 3REUA 2DKGA 1H4SA 4KR2A 4YRPA 3V8JA 4CH4A 4HWTA 1KOGA 3QO8A 2E3CA 4CH3A 4HWRA 3DSQA 4P74C 1USYA 2EWNA 3MF1A 1NJ1A 2DU7A 3P8YA 1B76A 2C7IA 1YB3A 3RF1A 4UP7A 3HFZB 3A31A 2ODRC 1L0WA 1B70A 3NELA 3MEYA 3P8TA 1WPYA 3IALA 2DTHA 3E9HA 4H2UA 1H4VB 1E1TA 3KFUA 3VBBA 2XGTA 3RKXA 1X2GA 1B7YA 1SERA 1LYLA 1X56A 4XU3A 1EIYB 4TVAB 2C8MA 3EFSA 2AMCA 2DTOA 1JJCA 1WQWA 1Z7NA 4H2XA 3HRKA
chains in the Genus database with same CATH superfamily
3JATA 4TV8A 3OW2U 3ABMB 1BQZA 2QHTA 1TUEB 1EN4A 4JAVA 2RCVA 3QF7A 4EB6A 5LP6C 2W0FC 2DQ3A 4JI4O 2YDEA 4XTVA 2RN9A 5LBQA 3K3WA 4JI4B 1BBWA 2C2AA 1SKVA 1RSOA 2ZE6A 4Z1VA 1Q6IA 3DC6A 4FMTA 3APOA 2B9ZA 3JSNA 4AQYO 4YY3O 3QO5A 3K58A 2EX3A 4PG3A 2DU5A 3STLC 3OEHG 4YY3B 1L0LH 4HWPA 4X5OA 1N0JA 2KG7B 5IYCO 3GWKC 5LL6Y 1HWYA 4WF2A 2NR5A 3UT5A 1AJPA 2ZT8A 1S5HC 4KQEA 4H0LB 2EIKB 3JD2A 4CS4A 3CRCA 2CGNA 3CMQA 2W6JG 4FJCC 1NH2B 3GB7C 1XILA 5C53B 3ZHSA 3IG2A 5L3BA 2ZR3A 3ABLB 4JV5O 4I0XA 3JD1A 1E24A 5LXTA 4JV5B 2RHSB 5C52B 2IBZH 1JOYA 4X1KB 2Y69B 1D5NA 2WAMA 4EX5A 3V7CA 5KNNA 3UGTA 1K4CC 1SA0B 3MD0A 1YJ9V 2GV9A 5JJJB 1K33A 1EOVA 1VQ4V 2P22C 2RHQB 2A7WA 4B7EA 5IYZA 3D36A 2F4VO 5B3SC 4I50B 1RM1B 2D2CB 2W6IG 1YTFB 3HTZA 2F4VB 1XNRO 3ZHVA 3R07A 2YI9A 1XNRB 1PNKA 1VQKV 2K9PA 5B1AB 1EVKA 4H33A 1CP9A 2E41A 2B1GA 3I56V 3JAKB 3B8NA 4PDLA 3BVOA 2BOCC 5FPRA 11ASA 4TVWA 3LSUA 1WB7A 1F23A 4GKKB 1S0VA 5H9CA 3OD4A 1S77D 3V8LA 1THZA 1AI7A 3ASNB 3OT7A 2Q5HA 4GKJO 4PHCA 3U10A 4GKJB 3C3SA 4QJFB 2J3MA 4E4EA 3RVYA 1V9PA 2QWPB 1FYFA 3BA8A 1DK1A 2XUMA 5DEDA 1HNWO 4G84A 4W4KA 4J42A 1HNWB 1VQZA 4JI3O 4P3PA 4YP0A 2ZZFA 3OTOO 1IXBA 5C93A 4ZTZB 3AK2A 1GO3F 4XEOA 2QM7A 5BZBA 3LUTB 5TISZ 2P06A 4MTFA 2KB1A 1S72V 4YCWA 3HR0A 3CPWU 3HKDB 3HXXA 4YRTA 1M57B 3QTCA 1Y67A 3MAQA 4TUYB 4O2DA 3HY0A 5EZYB 2ODMA 3CC2V 1IX9A 3VQXA 3RL6A 3K59A 1JCHA 2IY5A 3N2KB 4JI1O 2E5AA 5HFMA 2JDIG 1YCIA 4JI1B 4H44B 4RWUA 4YCVA 3JAWA 4WJ3M 1WAZA 1NJ8A 5KMGB 2ETNA 2HVKC 5EBMC 4EKWA 3BFMA 2DYSB 5GONB 2HNIA 3BFRA 2EILB 3ZJZA 3JARB 4O2BA 2QR4A 1QHTA 1YZBA 1ATIA 1SRYA 2F1MA 4LP8A 3RYCB 4YRIA 1EN6A 4MTXA 2HP8A 2BOBC 2XASA 4MSWC 3FX7A 1XMQO 3ZRXA 2IJKA 3F7VC 1H2LA 5E79Z 5B66Z 5BXZA 5E3IA 1XMQB 4HWSA 1NI8A 3PCOB 3QNEA 3E8BA 3KZIZ 2LP7A 3H01A 2P90A 4Z1MG 1SQGA 1V55B 4B3MO 1I7FA 3K5OA 3CCSV 4TVAA 1R3KC 4UV9A 4B3MB 1ZWIC 4K3AA 4J7JA 4LWSB 1WQ7A 3CRQA 2OCHA 1PL4A 1XUQA 3UFGA 3O65A 3JALB 4O4JB 1WA8B 1VMGA 1HR0O 4X1YB 4QPKA 4U7OA 4TV9B 1HR0B 4MT8A 3NXSA 3J7AU 4KUMA 1OCOC 5CB4A 3L1AA 4XU2A 2F43G 4UCUA 5L3EA 4D7SA 1K4DC 2RQ6A 1CPYA 3TEHB 1AR1B 4QGPA 4Q15A 3BRCA 2Q7GA 1BS3A 1LNQA 3IC9A 3RKWA 2ZE8A 5GTHZ 2FMLA 2LGWA 1B04A 1NT2B 1K8AW 2OYQA 2OTJV 4FK5C 4DUYO 1H8EG 3HKCA 4PA6A 3H1HH 4DUYB 4H2WA 1GN4A 2ZDIC 2HVJC 3JD0A 4UP8A 1FKAO 2DW4A 5EBWC 3LSQA 2Q5IA 3S3XA 2ZE7A 4PDMA 2Q69A 4B3RO 3HXZA 4MS2A 4U7NA 3SJBC 4B3RB 1ENVA 4J7ZA 3F5WC 3DTUB 4TOIA 3HKEB 5LYJA 2ZT6A 3N2GB 2HEPA 3T1CA 4P72A 1H2KA 1MZEA 4JI0O 1IVSA 4XDKA 3OGCC 2UXNA 1NJIW 2LGQA 2EBOA 4JI0B 2V7QG 3V7SA 1PYSA 1QVGU 5B1OA 1AI6A 1ZX3A 1Q81W 3FB7C 4OPHA 1A32A 3K03A 3B09A 4CC6A 4XEMA 2N05A 1Q6UA 1ZL8A 3HFVA 2WA4A 1FAFA 2ZGWA 1JX9A 4FFBB 5CBHA 3HXVA 2ZM6B 1QF6A 5HFLA 1M9NA 4O2AB 4F6EA 1Z7MA 3RVZA 1H2GA 3FB6C 2PYLA 2ADQB 3REUA 5GW7A 4DR6O 1BHAA 5BMVB 4JYBA 1T5EA 4HWTA 3BAAA 2PYJA 1UPGA 4DR6B 4CH3A 3SYQA 1USYA 5KA5A 2EWNA 5B1BB 4DW1A 2M6YA 1R3JC 4D7TA 1BQ0A 1VIBA 3R66A 1B76A 5KHJA 1VF5B 3HFZB 1YHQV 4HZ3A 3P8TA 3CXCU 5IJ0B 1FFXA 3CCUV 4JI7O 4J9ZB 3E9HA 4U3FH 2QTOA 4JI7B 4GX2A 3RYFA 4IYIA 5KA6A 4DV0O 1JPXA 2ZT9B 1I5YA 1Q7YW 1FFTB 4FVMA 2CH7A 1R1BA 3O9OA 3RYIB 1EIYB 1MZFA 3RYHB 1M5IA 2C8MA 2V1DA 3CB2A 4DO2A 2DTOA 1OV9A 4HT4A 3JASA 3E22B 2P0LA 2YC0A 1HNXO 2ZTGA 3HRIA 1NNHA 2IM9A 1FXKA 4ABMA 2CJ9A 5IYDO 3Q4HB 2RJZA 3TK1A 1XNQB 4J80A 4JAAA 2A8EA 4YROA 2HJDA 4E2LA 3RW0A 1YFSA 2CJAA 5EYPA 3LDDA 1JJ2U 2AXTZ 4X1IA 4JI2B 2DTIA 4FLXA 2EIMB 2Q68A 4ZI7A 4MW8A 1GK9A 1RIQA 1WLEA 1NR7A 3HKBB 1N32O 1ZAUA 1QNMA 4YRFA 2WLJA 1N32B 1JJOA 2V4DA 4N21A 1JFFB 2P5IA 4X65O 5L3FA 2YIBD 2X7RB 2OTLV 4IHJB 1TVKB 4Z2WA 4X65B 3CMAV 2WLHA 3D36C 5BR8O 4DV5O 4LF8O 4BWAA 2UUBO 4J11A 1NYRA 5BR8B 4DV5B 4U3JA 4LF8B 1VQ7V 2UUBB 2CGOA 2P6JA 3PZCA 1X55A 3SPIA 1XHXA 2A3QA 2YEVB 1PNLA 1OCOB 1BSMA 1IZ3A 4WI1A 1WYDA 2HKOA 2ZDIA 2EINB 2GBOA 3WB2A 2Q5ZA 1QE0A 1HDJA 2CDYA 4PA3A 2LFRA 1N9WA 3M8AA 3L74H 1BGYH 2ZNIA 3RACA 1R6NA 2F66C 4QNHB 2QDOA 4TWKA 4WBNA 2I4LA 4DYLA 4K35A 5KAIZ 2EJ7A 1EFRG 3SYAA 2DJZA 3K0GA 4OP0A 2CJBA 1DGSA 5KUMA 1YEWA 4LF4B 3WU2Z 2UXBO 4RMFA 2JS5A 2ZXWC 2UXBB 4UVAA 3AG4B 2BTQB 4XU0A 4KR3A 5IJ9B 2EJ9A 2AZ2A 2ZD9A 5ELNA 4IYHA 4WF9V 5LMUO 3AG2B 3L73H 1H38A 4R6ZA 5LMUB 3P30A 4LF5B 2G38A 2CTQA 2DZCA 3ZHRA 4YREA 2ZQMA 1WU7A 3KCYA 2H8PC 1TAEA 2E5LO 3E9IA 3RGLA 4PA4A 3W7WA 1FXHA 2E5LB 2HLDG 2EIJB 3WB0A 3I55V 1G4YB 1PP9H 3CYOA 3RKYA 3PJSK 4JPRA 3OUFA 4X89A 4OXSA 1ZTEA 2R70A 3A5ZA 4MTGA 4LVLA 3CSXA 4P2ZA 1BIAA 3UCSC 3MHHC 5L3GA 4LVKA 3AG7A 1EVLA 2OT5A 4EFEA 3B4SA 1B7YB 4LFBO 1J5WA 3QO7A 2L6LA 4D6TH 3OEEG 2WLLB 4LFBB 3ZIAG 4YJ2A 4MTOA 4YRJA 4XTWA 1NR1A 4AQYB 3K5LA 1ADJA 2QHSA 2YI8A 5C51B 2GUZB 1OCCC 2FKXA 3CCVV 1V54C 2ZZEA 3L9DA 4H2XB 2VQEO 3JATB 4TV8B 2OWOA 3K79A 1BL8A 1H2NA 4PI0A 2VQEB 4FLWA 3QG5A 2N04A 3A7RA 3ZN1A 1EZJA 3FYIB 4DV1O 4RUEA 3UKMA 4NYKA 3CRMA 4F4LA 1PNMA 4DV1B 1W0JG 1Z5WA 5D5QA 3IKMB 3HY1A 5ITZB 2IH1C 3ETGA 5CBFA 1QVFU 1J95A 3TUPA 2RHSA 1Y74A 2F23A 4OLFA 1JR9A 5JQGA 4OPAA 3G80A 1AR4A 5LHHA 1R3IC 2FYKA 4YJ3B 4JI6O 1P7GA 4HBNA 5AG2A 4X20B 1AR5A 3G1ZA 3L2ZA 4XBFA 3IKLA 3L71H 1VP7A 2Z0AA 12ASA 5EK0A 1MMMA 3ML0A 1P4RA 1Q43A 1PM9A 4JF3A 3HXYA 1Q5OA 3ZMTA 3MDSA 3ZMZA 1TUBA 3CJHA 1I5XA 2HFEC 2ZXFA 4CBCA 4XTXA 2BE3A 1F4NA 4YRKA 3OTFA 4YRMA 2A06H 4FLUA 4NB5A 2UUAO 4PJ0Z 5LXTB 2UUAB 5J2UA 5HGQA 5CA0A 2ODRD 4H13B 5GTIZ 1F51A 3SJQC 3FAVA 4HYOA 3ZMVA 1W0KG 4KL1A 2HG5C 4DV3O 4TTVA 2XT9A 4IGGA 3TCUA 4DV3B 1B8AA 1QLEB 5IYZB 2B1IA 3P8VA 4K86A 3AK3A 2EL9A 4YIOA 4MVOA 2H94A 3K06A 2X6CA 3ABKC 4P72C 2EJGA 3JD4A 5A2QN 3L4GA 4KFMA 1SESA 3TXQA 1BIBA 4JI3B 1X4TA 4QIWF 2YUAA 3OTOB 4IIJB 3VQYA 2AMCB 4LH7A 2E1HA 4NR1A 3N27A 1VQ9V 2X6AA 1I0HA 2DXUA 1S5LZ 3CMEV 4UCTA 4B7KA 2R9AA 4P73A 4JYYA 4WFFA 1WPXA 2ZT5A 1L1FA 4YRQA 1S3JA 4RQFA 2X6BA 2EJFA 1L8DA 4P3OA 1PV0A 5K1XA 2IU3A 1KYOF 2PMFA 1XI1A 2GSMB 3X2QC 4X9QA 3BJUA 1GKFA 2DWDC 1QCEA 4JASA 3ZS8C 1USYC 2PTMA 2F93B 1Y76A 4ASUG 4O4LA 1GM8A 1LUVA 1SQQH 3A5YA 3I7FA 1F7YA 4HVCA 3W3SA 1AI4A 4I55A 2AZ0A 5EIBD 2N74A 1E79G 3TETA 3VQVA 4X64O 2DEQA 2RNBA 1K5SA 3ZMUA 4X64B 2F95B 3A0RA 3E86A 4KHPO 4YRRA 2PI4A 2HHHO 2IY5B 2I4OA 2KSDA 4B3SO 2W0XA 2HHHB 5CA3A 2YIBA 5LP6B 2ARTA 3WG7C 4B3SB 3EHBB 5H5NA 3TGUH 2OCCC 3P3PA 3JAWB 5EC2C 3OMAB 1KOGA 3DSQA 4P74C 3JD3A 4KP4A 3THOA 3K5NA 1N8RW 4FLZA 1ORQC 2OIEA 4O2BB 1FXKC 1HP8A 3DGEA 4WFAV 5DECA 4CZZA 2ODRC 1B70A 3CEIA 3MEYA 1K9MW 1VARA 2DOSA 2CK3G 3OUSA 1WPYA 3IALA 2DTHA 3H1JH 2XAFA 4GX1A 1VQ5V 1ZLZA 2LO1A 2QKCA 1H4VB 1BZKA 1H2SB 1MNGA 5J2TA 2YXLA 3B77A 1LYLA 2LFSA 5LMNO 4J10A 1H2MA 1CEZA 3E83A 3T1HO 5LMNB 2WLIA 4TVAB 1M4UA 2E75B 1KKCA 4A5UB 1JJCA 3T1HB 1WQWA 2DN9A 3WFVA 3ETDA 3M99B 3HRKA 4LVMA 3IAYA 1OCZC 5JJNB 4DK1A 4K8XA 3K08A 1WP7A 2E64A 2ZCEA 4TVYA 3G6BA 1KKDA 4H2VA 4LH6A 3W7TA 5CB4B 3RGBA 3D3QA 2X0LA 3JCZA 2NS6A 1HXDA 3TXSA 1N4CA 3OR7C 5B3SB 4LBEC 5C8YA 2EZPA 3ICAA 2P4KA 4DR1O 2DMXA 5B5EZ 4O4HB 5KHIA 1YTFD 4DR1B 5D5PA 1NJ2A 1VQOV 5CBGA 2IW5A 4QE9A 4YXWG 2JS3A 4H37A 2CGHA 3CD6V 4CH5A 1NYQA 5H6QA 3HKCB 2I4NA 2QKAA 3CCJV 2RDCA 5EC1C 1M56C 3ZMSA 4K8ZA 3STZC 4G85A 1MSDA 3K5MA 1IDSA 4UVBA 3E2EA 4ZOLB 1X2HA 1OZ0A 2GHYA 2G4CA 1Y4MA 4P75C 2JK5C 4O4IA 5EIBC 3SJCC 3H1LH 5EBLC 1E22A 1TA8A 3R65A 5LHIA 3NETA 4UUJC 3NENA 2BCCH 3J80N 3ASOC 1IXMA 3IC7A 4FLTA 2WPDG 3UH0A 1AI5A 5LYJB 3JAMN 3CRAA 1M90W 2UUCO 4NTYA 5LA6A 3ZCCA 3NEMA 2QWQB 2ZKOA 4FZ1A 2UUCB 3ABMC 2JGDA 3GWOA 2ALYA 2A0LA 4ZHQA 2QJ1A 2DJVA 4DV2O 4HWOA 3H1IH 4FLYA 2IU0A 4DV2B 5CA1B 3F7YC 3A7UA 4RAIA 1D2DA 1ZL8B 4UCOA 3W7XA 3OD1A 4GCZA 2B5UA 4LF7O 3RIRA 1KP2A 2JEXA 4RDXA 4TWAA 1G8MA 4R7CA 4LF7B 1FJGO 3TJTA 3RYIA 1Q90D 1SETA 3CCLV 1LUWA 2Q9LA 4FIPC 1FJGB 3HXWA 1BCCH 1X59A 1U96A 3RUXA 5KAFZ 4DV0B 2QHVA 1GH6A 3L70H 4DV6O 2XTIA 4EO4A 1WPBA 4E51A 1IBKO 1MABG 2AGAA 4PI2A 1EN5A 4DV6B 4H2TA 3APQA 2EAYA 2DVEA 2EIKC 1IBKB 4Q6GA 3TEGA 2K1EA 3L75H 3DXRA 4PDRA 1W66A 1NJ5A 3UGQA 5JVDB 4YYEA 5JJEB 3V7RA 4P74A 4XDLA 2CIMA 4MVQA 4P9OA 1FFXB 2UXXA 2VWJA 1HNXB 2ADPA 2WLMA 4CS2A 3RYFB 4UVCA 1NS1A 2XAGA 3ZN0A 3K04A 3NR7A 5KHKA 3ERRA 4I5SA 1QBZA 3AG1C 4FM1A 2AKWB 4YCUA 4I9QA 2WLNA 4BIUA 2NLJC 5LOVA 2OCCB 2P67A 3CWBH 1JFFA 1PL0A 2ARSA 1JMKC 1WN7A 4FZ0A 3ETEA 3KKYA 1NTMH 4MVRA 1RM1C 1I94O 4G28B 3B8MA 3SPJA 1I94B 4LF9O 4DPGA 3MQZA 1FXKB 4LF9B 3VQWA 5B1AC 1BT8A 2BSKA 1R73A 4HNAA 5FLXN 1G51A 4EFBA 4LFCO 1GGMA 2E65A 1KD1W 2I4MA 1ADYA 4LFCB 5KX5A 1XMOO 1KC8W 1OCRC 5EYPB 4LNUA 3UM7A 4X1IB 1OJHA 3I5DA 2NNUA 1NVPD 1VF6A 1Q6HA 2YIDA 4WFGA 4ZI7B 4YRLA 1RPRA 2XOKG 3S3WA 4K88A 2Q73A 3AK1A 3BPZA 2R72A 1NKDA 4DRXB 3EFFK 4WJ4A 1CXZB 4F6RA 3UQ8A 4P9PA 4I4TA 4DQ2A 1FD9A 1P7BA 4G2KA 1SC5B 4BW9A 1OCZB 1R6KA 3U11A 3OGIB 4I9WA 2JVDA 1GM9A 1P84F 4U3JB 2JJ2G 2EULA 1H4TA 3ZRSA 1DF5A 3RBZA 4WFEA 2FYUH 2ITCC 1JA8A 2HJFC 1EBOA 3T1YO 5IY5C 5CMUA 5FNVA 4B3TO 3UO2A 3PN1A 3T1YB 5JH7A 4B3TB 1U97A 2Q4PA 3CCQV 1N34O 2WLKA 4P75A 4PHZA 1N34B 3T2MA 1M57C 1R6TA 4LNSA 4PA9A 2JRIA 1NJ6A 3C3TA 4NKGB 4AHCA 1YDXA 3SDLA 2ATKC 1AJNA 2QM4A 3A0BZ 1Q82W 2QWOB 4R50A 4GUNA 3CCMV 3LNNA 4P73C 1Z5VA 4H2SA 4MW3A 1W2BU 3ZRWB 1TGOA 4HA8A 1H8HG 3AEIA 2CUGA 2QM8A 1FPOA 2R9RB 2DE0X 4QPJA 5KHHA 2DYSC 1VQ8V 2EILC 1WP8A 2Q8VA 1AP5A 2GDSA 4BR6A 2GUZA 3MF2A 3H1KH 1YXBA 1E1RG 4UCSA 2KG7A 4UB8Z 2ZZGA 1US6A 1WNSA 1URFA 2Y0IA 4PV1B 4YDQA 3KG2A 3OMIB 3V8KA 2YS8A 4EEQA 1SQBH 2P5OA 1Y66A 3DC5A 3BCCH 1HC7A 1LR1A 5ITZA 2CTRA 4UCRA 4EB6B 1AROP 4DV7O 1V55C 1RP3B 4H02A 4DV7B 2R9IA 5A9GA 2QA4V 1RSOB 1H4QA 3VOUA 3SPHA 4LR3A 1KMMA 4YJ3A 1DF4A 4X20A 4YJ2B 1YJNV 4X1KA 4DXWA 2ZINA 3ZEDA 1O9GA 2FL4A 1M1KW 3ZBHA 2LJ2A 1SA0A 2XHBA 1N33O 1BHBA 3AG3C 2Q6AA 2ILMA 1N33B 1NU1H 3FJPA 1N0NA 2LW7A 2RHQA 4K0KO 4JI6B 1HNZO 5H6RA 4P71A 4I50A 4DK0A 4K0KB 1O9HA 4TQFA 1HNZB 3UT5B 4DR7O 2Y4UA 3GVMA 2A9HA 2IJJA 4DR7B 3B2EE 3FKSG 1BBUA 3E89A 3A2FA 1JQ0A 4P3NA 2E10A 1C0AA 3G67A 5FPOA 5JCOA 2BTOA 3G4SV 3FYEB 5B1NA 3JAKA 3ZHUA 1Y74B 1H4SA 2DKGA 1KU9A 3AG1B 3CE2A 4GZRB 5JQGB 4YRPA 4CH4A 1YI2V 3QO8A 1QU7A 2KQXA 4I0XB 2Y0PA 5IDJA 3MF1A 2WWWA 3F5TA 1I08A 4JTCB 2IH3C 2E74B 1COWG 1YB3A 4OX9O 1IBMO 2VQFO 4UP7A 1SZTA 3RF1A 1M93A 4YHHO 3NELA 4OX9B 1IBMB 2VQFB 2QKSA 4YHHB 1IBLO 3ABUA 1TUBB 3SYCA 3CJHB 3RFRA 1IBLB 4J9YB 2WA3A 1QR9A 3KCXA 4W4LA 4QE7A 1E1TA 3KFUA 2FB5A 4J41A 4GKKO 2XGTA 5J9PC 2IJHA 1SQVH 1OCRB 1L0NH 4MVSA 1SERA 3SJAC 1X56A 4XU3A 2CTPA 1MA1A 4IIJA 2DYRC 5J2UB 2AMCA 1RFYA 3W7SA 1SQPH 5CA0B 2ITDC 3JCUZ 3G6EV 2RMKB 2YXYA 4DW0A 3FAVB 3HKDA 3JYCA 2XAJA 4TUYA 4HAMA 1EQRA 4YRCA 5EZYA 4RO2A 4ZKIA 4B08A 1G5HA 3T4ZA 1YFRA 2ZNJA 2ZE5A 4H2YA 5IYBO 3CHXA 3N2KA 3FFQA 3ICXA 1SQXH 2ZXWB 5IY5B 1R3LC 4PELA 1HTTA 5B1BC 3IJ4A 3SR2C 3L4GB 1Q86W 5KMGA 2ARHA 3P3NA 5LGUA 1VQMV 4DR2O 2QE7G 5GONA 4DR2B 1ROPA 3JARA 3QVNA 5LGNA 2Q7HA 1GN2A 4MVMA 3A74A 4CS3A 3IGAC 3D8CA 1XOUA 3RYCA 2P4VA 1YFTA 2Z3YA 2QHUA 4UFZA 1SS3A 4J7KA 5LP6A 3HB3B 3BY6A 2L35A 1K3EA 1AJQA 1YF2A 2VRZA 3PCOA 2PF4E 3P32A 1VQ6V 4KHPB 1HW7A 3A8TA 2Q0AA 1AVMA 1S5JA 1K7DA 2Y4TA 4LWSA 1Y76B 4NTWA 4JZGA 1DLBA 1IL2A 4O4LB 4AH6A 1W59A 3JALA 4IT5A 4O4JA 3ZHTA 4TT3G 1ASYA 3SPGA 1WA8A 3K9AA 2E76B 4KXRA 2ZIOA 1MOFA 4X1YA 4I55B 4BIOA 2ZIMA 2CAZC 1Q3EA 1OCCB 4TV9A 1V54B 2XTAA 3C90A 2EIMC 3EXAA 1E1QG 1IURA 3BHPA 3M7MX 2PZSA 4OGQB 4X8AA 5DN6G 1XREA 4FM0A 1X01A 4UPAA 1XQ8A 4P30A 3TEHA 2XAQA 1B3QA 4GX5A 4BIZA 1FYJA 4XTZA 1K73W 3K0DA 4YPFA 2FTKA 4NTXA 5K1PA 2Z5UA 1PD3A 3OMNB 1GN6A 4X66O 4PA7A 1NVPB 1EM1A 1GM7A 1XEQA 4X66B 4ICGA 1NH2D 4FM2A 3AG3B 3H9VA 1B70B 1G6UA 3U0ZA 4ZTUB 4RUFA 3A0HZ 2EINC 2HR3A 4C7UA 1NQTA 3E8FA 4LFAO 4UXNA 1VF6C 4CH6A 4LFAB 5LHGA 4NVPA 1X54A 2DXTA 1NTZH 4O4HA 4YRSA 4GYCB 5J2TB 3CXHF 4FPPA 3HKEA 3OE7G 3N2GA 1XL6A 1EZVH 2P7TC 3OM3B 1RPOA 4UV8A 2WLIB 4LCUC 4AI8A 4JYAO 4NXMO 1JJCB 4YRNA 4JYAB 4XTYA 1MG1A 4NXMB 4TQDA 4TSFG 1B06A 4ZOLA 1PKXA 4LF6O 3AG4C 1N36O 5L3DA 4GT1A 1GAXA 1BE3H 4UCVA 1KQSU 4LF6B 4LVIA 1N36B 1VQNV 2YXHA 3AG2C 2ARUA 3A32A 2QSAA 2DZ9A 4YIPA 4AILC 2KKWA 1AILA 2QEXV 2PUSA 4FFBA 1GTOA 2Q7EA 4DUZO 4O2AA 4R8CA 5LGTA 2QTSA 4DUZB 5ELOA 2YICA 4XTUA 4X62O 3RT3C 4DR5O 5C8YB 2DDZA 5KLVH 4X62B 5F5WA 1E1OA 4DR5B 2EIJC 2O57A 4L87A 4L8JA 5BMVA 4DV4O 2J3LA 3L72H 1XL4A 1SF9A 4UB6Z 3D3IA 4DV4B 3ABKB 2AHZA 2DYRB 1KB9F 1AP6A 5CA1A 2QWRB 3UO3A 2DQ0A 1VQPV 2PI5A 3HFZA 1BMFG 4N23A 4JZ2A 2ZM6O 1PYSB 2JGUA 2EZOA 1PPJH 2CE4A 5IJ0A 2JJ1G 3CX5F 3FB5C 1VEWA 1KMIZ 3HXUA 4O4IB 3M4PA 3LC0A 1K92A 3CC7V 1GMGA 2JEUA 2WSSG 1Q8IA 3BA9A 2PGGA 3CCRV 1YSCA 1EIYA 5LA6B 3RYHA 2VS0A 2MW2B 2IJIA 3X2QB 3W7UA 2XAHA 2JGDB 3OR6C 3OAAG 5JVDA 5KHGA 2ALYB 3LDCA 3LSSA 4XU1A 4ZHQB 2UU9O 3LNMB 3E22A 1VF7A 3JSLA 2UU9B 2Q0OC 1DTOA 1NTKH 4JAUA 4X88A 4LVJA 3Q4HA 1S76D 1WNLA 1XHZA 3REXA 3SYPA 4J15A 1YVWA 3HPLC 2M7WA 1YIJV 3SPCA 2AKWA 2Y48A 3ZRVA 1OHHG 2GTAA 4GX0A 3ABLC 2JIZG 3A7AA 1K5QA 1YGBA 4G27B 3HKBA 2YSUB 4MVZA 5DM6V 3WQZA 2Y69C 2DWEC 4Q20A 1WB8A 2CH7B 2CTWA 3LDEA 4IL6Z 3SGIA 2PMEA 4YRGA 2LQTA 3SYOA 3WG7B 3T4DA 3ZHQA 4GLXA 5FL7G 1XDCA 3CC4V 2ZR2A 3EVKA 3K9SA 2Q67A 1XNQO 1KMNA 4IHJA 1TVKA 3DXRB 5E1AC 1K97A 3JASB 3J81N 1NZ6A 1ASZA 4P71C 3CP1A 4NCXA 2OIGA 2H3OA 1G5IA 1XBLA 4ZBMA 5H2FZ 5KUKA 4JI2O 1UFIA 2LW1A 1JVMA 2YEVA 1KECA 5JCOC 1Y6XA 4WFHA 4K87A 3ABTA 1YITV 5IT9N 3CS5A 1K34A 1D5AA 4JTAB 2GTSA 3MHSC 2MK3A 1XMOB 4DRXA 3M4QA 3BABA 1P49A 5LOVB 2QWNB 3ZX6A 4JTDB 3ASNC 5IWAO 4CC5A 3EFRA 1EFWA 4WFBV 2XNDG 5BY1A 5IWAB 1QLEC 1KBHA 1UJWB 3CRRA 3OFNG 1QQCA 3FB8C 4FFKA 4PD4F 3E8HA 2QGNA 4JI5O 3CCEV 4ZIBA 4JI5B 1GN3A 4RQEA 1QR8A 5CN0A 4JI8O 2BSKB 4LC1A 2ZT7A 4HNAB 2YIAA 1VQLV 3WB1A 4JI8B 1B6QA 3IFXA 2BTQA 5IJ9A 5KX5B 5IE9A 4LNUB 4PDVA 4UP9A 2PY5A 1KP3A 3RN4A 1FS0G 2AW9A 4FLVA 2EJRA 1FXVA 1G1XB 4DR4O 4KR2A 4WCEV 4BW5A 3V8JA 5JWPA 1NBMG 1WJZA 4DR4B 1KUQA 2E3CA 4HWRA 5F2VO 1ZUQA 4F6RB 4LF4O 1NJ1A 2DU7A 4I4TB 4BAYA 1F4MA 3P8YA 5L3CA 2VWKA 2C7IA 1Z2GA 4WBNB 3ETQA 3ZRWA 3A31A 1L0WA 2A79B 2UXCO 3G71V 2NN4A 4DR3O 2D3OW 3B40A 1SZXA 3BEHA 3RWRD 2UXCB 4JYCA 4DR3B 4LF5O 4H2UA 1M56B 1ZSPA 3VBBA 1SQFA 2UXDO 5FNVB 3RKXA 1X2GA 1J5EO 3E8GA 2UXDB 5JH7B 4I7ZB 3FD9A 1B7YA 2AHYA 3K57A 1J5EB 4XDJA 2WLLA 4JGSA 1QLNA 1AB3A 4NXNO 3EFSA 3ASOB 1YJWV 4MVUA 4NXNB 1MSWD 1Z7NA 1GRJA 3E35A 4H2XA
chains in the Genus database with same CATH topology
3JYCA 1OCZC 2XAJA 2P0LA 3OW2U 3ABMB 4HAMA 2ZTGA 1NNHA 3HRIA 2QHTA 1FXKA 1TUEB 4JAVA 5IYDO 1EQRA 2CJ9A 4YRCA 3A7AA 4RO2A 3K08A 3TK1A 4ZKIA 2E64A 1G5HA 3T4ZA 1YFRA 2ZCEA 2W0FC 1KKDA 4TVYA 2DQ3A 2ZNJA 2A8EA 4H2VA 4H2YA 4XTVA 4YROA 5LBQA 5IYBO 3W7TA 4E2LA 3K3WA 2X0LA 3RW0A 3JCZA 1BBWA 2NS6A 2C2AA 1YFSA 2CJAA 1HXDA 3LDDA 1JJ2U 5B3SB 3OR7C 4FMTA 4LBEC 2ZXWB 2DTIA 5IY5B 1R3LC 2EIMB 2Q68A 4PELA 2EZPA 3QO5A 4MW8A 3ICAA 1HTTA 4PG3A 2DU5A 1GK9A 5B1BC 3STLC 1RIQA 1WLEA 1NR7A 3OEHG 4HWPA 3L4GB 1Q86W 1YTFD 4YRFA 1NJ2A 2WLJA 1VQOV 5CBGA 5LGUA 2IW5A 4QE9A 1VQMV 4X5OA 4YXWG 2QE7G 4H37A 4N21A 5IYCO 2CGHA 2P5IA 1ROPA 3CD6V 5L3FA 5LGNA 2X7RB 2OTLV 1HWYA 4WF2A 1NYQA 4CH5A 5H6QA 2I4NA 3CMAV 3CCJV 2WLHA 2Q7HA 5EC1C 1M56C 3ZMSA 4MVMA 1AJPA 3A74A 4CS3A 3IGAC 3STZC 2ZT8A 4G85A 1S5HC 4UVBA 3E2EA 1NYRA 1X2HA 1YFTA 4KQEA 1OZ0A 2Z3YA 4BWAA 2EIKB 2GHYA 3JD2A 2QHUA 2G4CA 4CS4A 1Y4MA 1VQ7V 2P6JA 3PZCA 1X55A 3CMQA 4P75C 3SPIA 3HB3B 2JK5C 2YEVB 2W6JG 3BY6A 1K3EA 4FJCC 1PNLA 1NH2B 3GB7C 1AJQA 1OCOB 5EBLC 1E22A 5C53B 3PCOA 3R65A 4WI1A 5LHIA 1WYDA 2HKOA 2ZDIA 3P32A 4UUJC 3NENA 2EINB 3NETA 3ASOC 1IXMA 3IC7A 1QE0A 3IG2A 2WPDG 1VQ6V 3UH0A 4PA3A 1AI5A 2LFRA 5L3BA 1N9WA 2ZR3A 3ABLB 1E24A 3JD1A 1M90W 3ZCCA 3NEMA 2RHSB 5C52B 1JOYA 1K7DA 2Y69B 4EX5A 2WAMA 3ABMC 3RACA 2ZNIA 1R6NA 3V7CA 4QNHB 2ALYA 3GWOA 3UGTA 1K4CC 2A0LA 1DLBA 5KNNA 3MD0A 4TWKA 2I4LA 4AH6A 1IL2A 1YJ9V 1EFRG 1K33A 4HWOA 3SYAA 2DJZA 4TT3G 1EOVA 3SPGA 1ASYA 1VQ4V 3K0GA 3K9AA 2RHQB 4OP0A 2CJBA 2ZIOA 2IU0A 1MOFA 5KUMA 2ZIMA 3F7YC 3A7UA 3D36A 5B3SC 1RM1B 4RMFA 1OCCB 4RAIA 2W6IG 1V54B 2ZXWC 1YTFB 3HTZA 3W7XA 2EIMC 4UVAA 3AG4B 3OD1A 4XU0A 3R07A 4GCZA 4KR3A 1E1QG 2EJ9A 2B5UA 1PNKA 2ZD9A 1VQKV 1KP2A 5ELNA 3RIRA 2JEXA 5B1AB 4WF9V 4X8AA 5DN6G 1EVKA 1G8MA 3AG2B 4R7CA 1X01A 4TWAA 4H33A 4RDXA 1CP9A 1H38A 4R6ZA 2E41A 4UPAA 2B1GA 3I56V 4P30A 3B8NA 4PDLA 1SETA 2XAQA 3P30A 4FIPC 4GX5A 4BIZA 3CCLV 2DZCA 3HXWA 2BOCC 3TEHA 11ASA 4YREA 2ZQMA 4TVWA 4XTZA 1K73W 3RUXA 1F23A 3K0DA 1WU7A 1S0VA 2QHVA 5H9CA 2H8PC 2FTKA 4YPFA 2XTIA 1S77D 3E9IA 2Z5UA 3RGLA 4EO4A 3V8LA 4E51A 1THZA 4PA4A 3W7WA 1AI7A 1PD3A 3OMNB 3ASNB 1FXHA 1MABG 4PA7A 1NVPB 4H2TA 2HLDG 1GM7A 2EAYA 2DVEA 2EIKC 2EIJB 2Q5HA 4Q6GA 3TEGA 3I55V 2K1EA 4PDRA 1NH2D 1W66A 1NJ5A 3UGQA 4YYEA 3AG3B 4PHCA 1G4YB 4P74A 3V7RA 1B70B 4XDLA 4QJFB 2J3MA 2CIMA 3CYOA 4MVQA 3RKYA 4ZTUB 3PJSK 4JPRA 3OUFA 4RUFA 3RVYA 4P9OA 2EINC 4X89A 2UXXA 2HR3A 4OXSA 3A5ZA 4MTGA 2WLMA 1FYFA 1NQTA 3E8FA 4LVLA 4UXNA 4CS2A 4UVCA 4P2ZA 1BIAA 4G84A 2XAGA 3ZN0A 3K04A 3MHHC 4CH6A 5L3GA 5LHGA 3ERRA 4I5SA 1X54A 2DXTA 4LVKA 1VQZA 4YRSA 1QBZA 2OT5A 1EVLA 3AG1C 4P3PA 2AKWB 4YCUA 4YP0A 4H2XA 1B7YB 4FPPA 1J5WA 2ZZFA 3QO7A 2WLNA 3OE7G 5C93A 4BIUA 4ZTZB 1XL6A 3OEEG 2NLJC 2OCCB 2P7TC 2P67A 2WLLB 3OM3B 3ZIAG 1PL0A 1RPOA 4UV8A 2ARSA 2WLIB 4LCUC 4MTOA 4XTWA 1GO3F 4XEOA 4YRJA 1NR1A 2QM7A 3ETEA 5BZBA 1JJCB 1ADJA 2QHSA 4YRNA 3LUTB 5C51B 4XTYA 4MVRA 1MG1A 4MTFA 1RM1C 1OCCC 2KB1A 1S72V 3CCVV 1V54C 4G28B 3CPWU 2ZZEA 3B8MA 4H2XB 4YCWA 4TQDA 4TSFG 1PKXA 3HXXA 4YRTA 1M57B 3K79A 3SPJA 3AG4C 1BL8A 3QTCA 4DPGA 3MQZA 5L3DA 4GT1A 3A7RA 4O2DA 1KQSU 1FXKB 4LVIA 1VQNV 3ZN1A 3HY0A 3VQWA 5B1AC 1EZJA 3FYIB 1R73A 3AG2C 2ARUA 4RUEA 3UKMA 3A32A 1G51A 2DZ9A 4F4LA 3CC2V 1GGMA 3VQXA 3RL6A 2E65A 1PNMA 1KD1W 2QEXV 1GTOA 2I4MA 2Q7EA 1W0JG 1ADYA 1JCHA 2IY5A 3IKMB 1KC8W 1OCRC 4R8CA 5LGTA 5ELOA 3UM7A 3HY1A 4XTUA 2IH1C 2E5AA 3ETGA 5HFMA 2JDIG 2NNUA 5CBFA 1NVPD 1QVFU 1J95A 3TUPA 4WFGA 2DDZA 2RHSA 5F5WA 4YCVA 4YRLA 1RPRA 1E1OA 4OLFA 4WJ3M 2EIJC 2XOKG 4L87A 1NJ8A 5LHHA 2J3LA 4K88A 1R3IC 1XL4A 2FYKA 2HVKC 5EBMC 4EKWA 1NKDA 3D3IA 2DYSB 3BFMA 3EFFK 3ABKB 4WJ4A 2AHZA 2DYRB 2HNIA 2EILB 4P9PA 3ZJZA 3G1ZA 3L2ZA 4DQ2A 4XBFA 1P7BA 2DQ0A 1VQPV 3IKLA 2PI5A 4G2KA 12ASA 1ATIA 5EK0A 4BW9A 3HFZA 1BMFG 1SRYA 4N23A 1PYSB 4LP8A 1OCZB 1R6KA 3ML0A 4YRIA 1P4RA 2EZOA 4JF3A 3HXYA 4I9WA 4MTXA 2JJ1G 1GM9A 2BOBC 2XASA 3ZMTA 2JJ2G 3FB5C 4MSWC 3ZMZA 1H4TA 3ZRSA 1I5XA 1DF5A 2HFEC 3RBZA 2IJKA 3ZRXA 3F7VC 4WFEA 3HXUA 2ITCC 2HJFC 2ZXFA 3LC0A 1K92A 1EBOA 3CC7V 3M4PA 4CBCA 5IY5C 4HWSA 5CMUA 4XTXA 5E3IA 1GMGA 3PCOB 2JEUA 1F4NA 3QNEA 4YRKA 3E8BA 2WSSG 4YRMA 3CCQV 2LP7A 2WLKA 4P75A 3H01A 2P90A 3CCRV 4Z1MG 3T2MA 1V55B 1YSCA 1EIYA 3CCSV 4TVAA 1M57C 4LNSA 1R3KC 5HGQA 4UV9A 2IJIA 4PA9A 3X2QB 1ZWIC 3W7UA 2XAHA 2ODRD 1WQ7A 3OR6C 1NJ6A 3OAAG 2ALYB 3LDCA 3LSSA 1F51A 4XU1A 3SJQC 3LNMB 4HYOA 3ZMVA 1W0KG 3UFGA 2ATKC 2HG5C 1AJNA 4TTVA 1Q82W 4R50A 1DTOA 3CCMV 3TCUA 4JAUA 4X88A 1B8AA 1QLEB 4P73C 4LVJA 2B1IA 1S76D 4QPKA 1WNLA 3REXA 4U7OA 3SYPA 4J15A 4H2SA 4MW3A 3HPLC 2M7WA 4MT8A 1YIJV 3NXSA 1W2BU 3ZRWB 3SPCA 4HA8A 1H8HG 4KUMA 1OCOC 3L1AA 3P8VA 2AKWA 2Y48A 3AEIA 3ZRVA 4K86A 4XU2A 2QM8A 2F43G 5L3EA 1OHHG 2R9RB 4GX0A 2EL9A 3ABLC 2JIZG 4QPJA 4MVOA 1K4DC 2H94A 1CPYA 2DYSC 3K06A 2X6CA 3ABKC 1VQ8V 4P72C 2EJGA 1K5QA 1AR1B 1YGBA 2EILC 4G27B 4Q15A 4MVZA 2YSUB 5DM6V 3WQZA 2Y69C 2DWEC 3JD4A 4Q20A 3L4GA 4KFMA 1SESA 3LDEA 2Q7GA 2PMEA 3MF2A 4YRGA 1LNQA 1BIBA 3RKWA 3SYOA 3WG7B 4QIWF 1E1RG 3T4DA 5FL7G 3CC4V 2ZR2A 2ZZGA 3VQYA 1K8AW 4YDQA 2Q67A 2OTJV 3KG2A 4FK5C 1KMNA 2AMCB 3OMIB 3HXVA 1H8EG 4PA6A 1K97A 5E1AC 3V8KA 2E1HA 1ASZA 4P71C 1VQ9V 4H2WA 3CP1A 2X6AA 2DXUA 4NCXA 3CMEV 1Y66A 1G5IA 2ZDIC 4P73A 2HVJC 4ZBMA 5KUKA 1HC7A 3JD0A 4WFFA 4UP8A 1WPXA 1JVMA 2DW4A 1L1FA 2ZT5A 1AROP 1S3JA 2YEVA 3LSQA 5EBWC 2Q5IA 1KECA 4RQFA 2X6BA 4YRQA 4WFHA 1V55C 2EJFA 4P3OA 5K1XA 2IU3A 4K87A 4PDMA 2Q69A 3ABTA 1YITV 2PMFA 4MS2A 1K34A 3HXZA 4H02A 4U7NA 2GSMB 2R9IA 3X2QC 3BJUA 1GKFA 2QA4V 2DWDC 4JTAB 1H4QA 3VOUA 3MHSC 1ENVA 3SPHA 3F5WC 3DTUB 5K1PA 2MK3A 1KMMA 2ZT6A 1QCEA 4JASA 3M4QA 3T1CA 1DF4A 4P72A 1USYC 4JTDB 3ASNC 4XDKA 1YJNV 4DXWA 3OGCC 2UXNA 1NJIW 2ZINA 2EBOA 3EFRA 1EFWA 4WFBV 2XNDG 1M1KW 1QLEC 2V7QG 1UJWB 4ASUG 1BHBA 3V7SA 1GM8A 3OFNG 1PYSA 1QVGU 3FB8C 3AG3C 1AI6A 2Q6AA 5B1OA 3A5YA 3E8HA 3I7FA 3FJPA 1Q81W 3FB7C 4HVCA 3CCEV 2RHQA 4LVMA 3W3SA 1AI4A 4ZIBA 3K03A 4RQEA 5H6RA 1QR8A 1E79G 5CN0A 4P71A 3TETA 4XEMA 4LC1A 2ZT7A 3HFVA 4TQFA 2DEQA 1VQLV 3VQVA 1B6QA 3IFXA 2ZGWA 1JX9A 1K5SA 2A9HA 2IJJA 3A0RA 3E86A 3ZMUA 3FKSG 5CBHA 2PI4A 1BBUA 3E89A 5HFLA 1M9NA 2I4OA 1QF6A 2IY5B 1JQ0A 4P3NA 4PDVA 2E10A 4UP9A 1C0AA 1KP3A 5CA3A 2ARTA 3WG7C 1FS0G 3G4SV 1Z7MA 3FYEB 5B1NA 1H2GA 3FB6C 3EHBB 3RVZA 2OCCC 3REUA 5GW7A 2DKGA 1H4SA 2EJRA 1FXVA 3AG1B 4KR2A 4WCEV 1BHAA 4YRPA 5EC2C 4BW5A 3OMAB 3V8JA 4JYBA 4CH4A 4HWTA 1YI2V 1NBMG 1KOGA 3QO8A 2E3CA 4CH3A 4HWRA 3DSQA 4P74C 3SYQA 1USYA 5KA5A 3JD3A 4KP4A 2EWNA 5B1BB 5IDJA 3MF1A 1N8RW 1R3JC 1ORQC 2WWWA 1NJ1A 2DU7A 4JTCB 2IH3C 1F4MA 4BAYA 5L3CA 3P8YA 1FXKC 1B76A 2C7IA 1COWG 1YB3A 3DGEA 4WFAV 4UP7A 1SZTA 3HFZB 3RF1A 4CZZA 3ZRWA 2ODRC 1YHQV 3A31A 4HZ3A 1B70A 3NELA 3MEYA 3P8TA 1L0WA 2A79B 3CXCU 3G71V 1K9MW 2QKSA 2D3OW 3ABUA 2CK3G 3BEHA 3OUSA 3CCUV 1WPYA 4J9ZB 3IALA 3SYCA 2DTHA 4JYCA 3E9HA 2XAFA 4GX1A 1VQ5V 1M56B 4H2UA 3TEHB 2QTOA 4J9YB 1QR9A 1H4VB 4GX2A 4QE7A 1E1TA 3KFUA 3VBBA 2XGTA 5J9PC 5KA6A 1JPXA 3RKXA 2IJHA 1X2GA 1I5YA 1Q7YW 1OCRB 1FFTB 3E8GA 3B77A 1B7YA 4MVSA 1SERA 2AHYA 1LYLA 2LFSA 1X56A 4XDJA 4XU3A 2WLLA 1CEZA 3E83A 1EIYB 4JGSA 2WLIA 1QLNA 4TVAB 2C8MA 2DYRC 2V1DA 3EFSA 2AMCA 4DO2A 3W7SA 2DTOA 3ASOB 1JJCA 4HT4A 2ITDC 1WQWA 1YJWV 4MVUA 3WFVA 3G6EV 1MSWD 3ETDA 4YRRA 1Z7NA 3E35A 3M99B 3HRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0L A;  2ZTG A;  3HRI A;  1NNH A;  2QHT A;  2CJ9 A;  1EQR A;  4YRC A;  2E64 A;  1G5H A;  1YFR A;  2ZCE A;  4TVY A;  2DQ3 A;  2ZNJ A;  4H2V A;  4H2Y A;  4XTV A;  4YRO A;  1BBW A;  1YFS A;  2CJA A;  1HXD A;  2DTI A;  3QO5 A;  3ICA A;  1HTT A;  4PG3 A;  2DU5 A;  1RIQ A;  1WLE A;  4HWP A;  3L4G B;  4YRF A;  1NJ2 A;  4X5O A;  2CGH A;  2P5I A;  4WF2 A;  4CH5 A;  1NYQ A;  2I4N A;  2Q7H A;  3A74 A;  4CS3 A;  2ZT8 A;  4G85 A;  1NYR A;  1X2H A;  1YFT A;  4KQE A;  4BWA A;  2QHU A;  2G4C A;  4CS4 A;  3PZC A;  1X55 A;  3CMQ A;  4P75 C;  1E22 A;  5C53 B;  3PCO A;  4WI1 A;  1WYD A;  3NET A;  3NEN A;  3IG2 A;  1QE0 A;  3UH0 A;  1N9W A;  2ZR3 A;  1E24 A;  3NEM A;  2RHS B;  5C52 B;  4EX5 A;  3RAC A;  2ZNI A;  3V7C A;  2ALY A;  5KNN A;  3UGT A;  1IL2 A;  2I4L A;  4AH6 A;  4HWO A;  2DJZ A;  1EOV A;  1ASY A;  2RHQ B;  4OP0 A;  2CJB A;  2ZIO A;  2ZIM A;  3A7U A;  4RMF A;  3HTZ A;  3OD1 A;  4XU0 A;  4KR3 A;  3R07 A;  2EJ9 A;  3RIR A;  5ELN A;  1EVK A;  4TWA A;  4RDX A;  1X01 A;  4UPA A;  2E41 A;  3TEH A;  1SET A;  2DZC A;  3HXW A;  11AS A;  4YRE A;  4TVW A;  4XTZ A;  3RUX A;  1WU7 A;  2QHV A;  4YPF A;  2XTI A;  3E9I A;  5K1P A;  4EO4 A;  3RGL A;  3V8L A;  4E51 A;  4H2T A;  2EAY A;  2DVE A;  2Q5H A;  4Q6G A;  3TEG A;  1W66 A;  1NJ5 A;  3UGQ A;  4YYE A;  4PHC A;  3V7R A;  4P74 A;  1B70 B;  2J3M A;  2CIM A;  3RKY A;  4ZTU B;  3A5Z A;  1FYF A;  4CS2 A;  1BIA A;  4G84 A;  4CH6 A;  3ERR A;  2DXT A;  1X54 A;  1VQZ A;  4YRS A;  1EVL A;  4P3P A;  2AKW B;  4YCU A;  4YP0 A;  1B7Y B;  1J5W A;  2ZZF A;  3QO7 A;  4ZTZ B;  2ARS A;  4YRJ A;  4XTW A;  4XEO A;  1JJC B;  1ADJ A;  2QHS A;  4YRN A;  5C51 B;  4XTY A;  4YCW A;  2ZZE A;  4H2X B;  4TQD A;  3HXX A;  4YRT A;  3QTC A;  4DPG A;  3A7R A;  4O2D A;  3HY0 A;  3VQW A;  2ARU A;  3A32 A;  1G51 A;  2DZ9 A;  1GGM A;  3VQX A;  3RL6 A;  2E65 A;  2I4M A;  2Q7E A;  1ADY A;  2IY5 A;  3IKM B;  5ELO A;  3HY1 A;  4XTU A;  2E5A A;  3TUP A;  2DDZ A;  2RHS A;  5F5W A;  4YCV A;  4YRL A;  4OLF A;  1E1O A;  4WJ3 M;  4L87 A;  1NJ8 A;  2J3L A;  4K88 A;  2FYK A;  3BFM A;  4WJ4 A;  2HNI A;  3G1Z A;  3L2Z A;  4DQ2 A;  2DQ0 A;  3IKL A;  12AS A;  1ATI A;  4BW9 A;  3HFZ A;  1SRY A;  1PYS B;  4YRI A;  3HXY A;  1H4T A;  3HXU A;  2ZXF A;  3M4P A;  3LC0 A;  5E3I A;  4XTX A;  4HWS A;  3PCO B;  3QNE A;  4YRK A;  4YRM A;  4P75 A;  1EIY A;  4TVA A;  4LNS A;  5HGQ A;  2ODR D;  1WQ7 A;  1NJ6 A;  2ALY B;  3LSS A;  4XU1 A;  3UFG A;  4TTV A;  1B8A A;  4P73 C;  1WNL A;  3REX A;  4J15 A;  4H2S A;  4HA8 A;  3L1A A;  3P8V A;  2AKW A;  4K86 A;  4XU2 A;  2EL9 A;  3A7A A;  3TEH B;  4P72 C;  2EJG A;  1YGB A;  4Q15 A;  3WQZ A;  3L4G A;  2PME A;  1SES A;  2Q7G A;  3MF2 A;  4YRG A;  1BIB A;  3RKW A;  2ZR2 A;  2ZZG A;  3VQY A;  4YDQ A;  2AMC B;  1KMN A;  3V8K A;  2E1H A;  1ASZ A;  4P71 C;  4H2W A;  2DXU A;  4NCX A;  1G5I A;  4P73 A;  1HC7 A;  4UP8 A;  2ZT5 A;  4YRQ A;  3LSQ A;  2Q5I A;  4RQF A;  4P3O A;  2EJF A;  5K1X A;  4K87 A;  2PMF A;  3HXZ A;  4H02 A;  3BJU A;  1H4Q A;  1KMM A;  2ZT6 A;  3M4Q A;  4P72 A;  1USY C;  2ZIN A;  3EFR A;  1EFW A;  3V7S A;  1PYS A;  3A5Y A;  3I7F A;  3FJP A;  4HVC A;  2RHQ A;  3W3S A;  4ZIB A;  4RQE A;  4P71 A;  4XEM A;  2ZT7 A;  4TQF A;  3HFV A;  2DEQ A;  3VQV A;  2ZGW A;  3HXV A;  4YRR A;  1QF6 A;  1BBU A;  2IY5 B;  2I4O A;  4P3N A;  2E10 A;  4UP9 A;  1C0A A;  2ART A;  1Z7M A;  3REU A;  2DKG A;  1H4S A;  4KR2 A;  4YRP A;  3V8J A;  4CH4 A;  4HWT A;  1KOG A;  3QO8 A;  2E3C A;  4CH3 A;  4HWR A;  3DSQ A;  4P74 C;  1USY A;  2EWN A;  3MF1 A;  1NJ1 A;  2DU7 A;  3P8Y A;  1B76 A;  2C7I A;  1YB3 A;  3RF1 A;  4UP7 A;  3HFZ B;  3A31 A;  2ODR C;  1L0W A;  1B70 A;  3NEL A;  3MEY A;  3P8T A;  1WPY A;  3IAL A;  2DTH A;  3E9H A;  4H2U A;  1H4V B;  1E1T A;  3KFU A;  3VBB A;  2XGT A;  3RKX A;  1X2G A;  1B7Y A;  1SER A;  1LYL A;  1X56 A;  4XU3 A;  1EIY B;  4TVA B;  2C8M A;  3EFS A;  2AMC A;  2DTO A;  1JJC A;  1WQW A;  1Z7N A;  4H2X A;  3HRK A; 
#chains in the Genus database with same CATH topology
 3JAT A;  4TV8 A;  3OW2 U;  3ABM B;  1BQZ A;  2QHT A;  1TUE B;  1EN4 A;  4JAV A;  2RCV A;  3QF7 A;  4EB6 A;  5LP6 C;  2W0F C;  2DQ3 A;  4JI4 O;  2YDE A;  4XTV A;  2RN9 A;  5LBQ A;  3K3W A;  4JI4 B;  1BBW A;  2C2A A;  1SKV A;  1RSO A;  2ZE6 A;  4Z1V A;  1Q6I A;  3DC6 A;  4FMT A;  3APO A;  2B9Z A;  3JSN A;  4AQY O;  4YY3 O;  3QO5 A;  3K58 A;  2EX3 A;  4PG3 A;  2DU5 A;  3STL C;  3OEH G;  4YY3 B;  1L0L H;  4HWP A;  4X5O A;  1N0J A;  2KG7 B;  5IYC O;  3GWK C;  5LL6 Y;  1HWY A;  4WF2 A;  2NR5 A;  3UT5 A;  1AJP A;  2ZT8 A;  1S5H C;  4KQE A;  4H0L B;  2EIK B;  3JD2 A;  4CS4 A;  3CRC A;  2CGN A;  3CMQ A;  2W6J G;  4FJC C;  1NH2 B;  3GB7 C;  1XIL A;  5C53 B;  3ZHS A;  3IG2 A;  5L3B A;  2ZR3 A;  3ABL B;  4JV5 O;  4I0X A;  3JD1 A;  1E24 A;  5LXT A;  4JV5 B;  2RHS B;  5C52 B;  2IBZ H;  1JOY A;  4X1K B;  2Y69 B;  1D5N A;  2WAM A;  4EX5 A;  3V7C A;  5KNN A;  3UGT A;  1K4C C;  1SA0 B;  3MD0 A;  1YJ9 V;  2GV9 A;  5JJJ B;  1K33 A;  1EOV A;  1VQ4 V;  2P22 C;  2RHQ B;  2A7W A;  4B7E A;  5IYZ A;  3D36 A;  2F4V O;  5B3S C;  4I50 B;  1RM1 B;  2D2C B;  2W6I G;  1YTF B;  3HTZ A;  2F4V B;  1XNR O;  3ZHV A;  3R07 A;  2YI9 A;  1XNR B;  1PNK A;  1VQK V;  2K9P A;  5B1A B;  1EVK A;  4H33 A;  1CP9 A;  2E41 A;  2B1G A;  3I56 V;  3JAK B;  3B8N A;  4PDL A;  3BVO A;  2BOC C;  5FPR A;  11AS A;  4TVW A;  3LSU A;  1WB7 A;  1F23 A;  4GKK B;  1S0V A;  5H9C A;  3OD4 A;  1S77 D;  3V8L A;  1THZ A;  1AI7 A;  3ASN B;  3OT7 A;  2Q5H A;  4GKJ O;  4PHC A;  3U10 A;  4GKJ B;  3C3S A;  4QJF B;  2J3M A;  4E4E A;  3RVY A;  1V9P A;  2QWP B;  1FYF A;  3BA8 A;  1DK1 A;  2XUM A;  5DED A;  1HNW O;  4G84 A;  4W4K A;  4J42 A;  1HNW B;  1VQZ A;  4JI3 O;  4P3P A;  4YP0 A;  2ZZF A;  3OTO O;  1IXB A;  5C93 A;  4ZTZ B;  3AK2 A;  1GO3 F;  4XEO A;  2QM7 A;  5BZB A;  3LUT B;  5TIS Z;  2P06 A;  4MTF A;  2KB1 A;  1S72 V;  4YCW A;  3HR0 A;  3CPW U;  3HKD B;  3HXX A;  4YRT A;  1M57 B;  3QTC A;  1Y67 A;  3MAQ A;  4TUY B;  4O2D A;  3HY0 A;  5EZY B;  2ODM A;  3CC2 V;  1IX9 A;  3VQX A;  3RL6 A;  3K59 A;  1JCH A;  2IY5 A;  3N2K B;  4JI1 O;  2E5A A;  5HFM A;  2JDI G;  1YCI A;  4JI1 B;  4H44 B;  4RWU A;  4YCV A;  3JAW A;  4WJ3 M;  1WAZ A;  1NJ8 A;  5KMG B;  2ETN A;  2HVK C;  5EBM C;  4EKW A;  3BFM A;  2DYS B;  5GON B;  2HNI A;  3BFR A;  2EIL B;  3ZJZ A;  3JAR B;  4O2B A;  2QR4 A;  1QHT A;  1YZB A;  1ATI A;  1SRY A;  2F1M A;  4LP8 A;  3RYC B;  4YRI A;  1EN6 A;  4MTX A;  2HP8 A;  2BOB C;  2XAS A;  4MSW C;  3FX7 A;  1XMQ O;  3ZRX A;  2IJK A;  3F7V C;  1H2L A;  5E79 Z;  5B66 Z;  5BXZ A;  5E3I A;  1XMQ B;  4HWS A;  1NI8 A;  3PCO B;  3QNE A;  3E8B A;  3KZI Z;  2LP7 A;  3H01 A;  2P90 A;  4Z1M G;  1SQG A;  1V55 B;  4B3M O;  1I7F A;  3K5O A;  3CCS V;  4TVA A;  1R3K C;  4UV9 A;  4B3M B;  1ZWI C;  4K3A A;  4J7J A;  4LWS B;  1WQ7 A;  3CRQ A;  2OCH A;  1PL4 A;  1XUQ A;  3UFG A;  3O65 A;  3JAL B;  4O4J B;  1WA8 B;  1VMG A;  1HR0 O;  4X1Y B;  4QPK A;  4U7O A;  4TV9 B;  1HR0 B;  4MT8 A;  3NXS A;  3J7A U;  4KUM A;  1OCO C;  5CB4 A;  3L1A A;  4XU2 A;  2F43 G;  4UCU A;  5L3E A;  4D7S A;  1K4D C;  2RQ6 A;  1CPY A;  3TEH B;  1AR1 B;  4QGP A;  4Q15 A;  3BRC A;  2Q7G A;  1BS3 A;  1LNQ A;  3IC9 A;  3RKW A;  2ZE8 A;  5GTH Z;  2FML A;  2LGW A;  1B04 A;  1NT2 B;  1K8A W;  2OYQ A;  2OTJ V;  4FK5 C;  4DUY O;  1H8E G;  3HKC A;  4PA6 A;  3H1H H;  4DUY B;  4H2W A;  1GN4 A;  2ZDI C;  2HVJ C;  3JD0 A;  4UP8 A;  1FKA O;  2DW4 A;  5EBW C;  3LSQ A;  2Q5I A;  3S3X A;  2ZE7 A;  4PDM A;  2Q69 A;  4B3R O;  3HXZ A;  4MS2 A;  4U7N A;  3SJB C;  4B3R B;  1ENV A;  4J7Z A;  3F5W C;  3DTU B;  4TOI A;  3HKE B;  5LYJ A;  2ZT6 A;  3N2G B;  2HEP A;  3T1C A;  4P72 A;  1H2K A;  1MZE A;  4JI0 O;  1IVS A;  4XDK A;  3OGC C;  2UXN A;  1NJI W;  2LGQ A;  2EBO A;  4JI0 B;  2V7Q G;  3V7S A;  1PYS A;  1QVG U;  5B1O A;  1AI6 A;  1ZX3 A;  1Q81 W;  3FB7 C;  4OPH A;  1A32 A;  3K03 A;  3B09 A;  4CC6 A;  4XEM A;  2N05 A;  1Q6U A;  1ZL8 A;  3HFV A;  2WA4 A;  1FAF A;  2ZGW A;  1JX9 A;  4FFB B;  5CBH A;  3HXV A;  2ZM6 B;  1QF6 A;  5HFL A;  1M9N A;  4O2A B;  4F6E A;  1Z7M A;  3RVZ A;  1H2G A;  3FB6 C;  2PYL A;  2ADQ B;  3REU A;  5GW7 A;  4DR6 O;  1BHA A;  5BMV B;  4JYB A;  1T5E A;  4HWT A;  3BAA A;  2PYJ A;  1UPG A;  4DR6 B;  4CH3 A;  3SYQ A;  1USY A;  5KA5 A;  2EWN A;  5B1B B;  4DW1 A;  2M6Y A;  1R3J C;  4D7T A;  1BQ0 A;  1VIB A;  3R66 A;  1B76 A;  5KHJ A;  1VF5 B;  3HFZ B;  1YHQ V;  4HZ3 A;  3P8T A;  3CXC U;  5IJ0 B;  1FFX A;  3CCU V;  4JI7 O;  4J9Z B;  3E9H A;  4U3F H;  2QTO A;  4JI7 B;  4GX2 A;  3RYF A;  4IYI A;  5KA6 A;  4DV0 O;  1JPX A;  2ZT9 B;  1I5Y A;  1Q7Y W;  1FFT B;  4FVM A;  2CH7 A;  1R1B A;  3O9O A;  3RYI B;  1EIY B;  1MZF A;  3RYH B;  1M5I A;  2C8M A;  2V1D A;  3CB2 A;  4DO2 A;  2DTO A;  1OV9 A;  4HT4 A;  3JAS A;  3E22 B;  2P0L A;  2YC0 A;  1HNX O;  2ZTG A;  3HRI A;  1NNH A;  2IM9 A;  1FXK A;  4ABM A;  2CJ9 A;  5IYD O;  3Q4H B;  2RJZ A;  3TK1 A;  1XNQ B;  4J80 A;  4JAA A;  2A8E A;  4YRO A;  2HJD A;  4E2L A;  3RW0 A;  1YFS A;  2CJA A;  5EYP A;  3LDD A;  1JJ2 U;  2AXT Z;  4X1I A;  4JI2 B;  2DTI A;  4FLX A;  2EIM B;  2Q68 A;  4ZI7 A;  4MW8 A;  1GK9 A;  1RIQ A;  1WLE A;  1NR7 A;  3HKB B;  1N32 O;  1ZAU A;  1QNM A;  4YRF A;  2WLJ A;  1N32 B;  1JJO A;  2V4D A;  4N21 A;  1JFF B;  2P5I A;  4X65 O;  5L3F A;  2YIB D;  2X7R B;  2OTL V;  4IHJ B;  1TVK B;  4Z2W A;  4X65 B;  3CMA V;  2WLH A;  3D36 C;  5BR8 O;  4DV5 O;  4LF8 O;  4BWA A;  2UUB O;  4J11 A;  1NYR A;  5BR8 B;  4DV5 B;  4U3J A;  4LF8 B;  1VQ7 V;  2UUB B;  2CGO A;  2P6J A;  3PZC A;  1X55 A;  3SPI A;  1XHX A;  2A3Q A;  2YEV B;  1PNL A;  1OCO B;  1BSM A;  1IZ3 A;  4WI1 A;  1WYD A;  2HKO A;  2ZDI A;  2EIN B;  2GBO A;  3WB2 A;  2Q5Z A;  1QE0 A;  1HDJ A;  2CDY A;  4PA3 A;  2LFR A;  1N9W A;  3M8A A;  3L74 H;  1BGY H;  2ZNI A;  3RAC A;  1R6N A;  2F66 C;  4QNH B;  2QDO A;  4TWK A;  4WBN A;  2I4L A;  4DYL A;  4K35 A;  5KAI Z;  2EJ7 A;  1EFR G;  3SYA A;  2DJZ A;  3K0G A;  4OP0 A;  2CJB A;  1DGS A;  5KUM A;  1YEW A;  4LF4 B;  3WU2 Z;  2UXB O;  4RMF A;  2JS5 A;  2ZXW C;  2UXB B;  4UVA A;  3AG4 B;  2BTQ B;  4XU0 A;  4KR3 A;  5IJ9 B;  2EJ9 A;  2AZ2 A;  2ZD9 A;  5ELN A;  4IYH A;  4WF9 V;  5LMU O;  3AG2 B;  3L73 H;  1H38 A;  4R6Z A;  5LMU B;  3P30 A;  4LF5 B;  2G38 A;  2CTQ A;  2DZC A;  3ZHR A;  4YRE A;  2ZQM A;  1WU7 A;  3KCY A;  2H8P C;  1TAE A;  2E5L O;  3E9I A;  3RGL A;  4PA4 A;  3W7W A;  1FXH A;  2E5L B;  2HLD G;  2EIJ B;  3WB0 A;  3I55 V;  1G4Y B;  1PP9 H;  3CYO A;  3RKY A;  3PJS K;  4JPR A;  3OUF A;  4X89 A;  4OXS A;  1ZTE A;  2R70 A;  3A5Z A;  4MTG A;  4LVL A;  3CSX A;  4P2Z A;  1BIA A;  3UCS C;  3MHH C;  5L3G A;  4LVK A;  3AG7 A;  1EVL A;  2OT5 A;  4EFE A;  3B4S A;  1B7Y B;  4LFB O;  1J5W A;  3QO7 A;  2L6L A;  4D6T H;  3OEE G;  2WLL B;  4LFB B;  3ZIA G;  4YJ2 A;  4MTO A;  4YRJ A;  4XTW A;  1NR1 A;  4AQY B;  3K5L A;  1ADJ A;  2QHS A;  2YI8 A;  5C51 B;  2GUZ B;  1OCC C;  2FKX A;  3CCV V;  1V54 C;  2ZZE A;  3L9D A;  4H2X B;  2VQE O;  3JAT B;  4TV8 B;  2OWO A;  3K79 A;  1BL8 A;  1H2N A;  4PI0 A;  2VQE B;  4FLW A;  3QG5 A;  2N04 A;  3A7R A;  3ZN1 A;  1EZJ A;  3FYI B;  4DV1 O;  4RUE A;  3UKM A;  4NYK A;  3CRM A;  4F4L A;  1PNM A;  4DV1 B;  1W0J G;  1Z5W A;  5D5Q A;  3IKM B;  3HY1 A;  5ITZ B;  2IH1 C;  3ETG A;  5CBF A;  1QVF U;  1J95 A;  3TUP A;  2RHS A;  1Y74 A;  2F23 A;  4OLF A;  1JR9 A;  5JQG A;  4OPA A;  3G80 A;  1AR4 A;  5LHH A;  1R3I C;  2FYK A;  4YJ3 B;  4JI6 O;  1P7G A;  4HBN A;  5AG2 A;  4X20 B;  1AR5 A;  3G1Z A;  3L2Z A;  4XBF A;  3IKL A;  3L71 H;  1VP7 A;  2Z0A A;  12AS A;  5EK0 A;  1MMM A;  3ML0 A;  1P4R A;  1Q43 A;  1PM9 A;  4JF3 A;  3HXY A;  1Q5O A;  3ZMT A;  3MDS A;  3ZMZ A;  1TUB A;  3CJH A;  1I5X A;  2HFE C;  2ZXF A;  4CBC A;  4XTX A;  2BE3 A;  1F4N A;  4YRK A;  3OTF A;  4YRM A;  2A06 H;  4FLU A;  4NB5 A;  2UUA O;  4PJ0 Z;  5LXT B;  2UUA B;  5J2U A;  5HGQ A;  5CA0 A;  2ODR D;  4H13 B;  5GTI Z;  1F51 A;  3SJQ C;  3FAV A;  4HYO A;  3ZMV A;  1W0K G;  4KL1 A;  2HG5 C;  4DV3 O;  4TTV A;  2XT9 A;  4IGG A;  3TCU A;  4DV3 B;  1B8A A;  1QLE B;  5IYZ B;  2B1I A;  3P8V A;  4K86 A;  3AK3 A;  2EL9 A;  4YIO A;  4MVO A;  2H94 A;  3K06 A;  2X6C A;  3ABK C;  4P72 C;  2EJG A;  3JD4 A;  5A2Q N;  3L4G A;  4KFM A;  1SES A;  3TXQ A;  1BIB A;  4JI3 B;  1X4T A;  4QIW F;  2YUA A;  3OTO B;  4IIJ B;  3VQY A;  2AMC B;  4LH7 A;  2E1H A;  4NR1 A;  3N27 A;  1VQ9 V;  2X6A A;  1I0H A;  2DXU A;  1S5L Z;  3CME V;  4UCT A;  4B7K A;  2R9A A;  4P73 A;  4JYY A;  4WFF A;  1WPX A;  2ZT5 A;  1L1F A;  4YRQ A;  1S3J A;  4RQF A;  2X6B A;  2EJF A;  1L8D A;  4P3O A;  1PV0 A;  5K1X A;  2IU3 A;  1KYO F;  2PMF A;  1XI1 A;  2GSM B;  3X2Q C;  4X9Q A;  3BJU A;  1GKF A;  2DWD C;  1QCE A;  4JAS A;  3ZS8 C;  1USY C;  2PTM A;  2F93 B;  1Y76 A;  4ASU G;  4O4L A;  1GM8 A;  1LUV A;  1SQQ H;  3A5Y A;  3I7F A;  1F7Y A;  4HVC A;  3W3S A;  1AI4 A;  4I55 A;  2AZ0 A;  5EIB D;  2N74 A;  1E79 G;  3TET A;  3VQV A;  4X64 O;  2DEQ A;  2RNB A;  1K5S A;  3ZMU A;  4X64 B;  2F95 B;  3A0R A;  3E86 A;  4KHP O;  4YRR A;  2PI4 A;  2HHH O;  2IY5 B;  2I4O A;  2KSD A;  4B3S O;  2W0X A;  2HHH B;  5CA3 A;  2YIB A;  5LP6 B;  2ART A;  3WG7 C;  4B3S B;  3EHB B;  5H5N A;  3TGU H;  2OCC C;  3P3P A;  3JAW B;  5EC2 C;  3OMA B;  1KOG A;  3DSQ A;  4P74 C;  3JD3 A;  4KP4 A;  3THO A;  3K5N A;  1N8R W;  4FLZ A;  1ORQ C;  2OIE A;  4O2B B;  1FXK C;  1HP8 A;  3DGE A;  4WFA V;  5DEC A;  4CZZ A;  2ODR C;  1B70 A;  3CEI A;  3MEY A;  1K9M W;  1VAR A;  2DOS A;  2CK3 G;  3OUS A;  1WPY A;  3IAL A;  2DTH A;  3H1J H;  2XAF A;  4GX1 A;  1VQ5 V;  1ZLZ A;  2LO1 A;  2QKC A;  1H4V B;  1BZK A;  1H2S B;  1MNG A;  5J2T A;  2YXL A;  3B77 A;  1LYL A;  2LFS A;  5LMN O;  4J10 A;  1H2M A;  1CEZ A;  3E83 A;  3T1H O;  5LMN B;  2WLI A;  4TVA B;  1M4U A;  2E75 B;  1KKC A;  4A5U B;  1JJC A;  3T1H B;  1WQW A;  2DN9 A;  3WFV A;  3ETD A;  3M99 B;  3HRK A;  4LVM A;  3IAY A;  1OCZ C;  5JJN B;  4DK1 A;  4K8X A;  3K08 A;  1WP7 A;  2E64 A;  2ZCE A;  4TVY A;  3G6B A;  1KKD A;  4H2V A;  4LH6 A;  3W7T A;  5CB4 B;  3RGB A;  3D3Q A;  2X0L A;  3JCZ A;  2NS6 A;  1HXD A;  3TXS A;  1N4C A;  3OR7 C;  5B3S B;  4LBE C;  5C8Y A;  2EZP A;  3ICA A;  2P4K A;  4DR1 O;  2DMX A;  5B5E Z;  4O4H B;  5KHI A;  1YTF D;  4DR1 B;  5D5P A;  1NJ2 A;  1VQO V;  5CBG A;  2IW5 A;  4QE9 A;  4YXW G;  2JS3 A;  4H37 A;  2CGH A;  3CD6 V;  4CH5 A;  1NYQ A;  5H6Q A;  3HKC B;  2I4N A;  2QKA A;  3CCJ V;  2RDC A;  5EC1 C;  1M56 C;  3ZMS A;  4K8Z A;  3STZ C;  4G85 A;  1MSD A;  3K5M A;  1IDS A;  4UVB A;  3E2E A;  4ZOL B;  1X2H A;  1OZ0 A;  2GHY A;  2G4C A;  1Y4M A;  4P75 C;  2JK5 C;  4O4I A;  5EIB C;  3SJC C;  3H1L H;  5EBL C;  1E22 A;  1TA8 A;  3R65 A;  5LHI A;  3NET A;  4UUJ C;  3NEN A;  2BCC H;  3J80 N;  3ASO C;  1IXM A;  3IC7 A;  4FLT A;  2WPD G;  3UH0 A;  1AI5 A;  5LYJ B;  3JAM N;  3CRA A;  1M90 W;  2UUC O;  4NTY A;  5LA6 A;  3ZCC A;  3NEM A;  2QWQ B;  2ZKO A;  4FZ1 A;  2UUC B;  3ABM C;  2JGD A;  3GWO A;  2ALY A;  2A0L A;  4ZHQ A;  2QJ1 A;  2DJV A;  4DV2 O;  4HWO A;  3H1I H;  4FLY A;  2IU0 A;  4DV2 B;  5CA1 B;  3F7Y C;  3A7U A;  4RAI A;  1D2D A;  1ZL8 B;  4UCO A;  3W7X A;  3OD1 A;  4GCZ A;  2B5U A;  4LF7 O;  3RIR A;  1KP2 A;  2JEX A;  4RDX A;  4TWA A;  1G8M A;  4R7C A;  4LF7 B;  1FJG O;  3TJT A;  3RYI A;  1Q90 D;  1SET A;  3CCL V;  1LUW A;  2Q9L A;  4FIP C;  1FJG B;  3HXW A;  1BCC H;  1X59 A;  1U96 A;  3RUX A;  5KAF Z;  4DV0 B;  2QHV A;  1GH6 A;  3L70 H;  4DV6 O;  2XTI A;  4EO4 A;  1WPB A;  4E51 A;  1IBK O;  1MAB G;  2AGA A;  4PI2 A;  1EN5 A;  4DV6 B;  4H2T A;  3APQ A;  2EAY A;  2DVE A;  2EIK C;  1IBK B;  4Q6G A;  3TEG A;  2K1E A;  3L75 H;  3DXR A;  4PDR A;  1W66 A;  1NJ5 A;  3UGQ A;  5JVD B;  4YYE A;  5JJE B;  3V7R A;  4P74 A;  4XDL A;  2CIM A;  4MVQ A;  4P9O A;  1FFX B;  2UXX A;  2VWJ A;  1HNX B;  2ADP A;  2WLM A;  4CS2 A;  3RYF B;  4UVC A;  1NS1 A;  2XAG A;  3ZN0 A;  3K04 A;  3NR7 A;  5KHK A;  3ERR A;  4I5S A;  1QBZ A;  3AG1 C;  4FM1 A;  2AKW B;  4YCU A;  4I9Q A;  2WLN A;  4BIU A;  2NLJ C;  5LOV A;  2OCC B;  2P67 A;  3CWB H;  1JFF A;  1PL0 A;  2ARS A;  1JMK C;  1WN7 A;  4FZ0 A;  3ETE A;  3KKY A;  1NTM H;  4MVR A;  1RM1 C;  1I94 O;  4G28 B;  3B8M A;  3SPJ A;  1I94 B;  4LF9 O;  4DPG A;  3MQZ A;  1FXK B;  4LF9 B;  3VQW A;  5B1A C;  1BT8 A;  2BSK A;  1R73 A;  4HNA A;  5FLX N;  1G51 A;  4EFB A;  4LFC O;  1GGM A;  2E65 A;  1KD1 W;  2I4M A;  1ADY A;  4LFC B;  5KX5 A;  1XMO O;  1KC8 W;  1OCR C;  5EYP B;  4LNU A;  3UM7 A;  4X1I B;  1OJH A;  3I5D A;  2NNU A;  1NVP D;  1VF6 A;  1Q6H A;  2YID A;  4WFG A;  4ZI7 B;  4YRL A;  1RPR A;  2XOK G;  3S3W A;  4K88 A;  2Q73 A;  3AK1 A;  3BPZ A;  2R72 A;  1NKD A;  4DRX B;  3EFF K;  4WJ4 A;  1CXZ B;  4F6R A;  3UQ8 A;  4P9P A;  4I4T A;  4DQ2 A;  1FD9 A;  1P7B A;  4G2K A;  1SC5 B;  4BW9 A;  1OCZ B;  1R6K A;  3U11 A;  3OGI B;  4I9W A;  2JVD A;  1GM9 A;  1P84 F;  4U3J B;  2JJ2 G;  2EUL A;  1H4T A;  3ZRS A;  1DF5 A;  3RBZ A;  4WFE A;  2FYU H;  2ITC C;  1JA8 A;  2HJF C;  1EBO A;  3T1Y O;  5IY5 C;  5CMU A;  5FNV A;  4B3T O;  3UO2 A;  3PN1 A;  3T1Y B;  5JH7 A;  4B3T B;  1U97 A;  2Q4P A;  3CCQ V;  1N34 O;  2WLK A;  4P75 A;  4PHZ A;  1N34 B;  3T2M A;  1M57 C;  1R6T A;  4LNS A;  4PA9 A;  2JRI A;  1NJ6 A;  3C3T A;  4NKG B;  4AHC A;  1YDX A;  3SDL A;  2ATK C;  1AJN A;  2QM4 A;  3A0B Z;  1Q82 W;  2QWO B;  4R50 A;  4GUN A;  3CCM V;  3LNN A;  4P73 C;  1Z5V A;  4H2S A;  4MW3 A;  1W2B U;  3ZRW B;  1TGO A;  4HA8 A;  1H8H G;  3AEI A;  2CUG A;  2QM8 A;  1FPO A;  2R9R B;  2DE0 X;  4QPJ A;  5KHH A;  2DYS C;  1VQ8 V;  2EIL C;  1WP8 A;  2Q8V A;  1AP5 A;  2GDS A;  4BR6 A;  2GUZ A;  3MF2 A;  3H1K H;  1YXB A;  1E1R G;  4UCS A;  2KG7 A;  4UB8 Z;  2ZZG A;  1US6 A;  1WNS A;  1URF A;  2Y0I A;  4PV1 B;  4YDQ A;  3KG2 A;  3OMI B;  3V8K A;  2YS8 A;  4EEQ A;  1SQB H;  2P5O A;  1Y66 A;  3DC5 A;  3BCC H;  1HC7 A;  1LR1 A;  5ITZ A;  2CTR A;  4UCR A;  4EB6 B;  1ARO P;  4DV7 O;  1V55 C;  1RP3 B;  4H02 A;  4DV7 B;  2R9I A;  5A9G A;  2QA4 V;  1RSO B;  1H4Q A;  3VOU A;  3SPH A;  4LR3 A;  1KMM A;  4YJ3 A;  1DF4 A;  4X20 A;  4YJ2 B;  1YJN V;  4X1K A;  4DXW A;  2ZIN A;  3ZED A;  1O9G A;  2FL4 A;  1M1K W;  3ZBH A;  2LJ2 A;  1SA0 A;  2XHB A;  1N33 O;  1BHB A;  3AG3 C;  2Q6A A;  2ILM A;  1N33 B;  1NU1 H;  3FJP A;  1N0N A;  2LW7 A;  2RHQ A;  4K0K O;  4JI6 B;  1HNZ O;  5H6R A;  4P71 A;  4I50 A;  4DK0 A;  4K0K B;  1O9H A;  4TQF A;  1HNZ B;  3UT5 B;  4DR7 O;  2Y4U A;  3GVM A;  2A9H A;  2IJJ A;  4DR7 B;  3B2E E;  3FKS G;  1BBU A;  3E89 A;  3A2F A;  1JQ0 A;  4P3N A;  2E10 A;  1C0A A;  3G67 A;  5FPO A;  5JCO A;  2BTO A;  3G4S V;  3FYE B;  5B1N A;  3JAK A;  3ZHU A;  1Y74 B;  1H4S A;  2DKG A;  1KU9 A;  3AG1 B;  3CE2 A;  4GZR B;  5JQG B;  4YRP A;  4CH4 A;  1YI2 V;  3QO8 A;  1QU7 A;  2KQX A;  4I0X B;  2Y0P A;  5IDJ A;  3MF1 A;  2WWW A;  3F5T A;  1I08 A;  4JTC B;  2IH3 C;  2E74 B;  1COW G;  1YB3 A;  4OX9 O;  1IBM O;  2VQF O;  4UP7 A;  1SZT A;  3RF1 A;  1M93 A;  4YHH O;  3NEL A;  4OX9 B;  1IBM B;  2VQF B;  2QKS A;  4YHH B;  1IBL O;  3ABU A;  1TUB B;  3SYC A;  3CJH B;  3RFR A;  1IBL B;  4J9Y B;  2WA3 A;  1QR9 A;  3KCX A;  4W4L A;  4QE7 A;  1E1T A;  3KFU A;  2FB5 A;  4J41 A;  4GKK O;  2XGT A;  5J9P C;  2IJH A;  1SQV H;  1OCR B;  1L0N H;  4MVS A;  1SER A;  3SJA C;  1X56 A;  4XU3 A;  2CTP A;  1MA1 A;  4IIJ A;  2DYR C;  5J2U B;  2AMC A;  1RFY A;  3W7S A;  1SQP H;  5CA0 B;  2ITD C;  3JCU Z;  3G6E V;  2RMK B;  2YXY A;  4DW0 A;  3FAV B;  3HKD A;  3JYC A;  2XAJ A;  4TUY A;  4HAM A;  1EQR A;  4YRC A;  5EZY A;  4RO2 A;  4ZKI A;  4B08 A;  1G5H A;  3T4Z A;  1YFR A;  2ZNJ A;  2ZE5 A;  4H2Y A;  5IYB O;  3CHX A;  3N2K A;  3FFQ A;  3ICX A;  1SQX H;  2ZXW B;  5IY5 B;  1R3L C;  4PEL A;  1HTT A;  5B1B C;  3IJ4 A;  3SR2 C;  3L4G B;  1Q86 W;  5KMG A;  2ARH A;  3P3N A;  5LGU A;  1VQM V;  4DR2 O;  2QE7 G;  5GON A;  4DR2 B;  1ROP A;  3JAR A;  3QVN A;  5LGN A;  2Q7H A;  1GN2 A;  4MVM A;  3A74 A;  4CS3 A;  3IGA C;  3D8C A;  1XOU A;  3RYC A;  2P4V A;  1YFT A;  2Z3Y A;  2QHU A;  4UFZ A;  1SS3 A;  4J7K A;  5LP6 A;  3HB3 B;  3BY6 A;  2L35 A;  1K3E A;  1AJQ A;  1YF2 A;  2VRZ A;  3PCO A;  2PF4 E;  3P32 A;  1VQ6 V;  4KHP B;  1HW7 A;  3A8T A;  2Q0A A;  1AVM A;  1S5J A;  1K7D A;  2Y4T A;  4LWS A;  1Y76 B;  4NTW A;  4JZG A;  1DLB A;  1IL2 A;  4O4L B;  4AH6 A;  1W59 A;  3JAL A;  4IT5 A;  4O4J A;  3ZHT A;  4TT3 G;  1ASY A;  3SPG A;  1WA8 A;  3K9A A;  2E76 B;  4KXR A;  2ZIO A;  1MOF A;  4X1Y A;  4I55 B;  4BIO A;  2ZIM A;  2CAZ C;  1Q3E A;  1OCC B;  4TV9 A;  1V54 B;  2XTA A;  3C90 A;  2EIM C;  3EXA A;  1E1Q G;  1IUR A;  3BHP A;  3M7M X;  2PZS A;  4OGQ B;  4X8A A;  5DN6 G;  1XRE A;  4FM0 A;  1X01 A;  4UPA A;  1XQ8 A;  4P30 A;  3TEH A;  2XAQ A;  1B3Q A;  4GX5 A;  4BIZ A;  1FYJ A;  4XTZ A;  1K73 W;  3K0D A;  4YPF A;  2FTK A;  4NTX A;  5K1P A;  2Z5U A;  1PD3 A;  3OMN B;  1GN6 A;  4X66 O;  4PA7 A;  1NVP B;  1EM1 A;  1GM7 A;  1XEQ A;  4X66 B;  4ICG A;  1NH2 D;  4FM2 A;  3AG3 B;  3H9V A;  1B70 B;  1G6U A;  3U0Z A;  4ZTU B;  4RUF A;  3A0H Z;  2EIN C;  2HR3 A;  4C7U A;  1NQT A;  3E8F A;  4LFA O;  4UXN A;  1VF6 C;  4CH6 A;  4LFA B;  5LHG A;  4NVP A;  1X54 A;  2DXT A;  1NTZ H;  4O4H A;  4YRS A;  4GYC B;  5J2T B;  3CXH F;  4FPP A;  3HKE A;  3OE7 G;  3N2G A;  1XL6 A;  1EZV H;  2P7T C;  3OM3 B;  1RPO A;  4UV8 A;  2WLI B;  4LCU C;  4AI8 A;  4JYA O;  4NXM O;  1JJC B;  4YRN A;  4JYA B;  4XTY A;  1MG1 A;  4NXM B;  4TQD A;  4TSF G;  1B06 A;  4ZOL A;  1PKX A;  4LF6 O;  3AG4 C;  1N36 O;  5L3D A;  4GT1 A;  1GAX A;  1BE3 H;  4UCV A;  1KQS U;  4LF6 B;  4LVI A;  1N36 B;  1VQN V;  2YXH A;  3AG2 C;  2ARU A;  3A32 A;  2QSA A;  2DZ9 A;  4YIP A;  4AIL C;  2KKW A;  1AIL A;  2QEX V;  2PUS A;  4FFB A;  1GTO A;  2Q7E A;  4DUZ O;  4O2A A;  4R8C A;  5LGT A;  2QTS A;  4DUZ B;  5ELO A;  2YIC A;  4XTU A;  4X62 O;  3RT3 C;  4DR5 O;  5C8Y B;  2DDZ A;  5KLV H;  4X62 B;  5F5W A;  1E1O A;  4DR5 B;  2EIJ C;  2O57 A;  4L87 A;  4L8J A;  5BMV A;  4DV4 O;  2J3L A;  3L72 H;  1XL4 A;  1SF9 A;  4UB6 Z;  3D3I A;  4DV4 B;  3ABK B;  2AHZ A;  2DYR B;  1KB9 F;  1AP6 A;  5CA1 A;  2QWR B;  3UO3 A;  2DQ0 A;  1VQP V;  2PI5 A;  3HFZ A;  1BMF G;  4N23 A;  4JZ2 A;  2ZM6 O;  1PYS B;  2JGU A;  2EZO A;  1PPJ H;  2CE4 A;  5IJ0 A;  2JJ1 G;  3CX5 F;  3FB5 C;  1VEW A;  1KMI Z;  3HXU A;  4O4I B;  3M4P A;  3LC0 A;  1K92 A;  3CC7 V;  1GMG A;  2JEU A;  2WSS G;  1Q8I A;  3BA9 A;  2PGG A;  3CCR V;  1YSC A;  1EIY A;  5LA6 B;  3RYH A;  2VS0 A;  2MW2 B;  2IJI A;  3X2Q B;  3W7U A;  2XAH A;  2JGD B;  3OR6 C;  3OAA G;  5JVD A;  5KHG A;  2ALY B;  3LDC A;  3LSS A;  4XU1 A;  4ZHQ B;  2UU9 O;  3LNM B;  3E22 A;  1VF7 A;  3JSL A;  2UU9 B;  2Q0O C;  1DTO A;  1NTK H;  4JAU A;  4X88 A;  4LVJ A;  3Q4H A;  1S76 D;  1WNL A;  1XHZ A;  3REX A;  3SYP A;  4J15 A;  1YVW A;  3HPL C;  2M7W A;  1YIJ V;  3SPC A;  2AKW A;  2Y48 A;  3ZRV A;  1OHH G;  2GTA A;  4GX0 A;  3ABL C;  2JIZ G;  3A7A A;  1K5Q A;  1YGB A;  4G27 B;  3HKB A;  2YSU B;  4MVZ A;  5DM6 V;  3WQZ A;  2Y69 C;  2DWE C;  4Q20 A;  1WB8 A;  2CH7 B;  2CTW A;  3LDE A;  4IL6 Z;  3SGI A;  2PME A;  4YRG A;  2LQT A;  3SYO A;  3WG7 B;  3T4D A;  3ZHQ A;  4GLX A;  5FL7 G;  1XDC A;  3CC4 V;  2ZR2 A;  3EVK A;  3K9S A;  2Q67 A;  1XNQ O;  1KMN A;  4IHJ A;  1TVK A;  3DXR B;  5E1A C;  1K97 A;  3JAS B;  3J81 N;  1NZ6 A;  1ASZ A;  4P71 C;  3CP1 A;  4NCX A;  2OIG A;  2H3O A;  1G5I A;  1XBL A;  4ZBM A;  5H2F Z;  5KUK A;  4JI2 O;  1UFI A;  2LW1 A;  1JVM A;  2YEV A;  1KEC A;  5JCO C;  1Y6X A;  4WFH A;  4K87 A;  3ABT A;  1YIT V;  5IT9 N;  3CS5 A;  1K34 A;  1D5A A;  4JTA B;  2GTS A;  3MHS C;  2MK3 A;  1XMO B;  4DRX A;  3M4Q A;  3BAB A;  1P49 A;  5LOV B;  2QWN B;  3ZX6 A;  4JTD B;  3ASN C;  5IWA O;  4CC5 A;  3EFR A;  1EFW A;  4WFB V;  2XND G;  5BY1 A;  5IWA B;  1QLE C;  1KBH A;  1UJW B;  3CRR A;  3OFN G;  1QQC A;  3FB8 C;  4FFK A;  4PD4 F;  3E8H A;  2QGN A;  4JI5 O;  3CCE V;  4ZIB A;  4JI5 B;  1GN3 A;  4RQE A;  1QR8 A;  5CN0 A;  4JI8 O;  2BSK B;  4LC1 A;  2ZT7 A;  4HNA B;  2YIA A;  1VQL V;  3WB1 A;  4JI8 B;  1B6Q A;  3IFX A;  2BTQ A;  5IJ9 A;  5KX5 B;  5IE9 A;  4LNU B;  4PDV A;  4UP9 A;  2PY5 A;  1KP3 A;  3RN4 A;  1FS0 G;  2AW9 A;  4FLV A;  2EJR A;  1FXV A;  1G1X B;  4DR4 O;  4KR2 A;  4WCE V;  4BW5 A;  3V8J A;  5JWP A;  1NBM G;  1WJZ A;  4DR4 B;  1KUQ A;  2E3C A;  4HWR A;  5F2V O;  1ZUQ A;  4F6R B;  4LF4 O;  1NJ1 A;  2DU7 A;  4I4T B;  4BAY A;  1F4M A;  3P8Y A;  5L3C A;  2VWK A;  2C7I A;  1Z2G A;  4WBN B;  3ETQ A;  3ZRW A;  3A31 A;  1L0W A;  2A79 B;  2UXC O;  3G71 V;  2NN4 A;  4DR3 O;  2D3O W;  3B40 A;  1SZX A;  3BEH A;  3RWR D;  2UXC B;  4JYC A;  4DR3 B;  4LF5 O;  4H2U A;  1M56 B;  1ZSP A;  3VBB A;  1SQF A;  2UXD O;  5FNV B;  3RKX A;  1X2G A;  1J5E O;  3E8G A;  2UXD B;  5JH7 B;  4I7Z B;  3FD9 A;  1B7Y A;  2AHY A;  3K57 A;  1J5E B;  4XDJ A;  2WLL A;  4JGS A;  1QLN A;  1AB3 A;  4NXN O;  3EFS A;  3ASO B;  1YJW V;  4MVU A;  4NXN B;  1MSW D;  1Z7N A;  1GRJ A;  3E35 A;  4H2X A; 
#chains in the Genus database with same CATH homology
 3JYC A;  1OCZ C;  2XAJ A;  2P0L A;  3OW2 U;  3ABM B;  4HAM A;  2ZTG A;  1NNH A;  3HRI A;  2QHT A;  1FXK A;  1TUE B;  4JAV A;  5IYD O;  1EQR A;  2CJ9 A;  4YRC A;  3A7A A;  4RO2 A;  3K08 A;  3TK1 A;  4ZKI A;  2E64 A;  1G5H A;  3T4Z A;  1YFR A;  2ZCE A;  2W0F C;  1KKD A;  4TVY A;  2DQ3 A;  2ZNJ A;  2A8E A;  4H2V A;  4H2Y A;  4XTV A;  4YRO A;  5LBQ A;  5IYB O;  3W7T A;  4E2L A;  3K3W A;  2X0L A;  3RW0 A;  3JCZ A;  1BBW A;  2NS6 A;  2C2A A;  1YFS A;  2CJA A;  1HXD A;  3LDD A;  1JJ2 U;  5B3S B;  3OR7 C;  4FMT A;  4LBE C;  2ZXW B;  2DTI A;  5IY5 B;  1R3L C;  2EIM B;  2Q68 A;  4PEL A;  2EZP A;  3QO5 A;  4MW8 A;  3ICA A;  1HTT A;  4PG3 A;  2DU5 A;  1GK9 A;  5B1B C;  3STL C;  1RIQ A;  1WLE A;  1NR7 A;  3OEH G;  4HWP A;  3L4G B;  1Q86 W;  1YTF D;  4YRF A;  1NJ2 A;  2WLJ A;  1VQO V;  5CBG A;  5LGU A;  2IW5 A;  4QE9 A;  1VQM V;  4X5O A;  4YXW G;  2QE7 G;  4H37 A;  4N21 A;  5IYC O;  2CGH A;  2P5I A;  1ROP A;  3CD6 V;  5L3F A;  5LGN A;  2X7R B;  2OTL V;  1HWY A;  4WF2 A;  1NYQ A;  4CH5 A;  5H6Q A;  2I4N A;  3CMA V;  3CCJ V;  2WLH A;  2Q7H A;  5EC1 C;  1M56 C;  3ZMS A;  4MVM A;  1AJP A;  3A74 A;  4CS3 A;  3IGA C;  3STZ C;  2ZT8 A;  4G85 A;  1S5H C;  4UVB A;  3E2E A;  1NYR A;  1X2H A;  1YFT A;  4KQE A;  1OZ0 A;  2Z3Y A;  4BWA A;  2EIK B;  2GHY A;  3JD2 A;  2QHU A;  2G4C A;  4CS4 A;  1Y4M A;  1VQ7 V;  2P6J A;  3PZC A;  1X55 A;  3CMQ A;  4P75 C;  3SPI A;  3HB3 B;  2JK5 C;  2YEV B;  2W6J G;  3BY6 A;  1K3E A;  4FJC C;  1PNL A;  1NH2 B;  3GB7 C;  1AJQ A;  1OCO B;  5EBL C;  1E22 A;  5C53 B;  3PCO A;  3R65 A;  4WI1 A;  5LHI A;  1WYD A;  2HKO A;  2ZDI A;  3P32 A;  4UUJ C;  3NEN A;  2EIN B;  3NET A;  3ASO C;  1IXM A;  3IC7 A;  1QE0 A;  3IG2 A;  2WPD G;  1VQ6 V;  3UH0 A;  4PA3 A;  1AI5 A;  2LFR A;  5L3B A;  1N9W A;  2ZR3 A;  3ABL B;  1E24 A;  3JD1 A;  1M90 W;  3ZCC A;  3NEM A;  2RHS B;  5C52 B;  1JOY A;  1K7D A;  2Y69 B;  4EX5 A;  2WAM A;  3ABM C;  3RAC A;  2ZNI A;  1R6N A;  3V7C A;  4QNH B;  2ALY A;  3GWO A;  3UGT A;  1K4C C;  2A0L A;  1DLB A;  5KNN A;  3MD0 A;  4TWK A;  2I4L A;  4AH6 A;  1IL2 A;  1YJ9 V;  1EFR G;  1K33 A;  4HWO A;  3SYA A;  2DJZ A;  4TT3 G;  1EOV A;  3SPG A;  1ASY A;  1VQ4 V;  3K0G A;  3K9A A;  2RHQ B;  4OP0 A;  2CJB A;  2ZIO A;  2IU0 A;  1MOF A;  5KUM A;  2ZIM A;  3F7Y C;  3A7U A;  3D36 A;  5B3S C;  1RM1 B;  4RMF A;  1OCC B;  4RAI A;  2W6I G;  1V54 B;  2ZXW C;  1YTF B;  3HTZ A;  3W7X A;  2EIM C;  4UVA A;  3AG4 B;  3OD1 A;  4XU0 A;  3R07 A;  4GCZ A;  4KR3 A;  1E1Q G;  2EJ9 A;  2B5U A;  1PNK A;  2ZD9 A;  1VQK V;  1KP2 A;  5ELN A;  3RIR A;  2JEX A;  5B1A B;  4WF9 V;  4X8A A;  5DN6 G;  1EVK A;  1G8M A;  3AG2 B;  4R7C A;  1X01 A;  4TWA A;  4H33 A;  4RDX A;  1CP9 A;  1H38 A;  4R6Z A;  2E41 A;  4UPA A;  2B1G A;  3I56 V;  4P30 A;  3B8N A;  4PDL A;  1SET A;  2XAQ A;  3P30 A;  4FIP C;  4GX5 A;  4BIZ A;  3CCL V;  2DZC A;  3HXW A;  2BOC C;  3TEH A;  11AS A;  4YRE A;  2ZQM A;  4TVW A;  4XTZ A;  1K73 W;  3RUX A;  1F23 A;  3K0D A;  1WU7 A;  1S0V A;  2QHV A;  5H9C A;  2H8P C;  2FTK A;  4YPF A;  2XTI A;  1S77 D;  3E9I A;  2Z5U A;  3RGL A;  4EO4 A;  3V8L A;  4E51 A;  1THZ A;  4PA4 A;  3W7W A;  1AI7 A;  1PD3 A;  3OMN B;  3ASN B;  1FXH A;  1MAB G;  4PA7 A;  1NVP B;  4H2T A;  2HLD G;  1GM7 A;  2EAY A;  2DVE A;  2EIK C;  2EIJ B;  2Q5H A;  4Q6G A;  3TEG A;  3I55 V;  2K1E A;  4PDR A;  1NH2 D;  1W66 A;  1NJ5 A;  3UGQ A;  4YYE A;  3AG3 B;  4PHC A;  1G4Y B;  4P74 A;  3V7R A;  1B70 B;  4XDL A;  4QJF B;  2J3M A;  2CIM A;  3CYO A;  4MVQ A;  3RKY A;  4ZTU B;  3PJS K;  4JPR A;  3OUF A;  4RUF A;  3RVY A;  4P9O A;  2EIN C;  4X89 A;  2UXX A;  2HR3 A;  4OXS A;  3A5Z A;  4MTG A;  2WLM A;  1FYF A;  1NQT A;  3E8F A;  4LVL A;  4UXN A;  4CS2 A;  4UVC A;  4P2Z A;  1BIA A;  4G84 A;  2XAG A;  3ZN0 A;  3K04 A;  3MHH C;  4CH6 A;  5L3G A;  5LHG A;  3ERR A;  4I5S A;  1X54 A;  2DXT A;  4LVK A;  1VQZ A;  4YRS A;  1QBZ A;  2OT5 A;  1EVL A;  3AG1 C;  4P3P A;  2AKW B;  4YCU A;  4YP0 A;  4H2X A;  1B7Y B;  4FPP A;  1J5W A;  2ZZF A;  3QO7 A;  2WLN A;  3OE7 G;  5C93 A;  4BIU A;  4ZTZ B;  1XL6 A;  3OEE G;  2NLJ C;  2OCC B;  2P7T C;  2P67 A;  2WLL B;  3OM3 B;  3ZIA G;  1PL0 A;  1RPO A;  4UV8 A;  2ARS A;  2WLI B;  4LCU C;  4MTO A;  4XTW A;  1GO3 F;  4XEO A;  4YRJ A;  1NR1 A;  2QM7 A;  3ETE A;  5BZB A;  1JJC B;  1ADJ A;  2QHS A;  4YRN A;  3LUT B;  5C51 B;  4XTY A;  4MVR A;  1MG1 A;  4MTF A;  1RM1 C;  1OCC C;  2KB1 A;  1S72 V;  3CCV V;  1V54 C;  4G28 B;  3CPW U;  2ZZE A;  3B8M A;  4H2X B;  4YCW A;  4TQD A;  4TSF G;  1PKX A;  3HXX A;  4YRT A;  1M57 B;  3K79 A;  3SPJ A;  3AG4 C;  1BL8 A;  3QTC A;  4DPG A;  3MQZ A;  5L3D A;  4GT1 A;  3A7R A;  4O2D A;  1KQS U;  1FXK B;  4LVI A;  1VQN V;  3ZN1 A;  3HY0 A;  3VQW A;  5B1A C;  1EZJ A;  3FYI B;  1R73 A;  3AG2 C;  2ARU A;  4RUE A;  3UKM A;  3A32 A;  1G51 A;  2DZ9 A;  4F4L A;  3CC2 V;  1GGM A;  3VQX A;  3RL6 A;  2E65 A;  1PNM A;  1KD1 W;  2QEX V;  1GTO A;  2I4M A;  2Q7E A;  1W0J G;  1ADY A;  1JCH A;  2IY5 A;  3IKM B;  1KC8 W;  1OCR C;  4R8C A;  5LGT A;  5ELO A;  3UM7 A;  3HY1 A;  4XTU A;  2IH1 C;  2E5A A;  3ETG A;  5HFM A;  2JDI G;  2NNU A;  5CBF A;  1NVP D;  1QVF U;  1J95 A;  3TUP A;  4WFG A;  2DDZ A;  2RHS A;  5F5W A;  4YCV A;  4YRL A;  1RPR A;  1E1O A;  4OLF A;  4WJ3 M;  2EIJ C;  2XOK G;  4L87 A;  1NJ8 A;  5LHH A;  2J3L A;  4K88 A;  1R3I C;  1XL4 A;  2FYK A;  2HVK C;  5EBM C;  4EKW A;  1NKD A;  3D3I A;  2DYS B;  3BFM A;  3EFF K;  3ABK B;  4WJ4 A;  2AHZ A;  2DYR B;  2HNI A;  2EIL B;  4P9P A;  3ZJZ A;  3G1Z A;  3L2Z A;  4DQ2 A;  4XBF A;  1P7B A;  2DQ0 A;  1VQP V;  3IKL A;  2PI5 A;  4G2K A;  12AS A;  1ATI A;  5EK0 A;  4BW9 A;  3HFZ A;  1BMF G;  1SRY A;  4N23 A;  1PYS B;  4LP8 A;  1OCZ B;  1R6K A;  3ML0 A;  4YRI A;  1P4R A;  2EZO A;  4JF3 A;  3HXY A;  4I9W A;  4MTX A;  2JJ1 G;  1GM9 A;  2BOB C;  2XAS A;  3ZMT A;  2JJ2 G;  3FB5 C;  4MSW C;  3ZMZ A;  1H4T A;  3ZRS A;  1I5X A;  1DF5 A;  2HFE C;  3RBZ A;  2IJK A;  3ZRX A;  3F7V C;  4WFE A;  3HXU A;  2ITC C;  2HJF C;  2ZXF A;  3LC0 A;  1K92 A;  1EBO A;  3CC7 V;  3M4P A;  4CBC A;  5IY5 C;  4HWS A;  5CMU A;  4XTX A;  5E3I A;  1GMG A;  3PCO B;  2JEU A;  1F4N A;  3QNE A;  4YRK A;  3E8B A;  2WSS G;  4YRM A;  3CCQ V;  2LP7 A;  2WLK A;  4P75 A;  3H01 A;  2P90 A;  3CCR V;  4Z1M G;  3T2M A;  1V55 B;  1YSC A;  1EIY A;  3CCS V;  4TVA A;  1M57 C;  4LNS A;  1R3K C;  5HGQ A;  4UV9 A;  2IJI A;  4PA9 A;  3X2Q B;  1ZWI C;  3W7U A;  2XAH A;  2ODR D;  1WQ7 A;  3OR6 C;  1NJ6 A;  3OAA G;  2ALY B;  3LDC A;  3LSS A;  1F51 A;  4XU1 A;  3SJQ C;  3LNM B;  4HYO A;  3ZMV A;  1W0K G;  3UFG A;  2ATK C;  2HG5 C;  1AJN A;  4TTV A;  1Q82 W;  4R50 A;  1DTO A;  3CCM V;  3TCU A;  4JAU A;  4X88 A;  1B8A A;  1QLE B;  4P73 C;  4LVJ A;  2B1I A;  1S76 D;  4QPK A;  1WNL A;  3REX A;  4U7O A;  3SYP A;  4J15 A;  4H2S A;  4MW3 A;  3HPL C;  2M7W A;  4MT8 A;  1YIJ V;  3NXS A;  1W2B U;  3ZRW B;  3SPC A;  4HA8 A;  1H8H G;  4KUM A;  1OCO C;  3L1A A;  3P8V A;  2AKW A;  2Y48 A;  3AEI A;  3ZRV A;  4K86 A;  4XU2 A;  2QM8 A;  2F43 G;  5L3E A;  1OHH G;  2R9R B;  4GX0 A;  2EL9 A;  3ABL C;  2JIZ G;  4QPJ A;  4MVO A;  1K4D C;  2H94 A;  1CPY A;  2DYS C;  3K06 A;  2X6C A;  3ABK C;  1VQ8 V;  4P72 C;  2EJG A;  1K5Q A;  1AR1 B;  1YGB A;  2EIL C;  4G27 B;  4Q15 A;  4MVZ A;  2YSU B;  5DM6 V;  3WQZ A;  2Y69 C;  2DWE C;  3JD4 A;  4Q20 A;  3L4G A;  4KFM A;  1SES A;  3LDE A;  2Q7G A;  2PME A;  3MF2 A;  4YRG A;  1LNQ A;  1BIB A;  3RKW A;  3SYO A;  3WG7 B;  4QIW F;  1E1R G;  3T4D A;  5FL7 G;  3CC4 V;  2ZR2 A;  2ZZG A;  3VQY A;  1K8A W;  4YDQ A;  2Q67 A;  2OTJ V;  3KG2 A;  4FK5 C;  1KMN A;  2AMC B;  3OMI B;  3HXV A;  1H8E G;  4PA6 A;  1K97 A;  5E1A C;  3V8K A;  2E1H A;  1ASZ A;  4P71 C;  1VQ9 V;  4H2W A;  3CP1 A;  2X6A A;  2DXU A;  4NCX A;  3CME V;  1Y66 A;  1G5I A;  2ZDI C;  4P73 A;  2HVJ C;  4ZBM A;  5KUK A;  1HC7 A;  3JD0 A;  4WFF A;  4UP8 A;  1WPX A;  1JVM A;  2DW4 A;  1L1F A;  2ZT5 A;  1ARO P;  1S3J A;  2YEV A;  3LSQ A;  5EBW C;  2Q5I A;  1KEC A;  4RQF A;  2X6B A;  4YRQ A;  4WFH A;  1V55 C;  2EJF A;  4P3O A;  5K1X A;  2IU3 A;  4K87 A;  4PDM A;  2Q69 A;  3ABT A;  1YIT V;  2PMF A;  4MS2 A;  1K34 A;  3HXZ A;  4H02 A;  4U7N A;  2GSM B;  2R9I A;  3X2Q C;  3BJU A;  1GKF A;  2QA4 V;  2DWD C;  4JTA B;  1H4Q A;  3VOU A;  3MHS C;  1ENV A;  3SPH A;  3F5W C;  3DTU B;  5K1P A;  2MK3 A;  1KMM A;  2ZT6 A;  1QCE A;  4JAS A;  3M4Q A;  3T1C A;  1DF4 A;  4P72 A;  1USY C;  4JTD B;  3ASN C;  4XDK A;  1YJN V;  4DXW A;  3OGC C;  2UXN A;  1NJI W;  2ZIN A;  2EBO A;  3EFR A;  1EFW A;  4WFB V;  2XND G;  1M1K W;  1QLE C;  2V7Q G;  1UJW B;  4ASU G;  1BHB A;  3V7S A;  1GM8 A;  3OFN G;  1PYS A;  1QVG U;  3FB8 C;  3AG3 C;  1AI6 A;  2Q6A A;  5B1O A;  3A5Y A;  3E8H A;  3I7F A;  3FJP A;  1Q81 W;  3FB7 C;  4HVC A;  3CCE V;  2RHQ A;  4LVM A;  3W3S A;  1AI4 A;  4ZIB A;  3K03 A;  4RQE A;  5H6R A;  1QR8 A;  1E79 G;  5CN0 A;  4P71 A;  3TET A;  4XEM A;  4LC1 A;  2ZT7 A;  3HFV A;  4TQF A;  2DEQ A;  1VQL V;  3VQV A;  1B6Q A;  3IFX A;  2ZGW A;  1JX9 A;  1K5S A;  2A9H A;  2IJJ A;  3A0R A;  3E86 A;  3ZMU A;  3FKS G;  5CBH A;  2PI4 A;  1BBU A;  3E89 A;  5HFL A;  1M9N A;  2I4O A;  1QF6 A;  2IY5 B;  1JQ0 A;  4P3N A;  4PDV A;  2E10 A;  4UP9 A;  1C0A A;  1KP3 A;  5CA3 A;  2ART A;  3WG7 C;  1FS0 G;  3G4S V;  1Z7M A;  3FYE B;  5B1N A;  1H2G A;  3FB6 C;  3EHB B;  3RVZ A;  2OCC C;  3REU A;  5GW7 A;  2DKG A;  1H4S A;  2EJR A;  1FXV A;  3AG1 B;  4KR2 A;  4WCE V;  1BHA A;  4YRP A;  5EC2 C;  4BW5 A;  3OMA B;  3V8J A;  4JYB A;  4CH4 A;  4HWT A;  1YI2 V;  1NBM G;  1KOG A;  3QO8 A;  2E3C A;  4CH3 A;  4HWR A;  3DSQ A;  4P74 C;  3SYQ A;  1USY A;  5KA5 A;  3JD3 A;  4KP4 A;  2EWN A;  5B1B B;  5IDJ A;  3MF1 A;  1N8R W;  1R3J C;  1ORQ C;  2WWW A;  1NJ1 A;  2DU7 A;  4JTC B;  2IH3 C;  1F4M A;  4BAY A;  5L3C A;  3P8Y A;  1FXK C;  1B76 A;  2C7I A;  1COW G;  1YB3 A;  3DGE A;  4WFA V;  4UP7 A;  1SZT A;  3HFZ B;  3RF1 A;  4CZZ A;  3ZRW A;  2ODR C;  1YHQ V;  3A31 A;  4HZ3 A;  1B70 A;  3NEL A;  3MEY A;  3P8T A;  1L0W A;  2A79 B;  3CXC U;  3G71 V;  1K9M W;  2QKS A;  2D3O W;  3ABU A;  2CK3 G;  3BEH A;  3OUS A;  3CCU V;  1WPY A;  4J9Z B;  3IAL A;  3SYC A;  2DTH A;  4JYC A;  3E9H A;  2XAF A;  4GX1 A;  1VQ5 V;  1M56 B;  4H2U A;  3TEH B;  2QTO A;  4J9Y B;  1QR9 A;  1H4V B;  4GX2 A;  4QE7 A;  1E1T A;  3KFU A;  3VBB A;  2XGT A;  5J9P C;  5KA6 A;  1JPX A;  3RKX A;  2IJH A;  1X2G A;  1I5Y A;  1Q7Y W;  1OCR B;  1FFT B;  3E8G A;  3B77 A;  1B7Y A;  4MVS A;  1SER A;  2AHY A;  1LYL A;  2LFS A;  1X56 A;  4XDJ A;  4XU3 A;  2WLL A;  1CEZ A;  3E83 A;  1EIY B;  4JGS A;  2WLI A;  1QLN A;  4TVA B;  2C8M A;  2DYR C;  2V1D A;  3EFS A;  2AMC A;  4DO2 A;  3W7S A;  2DTO A;  3ASO B;  1JJC A;  4HT4 A;  2ITD C;  1WQW A;  1YJW V;  4MVU A;  3WFV A;  3G6E V;  1MSW D;  3ETD A;  4YRR A;  1Z7N A;  3E35 A;  3M99 B;  3HRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...