4RQEA

Human seryl-trna synthetase dimer complexed with two molecules of trnasec
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
478
structure length
460
Chain Sequence
VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKELSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVTSIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASKKLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYMDKVEFVHMLNATMCATTRTICAILENYQTEKGITVPEKLKEFMPPGLQELIPFVKPAPIEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SerRS-tRNA Sec complex structures reveal mechanism of the first step in selenocysteine biosynthesis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase/rna
molecule keywords Serine--tRNA ligase, cytoplasmic
total genus 121
structure length 460
sequence length 478
chains with identical sequence C
ec nomenclature ec 6.1.1.11: Serine--tRNA ligase.
pdb deposition date 2014-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T)
A PF02403 Seryl_tRNA_N Seryl-tRNA synthetase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.40 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4rqeA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 4rqeA02
4Q15A 1NYQA 1X54A 4YRFA 3NEMA 2ODRD 3UFGA 4J15A 1NJ1A 2QHTA 1NNHA 4P75C 1B7YA 4TVAB 4CH5A 3A5YA 4G84A 2DZCA 1JJCB 11ASA 4WF2A 1WQ7A 4YCWA 2DEQA 1ASYA 1VQZA 4CS3A 3EFRA 4YCVA 4YRCA 3HRKA 3WQZA 3A31A 1J5WA 4PHCA 1KMMA 3PCOB 5C53B 3HRIA 4XTYA 3RKWA 4L87A 1ATIA 2Q5IA 1B8AA 4YRMA 4O2DA 4AH6A 1G5IA 2QHSA 3QTCA 3UGQA 2DTIA 3ICAA 3A7UA 2ZZFA 1LYLA 2CGHA 1C0AA 1E22A 3QO8A 2I4LA 3ERRA 4G85A 2I4OA 1JJCA 2EWNA 4P71C 1USYC 1YFTA 3TUPA 1SETA 2ZTGA 4YRRA 3OD1A 2DTOA 4CH6A 4KR3A 3MF2A 2DQ0A 3QNEA 2E5AA 2ZT8A 4YRJA 5ELNA 1YFRA 3IKMB 3E9HA 3V8JA 1NYRA 3DSQA 4YRKA 5K1XA 1WNLA 3VBBA 3NETA 1NJ5A 1X55A 4YROA 1KOGA 4TTVA 1QE0A 3M4QA 1SERA 2EJ9A 3VQXA 4YCUA 4YP0A 4YRTA 4CS2A 5E3IA 2J3LA 4HWRA 2ZT6A 3RKYA 2DU5A 1WLEA 2G4CA 3L2ZA 4YRQA 2DKGA 2DJZA 1USYA 4UPAA 1WQWA 1H4SA 4P3OA 1B70A 1H4QA 2PMEA 1Z7NA 3RIRA 4K88A 1X2HA 4H2UA 1SESA 5C52B 1ADYA 4YRNA 1EFWA 4K86A 3VQYA 4OP0A 2E64A 1EVLA 3HFZA 2AKWA 2RHQB 2ZIMA 4UP8A 1B76A 4XU0A 1G5HA 1N9WA 2XGTA 2CJBA 3BFMA 4PG3A 4P73A 3V7CA 2IY5A 2Q7HA 2Q7EA 2EJFA 1YGBA 1WPYA 2ZNIA 2DXUA 4UP7A 4HWOA 3HY0A 3IG2A 4TQFA 3HXUA 4P75A 3NENA 4K87A 3RKXA 4YPFA 3HXVA 2ZNJA 2FYKA 2E1HA 4XTXA 4HWSA 1E1OA 4WJ3M 3REUA 2RHSA 4H2XB 3TEGA 2RHSB 1NJ6A 2ALYB 1YB3A 4HWPA 4YRIA 2ZZGA 3L4GA 4YRLA 3FJPA 4XTZA 4H2VA 1FYFA 2ZR2A 4ZTZB 3HXXA 1PYSA 2CJAA 3LSQA 3HXYA 1BBUA 4YYEA 4LNSA 1X01A 4YRPA 3RGLA 4BW9A 4P73C 2XTIA 2DZ9A 1WU7A 4TVAA 1EQRA 2EAYA 1ASZA 1E1TA 1ADJA 2ZGWA 5C51B 2ZR3A 2P5IA 4KR2A 2PMFA 4XEOA 2E41A 4UP9A 3A7AA 4E51A 3TEHB 1E24A 2ODRC 2DTHA 3TEHA 1G51A 2IY5B 3R07A 3P8VA 2Q5HA 2DQ3A 1PYSB 4H2XA 2ZXFA 2ZIOA 3RACA 1WYDA 4H2YA 5HGQA 5F5WA 1B7YB 3V7SA 3HXZA 1GGMA 1KMNA 3W3SA 1X2GA 1SRYA 1HXDA 4H2WA 1Z7MA 4TVWA 4P3PA 4BWAA 4P72A 1NJ2A 4P3NA 2I4MA 3IALA 4KQEA 3UGTA 2E65A 3L4GB 2CJ9A 4H02A 4XEMA 4XTWA 2CIMA 3RL6A 2Q7GA 5ELOA 1BIBA 1W66A 4RQFA 1HC7A 2EL9A 12ASA 1EOVA 4EO4A 3UH0A 3HFVA 3RUXA 1EVKA 3VQWA 3QO5A 3QO7A 4YDQA 4ZIBA 3CMQA 4YREA 3V8LA 3M4PA 2DDZA 4P71A 3A32A 2ARTA 2E10A 3A5ZA 4YRSA 4XTUA 1RIQA 2ARUA 3NELA 2C7IA 4WI1A 3PZCA 4NCXA 2E3CA 2QHUA 1H4TA 4H2SA 3L1AA 4RMFA 4YRGA 3LSSA 2ALYA 3HY1A 1IL2A 1BIAA 2ZT7A 3VQVA 3V8KA 2I4NA 3LC0A 3BJUA 1HTTA 5KNNA 3P8TA 1L0WA 2RHQA 4P74A 3REXA 4DPGA 5K1PA 3IKLA 3V7RA 1QF6A 1H4VB 4CH4A 4RDXA 4TWAA 4X5OA 4CH3A 2ARSA 2AKWB 1B70B 3KFUA 3HTZA 2AMCB 2P0LA 3MF1A 2EJGA 4P72C 2DU7A 4XTVA 4WJ4A 1X56A 2C8MA 1YFSA 4H2TA 2QHVA 4XU1A 2HNIA 3RF1A 3G1ZA 4EX5A 4TVYA 4OLFA 2ZINA 4DQ2A 2ZCEA 4HWTA 1BBWA 4XU2A 1EIYB 1NJ8A 4Q6GA 2ZZEA 4HVCA 2DXTA 3I7FA 2DVEA 2ZT5A 3HXWA 2AMCA 3P8YA 3PCOA 4P74C 4TQDA 3MEYA 4HA8A 1EIYA 3EFSA 3E9IA 2J3MA 3HFZB 4ZTUB 3A74A 3A7RA 4RQEA 4XU3A 4CS4A
chains in the Genus database with same CATH superfamily
3K79A 4Q15A 5LMUO 1NH2B 4DUYB 4J15A 2QHTA 3JD0A 4MSWC 3CRQA 2PTMA 1NNHA 1OHHG 2UXBO 4J41A 5HFLA 1L8DA 1OCZC 3AG4B 2D2CB 4A5UB 1NTKH 1SQBH 1JJCB 4FMTA 3P3NA 2XNDG 1R73A 1XNQB 2QSAA 3RWRD 5CB4A 3CCLV 1NT2B 2RJZA 1BQZA 4WBNA 4FLTA 4N21A 1GH6A 2DEQA 1ASYA 1VQZA 2P6JA 5C93A 4YCVA 3EHBB 3RYIB 3HRKA 5EK0A 1J5WA 4PHCA 4QPJA 1K3EA 5B1NA 1VQMV 2IH3C 3BCCH 3HRIA 4PI0A 4PA4A 4QJFB 3UT5B 2F4VB 2Q5IA 1G8MA 4L8JA 5IJ9A 1AR4A 4DUZO 2EJ7A 4O4IB 2RNBA 4JI2O 4AH6A 4O4JB 1NVPD 3UGQA 1E1QG 2YS8A 1YJNV 1DGSA 2ZZFA 1QQCA 2DWDC 2IW5A 3FB6C 4X1YB 4BIZA 1K92A 1BL8A 4JI5B 2CGHA 4YJ3B 1VQ8V 5JCOC 5CB4B 4DR7B 2JS3A 2IH1C 4JI3B 4G85A 5IYZA 2EWNA 2OCCB 5CBHA 2GHYA 1YFTA 1SETA 1NU1H 3DXRB 4YRRA 3OD1A 1SA0B 3DC5A 4X88A 1IDSA 3F5WC 1U97A 4CH6A 5HFMA 3SPGA 2E5AA 1XREA 4YRJA 5ELNA 2AXTZ 5DEDA 3ABTA 4MT8A 5BXZA 4BW5A 3OE7G 1NYRA 2Q6AA 4YRKA 1R3LC 1R3KC 1IBMO 3AG2B 4Z1VA 4DV2B 1DLBA 2YSUB 3OTFA 4LVMA 2UUAO 1AJNA 2UXNA 4W4KA 2QTOA 2V1DA 3M4QA 2WLLB 1SERA 1X4TA 3E86A 3JASB 4I50B 4HNAA 4YP0A 3F7YC 1BE3H 4IHJA 4J7JA 2J3LA 1N34B 2EZPA 5LHIA 2DU5A 4I4TA 5KMGA 2XAQA 1WA8B 4ZKIA 2DKGA 2PZSA 1USYA 1OCCB 1WQWA 4TT3G 4P3OA 3TGUH 2DN9A 1JCHA 4OPHA 4B3MO 2PMEA 3RIRA 1BSMA 1X2HA 1EN5A 3LDCA 2O57A 5B1AC 2Y0PA 3F7VC 4YRNA 3VQYA 3L75H 1K7DA 4MVQA 2Y48A 2QWRB 3KZIZ 3JSLA 2JS5A 3JASA 4I50A 1B76A 4DK0A 4LF8B 2XGTA 3K5NA 4X64O 4JTDB 2CJBA 1AI6A 1K34A 3X2QB 1NH2D 2ZDIC 5LXTB 1QNMA 4WF9V 4JAUA 4PDMA 2EILB 2IY5A 5FNVB 1U96A 4LNUA 4UCVA 2Q7EA 4GX0A 4PDRA 1KP3A 4R6ZA 2ATKC 4JI1B 2P4VA 4LFCB 4JZGA 1W59A 3K06A 2DXUA 4UP7A 5IYCO 2GUZB 3W7TA 3LUTB 4QNHB 3CS5A 1YHQV 3HKDA 2F95B 3WB1A 5LMUB 3G4SV 4QE7A 5FNVA 2LW1A 3FD9A 3RKXA 4YPFA 5KA5A 5LHGA 2FYKA 4FZ0A 4WJ3M 3CD6V 3OR6C 3U11A 5B1BB 1MG1A 2GUZA 2XOKG 4HWPA 4YRIA 3SPIA 5KUKA 3ZHQA 5JQGA 2L35A 3SPHA 3R65A 3OTOB 3FJPA 3B8MA 4H2VA 2ILMA 1FYFA 4MTFA 2EIJB 1G1XB 1AI7A 1PYSA 1FXVA 1VF6C 1VF5B 3LSQA 3SYPA 5JJNB 4JYBA 3HXYA 1JR9A 4LNSA 3G67A 3AG7A 5JJJB 1CP9A 3CCJV 5H6RA 3U10A 3T1CA 4GYCB 5L3CA 2JK5C 2DZ9A 4TVAA 2YI8A 4O4HA 2Z3YA 4DV6O 3AEIA 2EAYA 5KLVH 5J2TA 2QTSA 1PL4A 2YIDA 3H1JH 1ADJA 1E1TA 4JI5O 2P5IA 1H38A 2JDIG 2PMFA 3ML0A 2X0LA 5LA6A 4LF5B 5JQGB 3A7AA 3B77A 2YIBD 2IU0A 1NBMG 2DW4A 4K3AA 1J5EB 4U7OA 1QVGU 4YY3B 4B08A 4I9WA 1XQ8A 3ASOB 3M8AA 1WPBA 2DQ3A 3C90A 1HW7A 3ZEDA 1WYDA 3VOUA 4UB8Z 4RUFA 1XUQA 3K0DA 4UCRA 3UO3A 1M90W 2N05A 5F2VO 1YITV 4X9QA 1KP2A 1GGMA 1KMNA 2EILC 1RSOB 3HKCA 1HXDA 3L73H 4J42A 4DV2O 4GX2A 1Y74A 3CCEV 1SQVH 3AG2C 4J9YB 4BWAA 3AK1A 1NJ2A 2I4MA 4ZI7B 4OGQB 1GO3F 4WFGA 4XEMA 3OGIB 4JI6O 1KUQA 4GX5A 3E22B 4IIJA 4JASA 4RQFA 1N34O 1HC7A 1EOVA 4EO4A 5KHHA 2DJVA 2IU3A 3HFVA 2HJFC 5J2UB 1NI8A 3LNMB 5GONB 4LF9O 3CXCU 1TA8A 2ARHA 3ZRWB 3O65A 1VQPV 3TXSA 3CMQA 4YREA 5EBWC 5LGNA 2ZE6A 1G4YB 4NXMO 4P9OA 5BZBA 1JPXA 3ABKB 5JH7A 1Y6XA 3STLC 5LL6Y 4K35A 2E10A 4EEQA 2EBOA 3FAVA 3A5ZA 5B1OA 4QPKA 4UVAA 2JGUA 2B1GA 1Q8IA 1D5NA 4WBNB 1RIQA 4PELA 1XMOB 4F6EA 4LR3A 5EYPB 2NR5A 3JCZA 2Y4TA 3PZCA 3WB2A 1XILA 4UXNA 4OX9B 1ORQC 3ZN1A 4MW8A 4H2SA 2PYJA 1V55C 5DN6G 1JFFA 3HKEA 1PKXA 1BIAA 4MVOA 2ZT7A 1VQ4V 3VQVA 4LFAO 3AK3A 3ZHSA 1GN3A 5L3BA 3BJUA 2QGNA 3BVOA 4X1KA 1JA8A 4X1IA 3V7RA 4R50A 2PI4A 1QF6A 4CH4A 1AP5A 2WA3A 4P9PA 2ARSA 2AKWB 5B3SB 1KQSU 1KMIZ 2DU7A 4MTXA 2QM4A 4FFBA 5CMUA 2FTKA 4LF7B 4R8CA 2QHVA 2KKWA 1FPOA 1R6NA 2AHZA 4EX5A 4TVYA 4OLFA 4X62B 2ZINA 4DQ2A 4DR1B 4BIOA 1BBWA 4HBNA 2XT9A 5ITZB 3E8BA 5C8YA 2UU9B 2RDCA 1EIYB 4AQYO 4YJ2A 3JALB 2HFEC 1MNGA 4DR5B 2F1MA 2DXTA 1OCOB 3A2FA 3CRRA 3FB5C 4DV6B 4I55B 1YJWV 2HVJC 3P8YA 3FFQA 4H33A 3L72H 3OEHG 2P4KA 3E9IA 1GM8A 2J3MA 3HFZB 4LF5O 4K0KO 4FLZA 4YIPA 1M56B 1Z2GA 4XU3A 4X1IB 3GWKC 4UVCA 3TCUA 1X54A 4FM0A 3D3IA 3NEMA 1DF4A 2L6LA 1ENVA 4UV9A 4YY3O 4TV9B 1B7YA 4XDJA 2QWQB 4Q20A 2N74A 3BFRA 4JF3A 2DZCA 1XOUA 4PV1B 1YXBA 2Q73A 3M7MX 4J11A 4YRCA 2WLJA 4KP4A 3WQZA 4GZRB 1I08A 3NR7A 4NTXA 1P7BA 2JRIA 5ITZA 4IIJB 3SPJA 4ABMA 3CJHB 3CCMV 4DR4O 3MQZA 3TJTA 2X6CA 3T1HO 1K5SA 2F93B 4JI6B 2QHSA 1KB9F 3ICAA 3K5LA 2G38A 3A7UA 4H44B 1B6QA 3A0HZ 1UJWB 2Y69B 2E75B 1KD1W 1SS3A 4B3SB 1IURA 3HKCB 1K9MW 1BHAA 4DV7B 3QO8A 1IX9A 2I4LA 5FLXN 2I4OA 4ZHQB 1JJCA 1H2NA 1F4MA 3H9VA 1US6A 2ZTGA 2BSKB 3N27A 4JAVA 4OXSA 2KG7B 2DTOA 3MF2A 2DQ0A 4JTCB 2PY5A 5L3DA 3CB2A 5LP6C 3OUFA 3BHPA 3W7SA 4IYIA 3V8JA 3DSQA 3K0GA 2IJHA 3KCXA 1WNLA 1M57C 1KECA 2AW9A 3C3TA 1NJ5A 4FFBB 5EZYA 5E1AC 3T1YO 1ZL8B 4LFAB 2Y0IA 3RFRA 4JYAO 2YXHA 5LGUA 4HNAB 3STZC 1B3QA 3ZIAG 4CS2A 2FMLA 1FJGO 2CH7A 4DV5B 4HWRA 1N32B 2ZT6A 4LWSB 2YXYA 2G4CA 3E83A 2Y4UA 4LF6B 3JYCA 4YHHB 2A0LA 4NTWA 3K5OA 2Z0AA 4X66O 3BPZA 3B09A 1S5LZ 1KYOF 1Q6IA 4DW0A 1BMFG 4H2UA 1I5XA 4GX1A 3CE2A 5DM6V 3JALA 3Q4HB 1M9NA 1NTZH 1MSDA 2W0XA 4DR1O 3HFZA 4OP0A 5LMNB 2RHQB 3J7AU 4UP8A 4XU0A 1TVKB 1G5HA 2UUBB 1B04A 1TUBA 5LHHA 5LXTA 4PI2A 1M56C 4DR5O 2NN4A 5EC1C 4PG3A 1HNZB 1HNWB 2XAJA 1EZJA 3K03A 4LVIA 2OTLV 1OV9A 3G6BA 4ZOLA 1VF6A 1YGBA 3RT3C 3ETQA 3MAQA 5B3SC 4PDVA 3IC7A 4HWOA 4K0KB 3D36A 1L0LH 2VS0A 4WFEA 5BMVA 2LGWA 3A0BZ 4TQFA 3OT7A 4XBFA 4DV3B 4YJ2B 4P75A 3NENA 1I7FA 2DWEC 1E1OA 5TISZ 4RWUA 2F23A 4H2XB 2DMXA 2RHSB 4O2AB 1KU9A 1MOFA 1NR7A 1NKDA 1H2KA 1L0NH 4XTZA 4DV0O 1BT8A 4NTYA 3JAMN 2R9RB 3CEIA 3T2MA 2N04A 3HR0A 4EFBA 1OCOC 1I94B 4AHCA 3JATA 4FIPC 1BBUA 4YYEA 2ZQMA 1XEQA 1YSCA 2IM9A 1T5EA 1XBLA 2C2AA 5D5PA 4FVMA 3M99B 1WU7A 2LGQA 5KHJA 5JH7B 1BS3A 1ZX3A 4G2KA 4J10A 1MSWD 1HNXO 2CE4A 5GTHZ 4G28B 5H6QA 1D5AA 1JX9A 4KR2A 5CN0A 1DTOA 4O2BA 5LP6B 2B1IA 2ZD9A 3WFVA 4BAYA 1F23A 3ZRVA 2X6BA 4IGGA 2ODRC 2DTHA 1OCRB 4FZ1A 4DR6O 2QKSA 5BMVB 1G51A 1S76D 1PNMA 2W6JG 2OCCC 1XDCA 3P8VA 3SYAA 2YC0A 3K3WA 2Q5HA 2QR4A 4FLXA 1RPRA 2JEUA 3ZMVA 1PYSB 4HAMA 4H2XA 3ZMTA 5JVDB 2OYQA 2XUMA 2ZXFA 4LC1A 1RFYA 1NTMH 4O4JA 3P3PA 3HKDB 1S0VA 4DO2A 3W3SA 1X2GA 3FKSG 1GMGA 2A9HA 1VQKV 4GKJB 3L71H 4LVLA 2LJ2A 3OD4A 4G27B 2CTWA 4H2WA 2Q0AA 3I5DA 2IBZH 4P3PA 5H5NA 4P72A 2F4VO 3IALA 4KQEA 1FXKA 4DUZB 2OWOA 4B3RB 2CJ9A 4IHJB 1OJHA 4ZI7A 1H2MA 2HG5C 3CC4V 4MW3A 3W7UA 1TGOA 4FFKA 2JGDA 3VQWA 5B5EZ 2WA4A 3FB7C 1IBLO 1EBOA 4TV9A 4X66B 3MD0A 4F4LA 3B8NA 3ABMC 3RYCB 3JARA 5L3FA 3GVMA 4RAIA 1RSOA 4PA6A 2EZOA 4YRSA 2WLLA 2CGNA 3CMAV 1N0NA 5IJ0B 3TK1A 3ZS8C 1M93A 2BCCH 2QWPB 1AB3A 3WG7B 1WAZA 3C3SA 1NVPB 1URFA 2ZXWB 4DV4B 1ZAUA 1H4TA 3L1AA 1Q81W 4RMFA 1SZXA 1FYJA 1HNZO 1AJQA 5CA1B 3IAYA 3V8KA 1AILA 3CCUV 4O4LB 4O4HB 1P49A 3J80N 2RHQA 3BRCA 1L0WA 3REXA 4DPGA 3IKLA 1H4VB 4GKKO 2JEXA 3THOA 5KA6A 4X5OA 4K8ZA 4DV3O 4FM2A 1FD9A 2P0LA 1F7YA 1YVWA 2B5UA 3MDSA 3PJSK 2EJGA 4XTVA 4NVPA 4XDLA 1JMKC 2C8MA 3R66A 2EIMB 5KAIZ 4WFHA 3TETA 3CC7V 2YUAA 4B3MB 4XU1A 5B66Z 5JWPA 3ABUA 3G1ZA 4UCOA 4GT1A 3I55V 1SQFA 3OMAB 5IY5B 1TAEA 1MZFA 2ZCEA 2LP7A 4X89A 3ZMSA 2VWJA 2H8PC 1XHXA 2ITCC 1I94O 4LF8O 3EFFK 5EBMC 2HLDG 3BEHA 1Z5WA 2IJJA 3ZRXA 3ZHUA 1NJ8A 2ZZEA 4DR2B 5IDJA 4CC5A 2DVEA 2CTQA 1K97A 4O4IA 1MMMA 2AMCA 3QF7A 1M5IA 1W0JG 3PCOA 3SJCC 2Q68A 4LFCO 3RYIA 1UPGA 5LGTA 1LUVA 2UXCB 1Q90D 2QWOB 1XNRO 4ZTUB 4RQEA 3X2QC 4CS4A 5LYJA 1SQXH 1EZVH 2R70A 3K58A 4JV5O 3H01A 2ODRD 2F66C 3B2EE 2E5LB 4P75C 3D36C 3ZRWA 4PJ0Z 2E74B 4CH5A 4G84A 1L1FA 2GSMB 1ZTEA 1ZWIC 3MHSC 5CBFA 3CRAA 2ZM6O 3GB7C 11ASA 2WLMA 1N36B 4TV8A 4WF2A 3KKYA 4YCWA 3CMEV 4WFBV 5EIBC 3JD1A 1FXHA 2QWNB 3HPLC 2GTAA 3CWBH 1AJPA 4FLUA 5C53B 1WB8A 3AK2A 4X8AA 1LUWA 3RKWA 3UCSC 4KHPO 4L87A 1FFTB 4UVBA 1JJOA 1B8AA 4YRMA 4ZOLB 2HHHB 1XL4A 1Q43A 3QTCA 1R3JC 5LOVA 1X59A 2EIJC 3OW2U 4FJCC 4JI4O 4JI0B 2X7RB 3H1IH 4JI7B 5L3EA 2BE3A 3D8CA 1C0AA 4LFBB 4TV8B 1JFFB 3HKEB 1QU7A 5EBLC 4H0LB 1IBKB 2ADPA 4P71C 4B3TB 3ASOC 1IZ3A 4FPPA 1VQNV 3TUPA 1J5EO 1GN6A 3FAVB 4DV1B 1QR8A 1AI5A 1WNSA 4NXNB 1ZSPA 1J95A 3JAKB 5AG2A 3I56V 1KBHA 5KHKA 2DYRC 1V54C 4WFFA 1M4UA 3E2EA 2A7WA 3T4ZA 1EN6A 3IKMB 1WP8A 1UFIA 1XL6A 3RYHA 1Q6UA 2VQFO 1P7GA 4I9QA 4DV4O 1Y66A 1H8HG 3VBBA 2PI5A 2QM8A 1X55A 5IYBO 3APQA 1GRJA 1R1BA 3K9AA 1QE0A 1QCEA 4J7ZA 4JYCA 2EJ9A 4C7UA 3ZJZA 5J2UA 2Q67A 2EJRA 3OEEG 4YCUA 4YRTA 3ETEA 2XTAA 4GKKB 4MVRA 2V4DA 5JVDA 1QR9A 5E3IA 3CC2V 3RKYA 1EFRG 1WLEA 4JPRA 2UUCB 1A32A 5EYPA 1JJ2U 5KX5A 5FL7G 2BOBC 3SDLA 2HKOA 3RYHB 3JD3A 4LF9B 5CA3A 4UPAA 2UXDB 1P4RA 1H4QA 1PL0A 3H1LH 3JATB 4I0XA 5KHIA 3ASNC 4DR3B 3BABA 4JI8B 1AP6A 2GDSA 1KKCA 4CC6A 4NR1A 1ADYA 2EIKB 2V7QG 1HR0B 1EVLA 2ZIMA 1QVFU 4ZHQA 1VQLV 4KL1A 4NB5A 1VARA 2QKAA 3FX7A 5FPRA 1Q6HA 1H8EG 5CA0B 4DR2O 2WLHA 1RM1C 3ETDA 1XI1A 2CH7B 3K9SA 4HT4A 5FPOA 2Q7HA 4QIWF 4U3JB 2EJFA 2OTJV 2ZNIA 2B9ZA 2OIEA 4MVSA 1XNRB 1SQQH 3ABLB 3RYFB 3HXUA 1F4NA 1WP7A 5E79Z 5KAFZ 1THZA 2DE0X 3JAKA 2E5LO 3ZCCA 4U3JA 2DOSA 2E1HA 3E8HA 4XTXA 2CTPA 2KSDA 3REUA 2RHSA 1QLEC 5CA0A 3P30A 1XMQO 4QGPA 3TEGA 2MW2B 3CSXA 4LF7O 2ZM6B 4IT5A 3DGEA 5IJ0A 1WPXA 4I0XB 2EX3A 1XNQO 3E8GA 5CA1A 1PPJH 1K33A 4YRLA 4I5SA 3DC6A 4JZ2A 1QLNA 1Y76A 3BA9A 3JAWB 3K08A 4ZTZB 2CJAA 3N2GA 4FM1A 1B06A 3ZX6A 5BY1A 1N33B 4KHPB 3CCSV 4YRPA 3RGLA 1Q7YW 3LSUA 1SA0A 4X1YA 4P73C 2M6YA 2HHHO 4PD4F 1V9PA 2HR3A 4LP8A 1AROP 1FS0G 3E22A 5KX5B 3E8FA 4JI0O 4X20A 4JI7O 3JD4A 2ZR3A 1TVKA 1VQ9V 3ZHRA 4XEOA 1K8AW 1FXKB 4LFBO 2E41A 4UP9A 3ASNB 5GONA 1IBKO 3G6EV 1YIJV 4B3TO 3Q4HA 1K4CC 3TEHA 3OR7C 2A8EA 3SJAC 4DV1O 2GBOA 5IJ9B 3A8TA 4JTAB 3CCQV 4AI8A 3BA8A 1NR1A 5IWAB 4K8XA 4F6RA 4H2YA 4BIUA 1B7YB 4OPAA 3V7SA 3HXZA 2Q0OC 4R7CA 3L70H 1GM9A 1PV0A 2RN9A 4X20B 1SRYA 3IGAC 4DXWA 2QJ1A 2IJIA 4LF4B 4MVMA 3N2GB 1JOYA 4KUMA 1YF2A 4TVWA 4LBEC 4P3NA 5C8YB 1H2GA 3UGTA 4DR4B 1SQGA 3L4GB 2P67A 1S72V 1PM9A 3D3QA 4XTWA 4D7TA 1HDJA 1AI4A 3JD2A 4HZ3A 4TUYB 2CIMA 5J2TB 2Q7GA 1W66A 1KC8W 12ASA 5LOVB 2UUCO 3UH0A 4MVZA 4B3SO 3UO2A 2ZE8A 4DV7O 3QO7A 1Q3EA 4YDQA 2BTQB 1JVMA 4O4LA 2ZXWC 2UXDO 2FB5A 2MK3A 3M4PA 3ZMZA 2ZDIA 3A32A 1V55B 2ARTA 4Z1MG 1RM1B 4JI8O 3RVYA 1R6TA 2EULA 4I7ZB 4F6RB 1ZUQA 5EIBD 3B4SA 3KCYA 5BR8B 3G71V 1KKDA 4JGSA 1OZ0A 1HR0O 3NELA 1BHBA 2C7IA 3RYFA 2EIKC 3L74H 4WI1A 1IXMA 3FYIB 4NCXA 4X64B 1Y67A 2E3CA 3ABLC 2P5OA 1I0HA 4H13B 2GTSA 1AR1B 4EKWA 2D3OW 1BCCH 3B40A 2ALYA 2H3OA 1DK1A 3T1YB 3UKMA 2YEVB 4JI1O 4JYAB 3PN1A 3AG1B 5B1BC 1HTTA 5KNNA 1S5HC 4P74A 2FKXA 3IFXA 2WWWA 5JCOA 1JQ0A 1EM1A 4TWAA 3NXSA 1FJGB 4DV5O 1I5YA 1N32O 1B70B 3KFUA 2AMCB 1YEWA 4P72C 3AG3B 1CXZB 2YEVA 4WJ4A 4YHHO 1X56A 2VQEO 2WPDG 2P22C 1XMQB 1GN4A 2NS6A 4LNUB 1VF7A 3CYOA 1YTFB 2HNIA 3RF1A 3OTOO 3ETGA 3H1KH 4B7EA 4HWTA 2EINC 2R72A 5LMNO 5D5QA 4XU2A 2JIZG 1G6UA 1N33O 2PUSA 1K5QA 1PNLA 2UUBO 2BTOA 3OM3B 4TOIA 3J81N 3CHXA 2PF4E 1P84F 2WLKA 3HXWA 3S3WA 1MA1A 2CTRA 1NJIW 1LR1A 5A2QN 1H2SB 2P7TC 3MEYA 4HA8A 1EIYA 2KB1A 3ABMB 5GW7A 2F43G 3A7RA 4E51A 1VMGA 1NYQA 4YRFA 1FXKC 1NS1A 1W2BU 3UFGA 1GN2A 2JGDB 1NJ1A 2R9AA 3DTUB 3QG5A 1CEZA 5IWAO 4TVAB 2W6IG 2KQXA 3SPCA 3A5YA 1NQTA 4DK1A 4YXWG 2LQTA 4I4TB 3CJHA 1COWG 1RP3B 3OGCC 4UCTA 2AZ0A 3FYEB 1BGYH 1WQ7A 1BZKA 1VQ7V 5IT9N 4CS3A 3EFRA 5KUMA 2RCVA 4GUNA 3A31A 2QEXV 4LF4O 2BSKA 1GKFA 1R3IC 1KMMA 4FLYA 3PCOB 4EB6B 4XTYA 2ZKOA 1ATIA 3OMIB 4ZBMA 2R9IA 1XHZA 4O2DA 2H94A 1WN7A 1G5IA 3JSNA 2DTIA 2YDEA 3W7XA 1Q82W 3JCUZ 1LYLA 2WAMA 1WJZA 2QA4V 2E76B 1D2DA 5IYZB 1E22A 3U0ZA 2Q69A 4MTGA 3ERRA 1GTOA 2XAGA 4MTOA 4DYLA 5GTIZ 3WB0A 1USYC 2W0FC 3UQ8A 4NXMB 3BY6A 4DR6B 3EVKA 4IL6Z 4O2BB 5LP6A 3ZHTA 2PYLA 1VQ6V 4QE9A 5A9GA 3K59A 4GLXA 1SZTA 4KR3A 1VP7A 2XASA 5BR8O 3QNEA 4N23A 1XMOO 1EN4A 2ZT8A 3L9DA 4ASUG 1YFRA 1S77D 1O9GA 3E9HA 2ODMA 2YXLA 3SJBC 4B7KA 1VEWA 5K1XA 3SYCA 2RMKB 4OX9O 1TUEB 3WG7C 4U3FH 4GKJO 3KG2A 3NETA 2HEPA 3T4DA 3RVZA 2YIAA 3H1HH 4CZZA 2Q5ZA 4LH6A 3CPWU 1VIBA 2Q4PA 2ADQB 4YROA 1KOGA 1Y76B 4TTVA 4KXRA 2VWKA 4B3RO 1FAFA 1SC5B 3VQXA 2A06H 2YICA 1Q5OA 4E4EA 3CXHF 2XAHA 2Z5UA 1SKVA 3L2ZA 3UM7A 4YRQA 3RGBA 3LDEA 2NNUA 3JAWA 4J9ZB 2DJZA 1IBLB 2VQEB 3P32A 4WCEV 1H4SA 3IC9A 1B70A 4E2LA 2VRZA 3G80A 1Z7NA 3ZBHA 4K88A 2JJ1G 4LWSA 1SESA 5C52B 3WU2Z 4X62O 1H2LA 4W4LA 1PD3A 1EFWA 4K86A 3SGIA 2E64A 2AKWA 2UU9O 2LW7A 5JJEB 4X65O 2LFSA 1R6KA 1RPOA 4MS2A 1N9WA 2QDOA 4EFEA 4AQYB 2Q8VA 1F51A 3HKBA 4XDKA 1HWYA 3BFMA 5L3GA 2JJ2G 4JAAA 4O2AA 5LBQA 3CRMA 4PHZA 5EZYB 4P73A 2A3QA 2LO1A 1N8RW 3V7CA 2OIGA 4DW1A 2CK3G 5IYDO 2UXXA 3N2KB 1WPYA 4LH7A 1S3JA 4WFAV 3HY0A 3CX5F 1YJ9V 3IG2A 1YZBA 4U7NA 2ZE5A 4FLVA 5CBGA 2OT5A 2LFRA 4K87A 2EIMC 3LDDA 4D7SA 4FK5C 1FFXA 3HXVA 2ZNJA 4HWSA 3K57A 1PNKA 4YIOA 1NJ6A 5DECA 2ALYB 1YB3A 1YDXA 2X6AA 1VQ5V 4Z2WA 2ZZGA 3L4GA 5J9PC 4PA3A 4H37A 2AHYA 3ABKC 2CUGA 2ZR2A 3HXXA 2WLIB 2ZT9B 1TUBB 1AVMA 3CP1A 1Z5VA 2FL4A 1X01A 1QLEB 4BW9A 4AILC 3T1HB 3SYOA 2XTIA 4UB6Z 1WA8A 2ETNA 1EQRA 2K9PA 2DYSB 1OCCC 4UV8A 1ASZA 2ZGWA 5C51B 2DYRB 3O9OA 2KG7A 4J80A 1FKAO 2UXCO 1LNQA 2M7WA 3K5MA 4LCUC 2Y69C 3TEHB 5LA6B 1E24A 3EXAA 3RW0A 4DUYO 3E89A 2YI9A 4JV5B 2IY5B 1VQOV 3R07A 2UXBB 2QE7G 2WSSG 2ZIOA 3RACA 3AG3C 1K4DC 4D6TH 1YI2V 5HGQA 1YCIA 5F5WA 1NZ6A 5KMGB 1CPYA 1V54B 3OMNB 1N36O 4UCUA 1ZL8A 3E35A 4IYHA 4MVUA 2AZ2A 1ROPA 1OCRC 1QBZA 1OCZB 3AG4C 5IY5C 2FYUH 3RN4A 1ZLZA 2CDYA 1Z7MA 1M57B 4PA9A 2OCHA 2EINB 2WLIA 3LNNA 2XAFA 2A79B 1Q86W 3OUSA 2E65A 2JVDA 4TUYA 2AGAA 2HJDA 2P90A 4JI2B 4H02A 5H2FZ 3RBZA 3JARB 3RL6A 3IJ4A 5ELOA 1BIBA 3GWOA 1IXBA 2EL9A 4JI4B 3APOA 2QKCA 4LF6O 3DXRA 3RUXA 1EVKA 1YTFD 3QO5A 4DR7O 2HVKC 4ZIBA 1Y4MA 4JI3O 4X1KB 4RUEA 4GCZA 3V8LA 3SR2C 2DDZA 4P71A 1S5JA 1AR5A 3CCVV 4YJ3A 4NKGB 2YIBA 2BOCC 4NXNO 4TWKA 3SJQC 1QHTA 4J7KA 4XTUA 4CBCA 1PP9H 3TXQA 3ZN0A 2ARUA 1WB7A 2QM7A 5EC2C 1SF9A 2K1EA 4DRXA 4X65B 4LVJA 1GM7A 3CCRV 3RYCA 2HP8A 2VQFB 5KHGA 4HYOA 4P2ZA 2ITDC 2QHUA 4ICGA 1GK9A 1IBMB 2GV9A 4YRGA 3LSSA 1HNWO 3HY1A 2UUAB 1IL2A 3FB8C 2PGGA 3HKBB 2IJKA 3ZMUA 4BR6A 1MZEA 2I4NA 4DRXB 3CRCA 3LC0A 1IVSA 4TSFG 3UT5A 1SQPH 1W0KG 1GAXA 1K73W 3P8TA 1FFXB 3BAAA 5K1PA 3S3XA 1HP8A 4RDXA 4CH3A 3W7WA 2NLJC 2Q9LA 2RQ6A 1E79G 1N4CA 3HTZA 4I55A 1Y74B 3ZHVA 3MF1A 3A0RA 1BQ0A 4JYYA 3SYQA 4RO2A 4UCSA 4EB6A 1YFSA 4H2TA 4FLWA 3N2KA 4DR3O 1O9HA 3AG1C 4PDLA 3MHHC 5IE9A 1E1RG 3QVNA 2WLNA 4DV0B 1M1KW 2CGOA 4P30A 4UUJC 3HB3B 2P06A 3OAAG 2CAZC 1N0JA 3K04A 5H9CA 4Q6GA 4HVCA 4UFZA 2ZE7A 3ZRSA 3I7FA 5LYJB 2XHBA 2ZT5A 5B1AB 2BTQA 1HNXB 4P74C 4TQDA 4PA7A 1DF5A 3OFNG 3ICXA 4KFMA 2DYSC 1MABG 4LVKA 3EFSA 3A74A 4NYKA 3F5TA
chains in the Genus database with same CATH topology
4UVCA 3K79A 4Q15A 3TCUA 1NYQA 1X54A 4YRFA 3D3IA 1FXKC 1NH2B 3NEMA 1W2BU 1DF4A 3H01A 2ODRD 1ENVA 4UV9A 4J15A 3UFGA 1NJ1A 2QHTA 3DTUB 3JD0A 4MSWC 1NNHA 4P75C 1CEZA 1OHHG 4XU3A 5HFLA 3ZRWA 1B7YA 4TVAB 2W6IG 4CH5A 3SPCA 3A5YA 1OCZC 3AG4B 4XDJA 4G84A 1L1FA 1NQTA 2GSMB 4Q20A 4JF3A 2DZCA 1ZWIC 3MHSC 4YXWG 5CBFA 1JJCB 4FMTA 1COWG 3GB7C 11ASA 2XNDG 1R73A 3OGCC 2WLMA 3CCLV 3FYEB 1WQ7A 4WF2A 4YCWA 3CMEV 4N21A 4WFBV 2DEQA 1VQ7V 1ASYA 3JD1A 1VQZA 4CS3A 2P6JA 5C93A 5KUMA 2WLJA 3EHBB 4KP4A 5EK0A 3A31A 3EFRA 1J5WA 3HRKA 1FXHA 3HPLC 4QPJA 2QEXV 4PHCA 1GKFA 1K3EA 1R3IC 5B1NA 2IH3C 1VQMV 1KMMA 1AJPA 3PCOB 5C53B 1P7BA 3HRIA 4XTYA 4PA4A 4X8AA 4QJFB 3RKWA 4L87A 1ATIA 1FFTB 4UVBA 3SPJA 3OMIB 4ZBMA 2Q5IA 3CCMV 1B8AA 1G8MA 3MQZA 4YRMA 2X6CA 2R9IA 1K5SA 4O2DA 2H94A 1XL4A 1G5IA 4AH6A 2QHSA 1NVPD 3QTCA 3UGQA 1E1QG 1R3JC 1YJNV 2DTIA 3ICAA 3A7UA 2EIJC 2ZZFA 2DWDC 3W7XA 3OW2U 2IW5A 4FJCC 1B6QA 3FB6C 1Q82W 4BIZA 1K92A 2X7RB 1UJWB 2Y69B 1LYLA 2WAMA 1KD1W 1BL8A 5L3EA 2QA4V 2CGHA 1K9MW 1VQ8V 1BHAA 1C0AA 1E22A 3QO8A 2I4LA 2Q69A 4MTGA 3ERRA 2IH1C 4G85A 5EBLC 2I4OA 1GTOA 2XAGA 4MTOA 2OCCB 5CBHA 1F4MA 1JJCA 2EWNA 4P71C 2GHYA 3ASOC 4FPPA 2W0FC 1VQNV 1USYC 3BY6A 1YFTA 3TUPA 1SETA 2ZTGA 4JAVA 4OXSA 3OD1A 4YRRA 1QR8A 4X88A 1VQ6V 2DTOA 1AI5A 4QE9A 3F5WC 1J95A 3I56V 1SZTA 5K1PA 4CH6A 4KR3A 3MF2A 2DQ0A 2XASA 4JTCB 5L3DA 5HFMA 3SPGA 2DYRC 3QNEA 2E5AA 1V54C 4N23A 3OUFA 4WFFA 2ZT8A 3E2EA 4YRJA 4ASUG 5ELNA 3T4ZA 3W7SA 1YFRA 3IKMB 1S77D 3ABTA 4MT8A 3E9HA 4BW5A 3OE7G 1NYRA 1XL6A 3V8JA 3K0GA 3DSQA 2Q6AA 4YRKA 3BFMA 1R3LC 1R3KC 5K1XA 3SYCA 2IJHA 1TUEB 3WG7C 1WNLA 1Y66A 3KG2A 1H8HG 3VBBA 1M57C 3AG2B 2PI5A 3NETA 1KECA 3T4DA 3RVZA 2QM8A 1NJ5A 4CZZA 1DLBA 5IYBO 1X55A 2YSUB 3CPWU 4LVMA 5E1AC 4YROA 1KOGA 4TTVA 1AJNA 3K9AA 1QE0A 2UXNA 2QTOA 2V1DA 1QCEA 4JYCA 3M4QA 2WLLB 5LGUA 1SERA 2EJ9A 3WQZA 3E86A 3ZJZA 2Q67A 2EJRA 3OEEG 3STZC 4YCUA 3VQXA 4YP0A 3ETEA 4YRTA 3F7YC 3ZIAG 4CS2A 4MVRA 1QR9A 5E3IA 2J3LA 4HWRA 3CC2V 2ZT6A 2XAHA 2Z5UA 3RKYA 1EFRG 2EZPA 5LHIA 2DU5A 1WLEA 3E83A 4JPRA 2G4CA 3L2ZA 3UM7A 4YRQA 3LDEA 2NNUA 2XAQA 5FL7G 3JYCA 4ZKIA 1JJ2U 4J9ZB 2DJZA 2BOBC 1USYA 1OCCB 2HKOA 2DKGA 3JD3A 2A0LA 5CA3A 4UPAA 1WQWA 3P32A 4WCEV 4TT3G 3X2QC 4P3OA 1H4SA 1P4RA 1B70A 1H4QA 4E2LA 1PL0A 1JCHA 2PMEA 3ASNC 1Z7NA 3RIRA 4K88A 1BMFG 1X2HA 2JJ1G 3LDCA 4H2UA 1I5XA 1SESA 4GX1A 5C52B 5DM6V 3F7VC 5B1AC 1ADYA 4YRNA 1PD3A 2EIKB 1M9NA 1EFWA 4K86A 3VQYA 1K7DA 2V7QG 1EVLA 4MVQA 2Y48A 2AKWA 2E64A 2RHQB 2ZIMA 3HFZA 1QVFU 4UP8A 1VQLV 1B76A 2LFSA 4XU0A 1R6KA 1RPOA 4MS2A 1G5HA 1N9WA 2XGTA 4JTDB 1F51A 2CJBA 5LHHA 1H8EG 2WLHA 1AI6A 1K34A 1HWYA 1M56C 4XDKA 3X2QB 1RM1C 3ETDA 5L3GA 2JJ2G 5EC1C 5LBQA 1NH2D 2ZDIC 4PG3A 4P73A 4WF9V 4JAUA 1N8RW 3V7CA 4HT4A 4PDMA 2XAJA 2EILB 2IY5A 1EZJA 2Q7HA 3K03A 2CK3G 5IYDO 4QIWF 2Q7EA 4LVIA 4GX0A 4PDRA 2OTLV 1KP3A 4R6ZA 2UXXA 2EJFA 2ATKC 2OTJV 1YGBA 1WPYA 2ZNIA 3K06A 1S3JA 4MVSA 2DXUA 4UP7A 5B3SC 5IYCO 4PDVA 3IC7A 4WFAV 3ABLB 3W7TA 3D36A 3HY0A 3LUTB 1YJ9V 4HWOA 3IG2A 4QNHB 1YHQV 4U7NA 4WFEA 4TQFA 4XBFA 3HXUA 1F4NA 3G4SV 5CBGA 1THZA 4YCVA 2OT5A 3NENA 2LFRA 4K87A 4P75A 4QE7A 2EIMC 3LDDA 3RKXA 4FK5C 4YPFA 5KA5A 3HXVA 3ZCCA 2ZNJA 5LHGA 2DWEC 3E8HA 2E1HA 2FYKA 4HWSA 1E1OA 4XTXA 4WJ3M 3CD6V 3REUA 2RHSA 1QLEC 3OR6C 1PNKA 3P30A 5B1BB 4H2XB 3TEGA 1MG1A 2RHSB 2XOKG 3DGEA 1NJ6A 2ALYB 1WPXA 1YB3A 4HWPA 2X6AA 1VQ5V 4YRIA 3SPIA 1MOFA 1NR7A 5KUKA 3E8GA 1NKDA 2ZZGA 3L4GA 1K33A 4YRLA 4I5SA 3R65A 3SPHA 5J9PC 4PA3A 3B8MA 4H37A 1QLNA 3FJPA 2AHYA 3ABKC 4XTZA 4H2VA 1FYFA 4MTFA 2EIJB 3K08A 2R9RB 2ZR2A 4ZTZB 3T2MA 1AI7A 3HXXA 1PYSA 1FXVA 2CJAA 3LSQA 3SYPA 1OCOC 4JYBA 2WLIB 3HXYA 1BBUA 4FIPC 4YYEA 3CP1A 2ZQMA 3CCSV 1X01A 4LNSA 4YRPA 1YSCA 1CP9A 3RGLA 2C2AA 1QLEB 5H6RA 3CCJV 1Q7YW 3T1CA 4BW9A 4P73C 3SYOA 2XTIA 5L3CA 2JK5C 3M99B 2DZ9A 1WU7A 4TVAA 2HR3A 2Z3YA 1EQRA 4G2KA 2DYSB 4LP8A 1AROP 3AEIA 2EAYA 1MSWD 1FS0G 1OCCC 4UV8A 3E8FA 5H6QA 4G28B 1ASZA 4P71A 1JX9A 1E1TA 1ADJA 3JD4A 2ZGWA 5C51B 2DYRB 2ZR3A 2JDIG 1H38A 2P5IA 5CN0A 1DTOA 1VQ9V 2PMFA 3ML0A 4XEOA 2X0LA 2B1IA 1LNQA 1FXKB 2ZD9A 1K8AW 2E41A 4UP9A 2M7WA 3ASNB 4LCUC 2Y69C 3WFVA 4BAYA 3A7AA 3B77A 4E51A 3G6EV 1F23A 3ZRVA 2X6BA 3TEHB 1YIJV 2IU0A 1E24A 2ODRC 2DTHA 1K4CC 1NBMG 1OCRB 2DW4A 3OR7C 2QKSA 3E89A 4U7OA 3RW0A 1G51A 1VQOV 1QVGU 1S76D 1PNMA 2W6JG 2IY5B 4I9WA 2OCCC 3R07A 4JTAB 3P8VA 3SYAA 3ASOB 3K3WA 2Q5HA 3CCQV 1NR1A 2QE7G 1RPRA 2DQ3A 2JEUA 2WSSG 4HAMA 3ZMVA 1PYSB 4H2XA 3ZMTA 2ZXFA 2ZIOA 3RACA 4LC1A 3AG3C 1WYDA 4H2YA 1K4DC 3VOUA 4BIUA 1YI2V 3TEHA 4RUFA 5HGQA 3K0DA 4OP0A 1M90W 1S0VA 5F5WA 1B7YB 1YITV 3V7SA 1CPYA 1V54B 3OMNB 1KP2A 2A8EA 4DO2A 3HXZA 4R7CA 1GGMA 1KMNA 3E35A 3W3SA 2EILC 1GM9A 3FKSG 4MVUA 1X2GA 1GMGA 1ROPA 2A9HA 1VQKV 4LVLA 1SRYA 3IGAC 4DXWA 1OCRC 1HXDA 2IJIA 4MVMA 1QBZA 4GX2A 4G27B 1OCZB 3AG4C 4H2WA 3CCEV 5IY5C 1JOYA 4KUMA 1Z7MA 1M57B 3AG2C 4J9YB 4PA9A 4LBEC 4P3PA 4P72A 4TVWA 4BWAA 1NJ2A 2EINB 2I4MA 3IALA 1H2GA 4KQEA 4P3NA 1FXKA 3UGTA 2WLIA 2XAFA 2A79B 1Q86W 3OUSA 2E65A 3L4GB 2P67A 2CJ9A 1GO3F 2P90A 4WFGA 1S72V 4H02A 4XEMA 3RBZA 4XTWA 1AI4A 3JD2A 4GX5A 4HZ3A 2CIMA 3RL6A 2Q7GA 2HG5C 1BIBA 5ELOA 3CC4V 4JASA 4MW3A 3GWOA 4RQFA 1KC8W 1W66A 1HC7A 2EL9A 3W7UA 12ASA 1EOVA 4EO4A 3UH0A 2IU3A 4MVZA 3HFVA 2HJFC 3RUXA 1EVKA 3VQWA 3LNMB 3FB7C 1YTFD 3QO5A 1EBOA 2HVKC 3QO7A 3CXCU 4ZIBA 3ZRWB 4YDQA 1Y4MA 1JVMA 3MD0A 1VQPV 2ZXWC 3CMQA 4YREA 4RUEA 5EBWC 4F4LA 5LGNA 4GCZA 3B8NA 1G4YB 3ABMC 3V8LA 2MK3A 4P9OA 3M4PA 2DDZA 5L3FA 5BZBA 1JPXA 3ABKB 3ZMZA 2ZDIA 3CCVV 3A32A 1V55B 4RAIA 4Z1MG 2ARTA 1RM1B 3STLC 2E10A 2BOCC 3A5ZA 2EBOA 4TWKA 3RVYA 5B1OA 4PA6A 3SJQC 4QPKA 4UVAA 2EZOA 4YRSA 3G71V 4XTUA 2B1GA 2WLLA 4CBCA 1KKDA 4JGSA 3CMAV 1RIQA 3ZN0A 2ARUA 1OZ0A 4PELA 3NELA 2QM7A 3TK1A 5EC2C 1BHBA 2C7IA 2K1EA 3WG7B 2EIKC 4LVJA 1GM7A 3CCRV 4WI1A 1IXMA 3FYIB 3JCZA 3PZCA 4NCXA 3ABLC 1NVPB 2E3CA 4HYOA 2ZXWB 4UXNA 4P2ZA 1AR1B 1ORQC 2ITDC 3ZN1A 4EKWA 2QHUA 1GK9A 4MW8A 1H4TA 4H2SA 3L1AA 1Q81W 4RMFA 2D3OW 4YRGA 3LSSA 1V55C 2ALYA 5DN6G 1AJQA 3HY1A 1IL2A 1PKXA 3FB8C 1BIAA 4MVOA 2IJKA 3ZMUA 1VQ4V 3UKMA 2ZT7A 2YEVB 3V8KA 2I4NA 3VQVA 3LC0A 5L3BA 3CCUV 4TSFG 3BJUA 3AG1B 1W0KG 5B1BC 1HTTA 5KNNA 1K73W 3P8TA 1S5HC 2RHQA 4P74A 1L0WA 3REXA 4DPGA 3IFXA 3IKLA 3V7RA 2WWWA 4R50A 2PI4A 1QF6A 1H4VB 1JQ0A 4CH4A 2JEXA 4RDXA 4TWAA 3NXSA 5KA6A 4X5OA 4CH3A 1I5YA 4P9PA 3W7WA 2ARSA 2AKWB 2NLJC 1B70B 5B3SB 1KQSU 1E79G 3HTZA 3KFUA 2AMCB 2P0LA 2B5UA 3PJSK 3A0RA 3AG3B 2EJGA 2DU7A 3MF1A 4P72C 4XTVA 4MTXA 2YEVA 4WJ4A 3SYQA 1X56A 4YRCA 4XDLA 4RO2A 5CMUA 2C8MA 2EIMB 2WPDG 1YFSA 4WFHA 4H2TA 2NS6A 3TETA 3CC7V 2FTKA 3CYOA 4R8CA 3AG1C 1YTFB 2QHVA 4XU1A 2HNIA 3RF1A 3ABUA 3G1ZA 4PDLA 3MHHC 1E1RG 1R6NA 2AHZA 4EX5A 3ETGA 4TVYA 1M1KW 2WLNA 4GT1A 3I55V 4OLFA 3OMAB 5IY5B 4P30A 2ZINA 4DQ2A 4UUJC 2ZCEA 4HWTA 2LP7A 3HB3B 4X89A 1BBWA 2EINC 3ZMSA 3OAAG 3E8BA 4XU2A 2H8PC 2ITCC 3K04A 2JIZG 3EFFK 1EIYB 5EBMC 1K5QA 2HLDG 1PNLA 3BEHA 5H9CA 2IJJA 1NJ8A 3ZRXA 2ZZEA 4Q6GA 4HVCA 2HFEC 3OM3B 3ZRSA 2DXTA 1OCOB 5IDJA 3I7FA 2DVEA 2ZT5A 1K97A 2WLKA 3FB5C 5B1AB 1YJWV 2AMCA 3HXWA 4KR2A 2HVJC 1NJIW 3P8YA 1W0JG 3PCOA 4P74C 4TQDA 4PA7A 1DF5A 3OFNG 3OEHG 4H33A 2P7TC 2Q68A 4KFMA 3MEYA 5LGTA 2DYSC 4HA8A 4LVKA 1EIYA 3EFSA 3E9IA 1GM8A 2KB1A 3ABMB 2J3MA 3HFZB 5GW7A 2F43G 3A7RA 3A74A 4ZTUB 4RQEA 1MABG 1M56B 4CS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q15 A;  1NYQ A;  1X54 A;  4YRF A;  3NEM A;  2ODR D;  3UFG A;  4J15 A;  1NJ1 A;  2QHT A;  1NNH A;  4P75 C;  1B7Y A;  4TVA B;  4CH5 A;  3A5Y A;  4G84 A;  2DZC A;  1JJC B;  11AS A;  4WF2 A;  1WQ7 A;  4YCW A;  2DEQ A;  1ASY A;  1VQZ A;  4CS3 A;  3EFR A;  4YCV A;  4YRC A;  3HRK A;  3WQZ A;  3A31 A;  1J5W A;  4PHC A;  1KMM A;  3PCO B;  5C53 B;  3HRI A;  4XTY A;  3RKW A;  4L87 A;  1ATI A;  2Q5I A;  1B8A A;  4YRM A;  4O2D A;  4AH6 A;  1G5I A;  2QHS A;  3QTC A;  3UGQ A;  2DTI A;  3ICA A;  3A7U A;  2ZZF A;  1LYL A;  2CGH A;  1C0A A;  1E22 A;  3QO8 A;  2I4L A;  3ERR A;  4G85 A;  2I4O A;  1JJC A;  2EWN A;  4P71 C;  1USY C;  1YFT A;  3TUP A;  1SET A;  2ZTG A;  4YRR A;  3OD1 A;  2DTO A;  4CH6 A;  4KR3 A;  3MF2 A;  2DQ0 A;  3QNE A;  2E5A A;  2ZT8 A;  4YRJ A;  5ELN A;  1YFR A;  3IKM B;  3E9H A;  3V8J A;  1NYR A;  3DSQ A;  4YRK A;  5K1X A;  1WNL A;  3VBB A;  3NET A;  1NJ5 A;  1X55 A;  4YRO A;  1KOG A;  4TTV A;  1QE0 A;  3M4Q A;  1SER A;  2EJ9 A;  3VQX A;  4YCU A;  4YP0 A;  4YRT A;  4CS2 A;  5E3I A;  2J3L A;  4HWR A;  2ZT6 A;  3RKY A;  2DU5 A;  1WLE A;  2G4C A;  3L2Z A;  4YRQ A;  2DKG A;  2DJZ A;  1USY A;  4UPA A;  1WQW A;  1H4S A;  4P3O A;  1B70 A;  1H4Q A;  2PME A;  1Z7N A;  3RIR A;  4K88 A;  1X2H A;  4H2U A;  1SES A;  5C52 B;  1ADY A;  4YRN A;  1EFW A;  4K86 A;  3VQY A;  4OP0 A;  2E64 A;  1EVL A;  3HFZ A;  2AKW A;  2RHQ B;  2ZIM A;  4UP8 A;  1B76 A;  4XU0 A;  1G5H A;  1N9W A;  2XGT A;  2CJB A;  3BFM A;  4PG3 A;  4P73 A;  3V7C A;  2IY5 A;  2Q7H A;  2Q7E A;  2EJF A;  1YGB A;  1WPY A;  2ZNI A;  2DXU A;  4UP7 A;  4HWO A;  3HY0 A;  3IG2 A;  4TQF A;  3HXU A;  4P75 A;  3NEN A;  4K87 A;  3RKX A;  4YPF A;  3HXV A;  2ZNJ A;  2FYK A;  2E1H A;  4XTX A;  4HWS A;  1E1O A;  4WJ3 M;  3REU A;  2RHS A;  4H2X B;  3TEG A;  2RHS B;  1NJ6 A;  2ALY B;  1YB3 A;  4HWP A;  4YRI A;  2ZZG A;  3L4G A;  4YRL A;  3FJP A;  4XTZ A;  4H2V A;  1FYF A;  2ZR2 A;  4ZTZ B;  3HXX A;  1PYS A;  2CJA A;  3LSQ A;  3HXY A;  1BBU A;  4YYE A;  4LNS A;  1X01 A;  4YRP A;  3RGL A;  4BW9 A;  4P73 C;  2XTI A;  2DZ9 A;  1WU7 A;  4TVA A;  1EQR A;  2EAY A;  1ASZ A;  1E1T A;  1ADJ A;  2ZGW A;  5C51 B;  2ZR3 A;  2P5I A;  4KR2 A;  2PMF A;  4XEO A;  2E41 A;  4UP9 A;  3A7A A;  4E51 A;  3TEH B;  1E24 A;  2ODR C;  2DTH A;  3TEH A;  1G51 A;  2IY5 B;  3R07 A;  3P8V A;  2Q5H A;  2DQ3 A;  1PYS B;  4H2X A;  2ZXF A;  2ZIO A;  3RAC A;  1WYD A;  4H2Y A;  5HGQ A;  5F5W A;  1B7Y B;  3V7S A;  3HXZ A;  1GGM A;  1KMN A;  3W3S A;  1X2G A;  1SRY A;  1HXD A;  4H2W A;  1Z7M A;  4TVW A;  4P3P A;  4BWA A;  4P72 A;  1NJ2 A;  4P3N A;  2I4M A;  3IAL A;  4KQE A;  3UGT A;  2E65 A;  3L4G B;  2CJ9 A;  4H02 A;  4XEM A;  4XTW A;  2CIM A;  3RL6 A;  2Q7G A;  5ELO A;  1BIB A;  1W66 A;  4RQF A;  1HC7 A;  2EL9 A;  12AS A;  1EOV A;  4EO4 A;  3UH0 A;  3HFV A;  3RUX A;  1EVK A;  3VQW A;  3QO5 A;  3QO7 A;  4YDQ A;  4ZIB A;  3CMQ A;  4YRE A;  3V8L A;  3M4P A;  2DDZ A;  4P71 A;  3A32 A;  2ART A;  2E10 A;  3A5Z A;  4YRS A;  4XTU A;  1RIQ A;  2ARU A;  3NEL A;  2C7I A;  4WI1 A;  3PZC A;  4NCX A;  2E3C A;  2QHU A;  1H4T A;  4H2S A;  3L1A A;  4RMF A;  4YRG A;  3LSS A;  2ALY A;  3HY1 A;  1IL2 A;  1BIA A;  2ZT7 A;  3VQV A;  3V8K A;  2I4N A;  3LC0 A;  3BJU A;  1HTT A;  5KNN A;  3P8T A;  1L0W A;  2RHQ A;  4P74 A;  3REX A;  4DPG A;  5K1P A;  3IKL A;  3V7R A;  1QF6 A;  1H4V B;  4CH4 A;  4RDX A;  4TWA A;  4X5O A;  4CH3 A;  2ARS A;  2AKW B;  1B70 B;  3KFU A;  3HTZ A;  2AMC B;  2P0L A;  3MF1 A;  2EJG A;  4P72 C;  2DU7 A;  4XTV A;  4WJ4 A;  1X56 A;  2C8M A;  1YFS A;  4H2T A;  2QHV A;  4XU1 A;  2HNI A;  3RF1 A;  3G1Z A;  4EX5 A;  4TVY A;  4OLF A;  2ZIN A;  4DQ2 A;  2ZCE A;  4HWT A;  1BBW A;  4XU2 A;  1EIY B;  1NJ8 A;  4Q6G A;  2ZZE A;  4HVC A;  2DXT A;  3I7F A;  2DVE A;  2ZT5 A;  3HXW A;  2AMC A;  3P8Y A;  3PCO A;  4P74 C;  4TQD A;  3MEY A;  4HA8 A;  1EIY A;  3EFS A;  3E9I A;  2J3M A;  3HFZ B;  4ZTU B;  3A74 A;  3A7R A;  4RQE A;  4XU3 A;  4CS4 A; 
#chains in the Genus database with same CATH topology
 3K79 A;  4Q15 A;  5LMU O;  1NH2 B;  4DUY B;  4J15 A;  2QHT A;  3JD0 A;  4MSW C;  3CRQ A;  2PTM A;  1NNH A;  1OHH G;  2UXB O;  4J41 A;  5HFL A;  1L8D A;  1OCZ C;  3AG4 B;  2D2C B;  4A5U B;  1NTK H;  1SQB H;  1JJC B;  4FMT A;  3P3N A;  2XND G;  1R73 A;  1XNQ B;  2QSA A;  3RWR D;  5CB4 A;  3CCL V;  1NT2 B;  2RJZ A;  1BQZ A;  4WBN A;  4FLT A;  4N21 A;  1GH6 A;  2DEQ A;  1ASY A;  1VQZ A;  2P6J A;  5C93 A;  4YCV A;  3EHB B;  3RYI B;  3HRK A;  5EK0 A;  1J5W A;  4PHC A;  4QPJ A;  1K3E A;  5B1N A;  1VQM V;  2IH3 C;  3BCC H;  3HRI A;  4PI0 A;  4PA4 A;  4QJF B;  3UT5 B;  2F4V B;  2Q5I A;  1G8M A;  4L8J A;  5IJ9 A;  1AR4 A;  4DUZ O;  2EJ7 A;  4O4I B;  2RNB A;  4JI2 O;  4AH6 A;  4O4J B;  1NVP D;  3UGQ A;  1E1Q G;  2YS8 A;  1YJN V;  1DGS A;  2ZZF A;  1QQC A;  2DWD C;  2IW5 A;  3FB6 C;  4X1Y B;  4BIZ A;  1K92 A;  1BL8 A;  4JI5 B;  2CGH A;  4YJ3 B;  1VQ8 V;  5JCO C;  5CB4 B;  4DR7 B;  2JS3 A;  2IH1 C;  4JI3 B;  4G85 A;  5IYZ A;  2EWN A;  2OCC B;  5CBH A;  2GHY A;  1YFT A;  1SET A;  1NU1 H;  3DXR B;  4YRR A;  3OD1 A;  1SA0 B;  3DC5 A;  4X88 A;  1IDS A;  3F5W C;  1U97 A;  4CH6 A;  5HFM A;  3SPG A;  2E5A A;  1XRE A;  4YRJ A;  5ELN A;  2AXT Z;  5DED A;  3ABT A;  4MT8 A;  5BXZ A;  4BW5 A;  3OE7 G;  1NYR A;  2Q6A A;  4YRK A;  1R3L C;  1R3K C;  1IBM O;  3AG2 B;  4Z1V A;  4DV2 B;  1DLB A;  2YSU B;  3OTF A;  4LVM A;  2UUA O;  1AJN A;  2UXN A;  4W4K A;  2QTO A;  2V1D A;  3M4Q A;  2WLL B;  1SER A;  1X4T A;  3E86 A;  3JAS B;  4I50 B;  4HNA A;  4YP0 A;  3F7Y C;  1BE3 H;  4IHJ A;  4J7J A;  2J3L A;  1N34 B;  2EZP A;  5LHI A;  2DU5 A;  4I4T A;  5KMG A;  2XAQ A;  1WA8 B;  4ZKI A;  2DKG A;  2PZS A;  1USY A;  1OCC B;  1WQW A;  4TT3 G;  4P3O A;  3TGU H;  2DN9 A;  1JCH A;  4OPH A;  4B3M O;  2PME A;  3RIR A;  1BSM A;  1X2H A;  1EN5 A;  3LDC A;  2O57 A;  5B1A C;  2Y0P A;  3F7V C;  4YRN A;  3VQY A;  3L75 H;  1K7D A;  4MVQ A;  2Y48 A;  2QWR B;  3KZI Z;  3JSL A;  2JS5 A;  3JAS A;  4I50 A;  1B76 A;  4DK0 A;  4LF8 B;  2XGT A;  3K5N A;  4X64 O;  4JTD B;  2CJB A;  1AI6 A;  1K34 A;  3X2Q B;  1NH2 D;  2ZDI C;  5LXT B;  1QNM A;  4WF9 V;  4JAU A;  4PDM A;  2EIL B;  2IY5 A;  5FNV B;  1U96 A;  4LNU A;  4UCV A;  2Q7E A;  4GX0 A;  4PDR A;  1KP3 A;  4R6Z A;  2ATK C;  4JI1 B;  2P4V A;  4LFC B;  4JZG A;  1W59 A;  3K06 A;  2DXU A;  4UP7 A;  5IYC O;  2GUZ B;  3W7T A;  3LUT B;  4QNH B;  3CS5 A;  1YHQ V;  3HKD A;  2F95 B;  3WB1 A;  5LMU B;  3G4S V;  4QE7 A;  5FNV A;  2LW1 A;  3FD9 A;  3RKX A;  4YPF A;  5KA5 A;  5LHG A;  2FYK A;  4FZ0 A;  4WJ3 M;  3CD6 V;  3OR6 C;  3U11 A;  5B1B B;  1MG1 A;  2GUZ A;  2XOK G;  4HWP A;  4YRI A;  3SPI A;  5KUK A;  3ZHQ A;  5JQG A;  2L35 A;  3SPH A;  3R65 A;  3OTO B;  3FJP A;  3B8M A;  4H2V A;  2ILM A;  1FYF A;  4MTF A;  2EIJ B;  1G1X B;  1AI7 A;  1PYS A;  1FXV A;  1VF6 C;  1VF5 B;  3LSQ A;  3SYP A;  5JJN B;  4JYB A;  3HXY A;  1JR9 A;  4LNS A;  3G67 A;  3AG7 A;  5JJJ B;  1CP9 A;  3CCJ V;  5H6R A;  3U10 A;  3T1C A;  4GYC B;  5L3C A;  2JK5 C;  2DZ9 A;  4TVA A;  2YI8 A;  4O4H A;  2Z3Y A;  4DV6 O;  3AEI A;  2EAY A;  5KLV H;  5J2T A;  2QTS A;  1PL4 A;  2YID A;  3H1J H;  1ADJ A;  1E1T A;  4JI5 O;  2P5I A;  1H38 A;  2JDI G;  2PMF A;  3ML0 A;  2X0L A;  5LA6 A;  4LF5 B;  5JQG B;  3A7A A;  3B77 A;  2YIB D;  2IU0 A;  1NBM G;  2DW4 A;  4K3A A;  1J5E B;  4U7O A;  1QVG U;  4YY3 B;  4B08 A;  4I9W A;  1XQ8 A;  3ASO B;  3M8A A;  1WPB A;  2DQ3 A;  3C90 A;  1HW7 A;  3ZED A;  1WYD A;  3VOU A;  4UB8 Z;  4RUF A;  1XUQ A;  3K0D A;  4UCR A;  3UO3 A;  1M90 W;  2N05 A;  5F2V O;  1YIT V;  4X9Q A;  1KP2 A;  1GGM A;  1KMN A;  2EIL C;  1RSO B;  3HKC A;  1HXD A;  3L73 H;  4J42 A;  4DV2 O;  4GX2 A;  1Y74 A;  3CCE V;  1SQV H;  3AG2 C;  4J9Y B;  4BWA A;  3AK1 A;  1NJ2 A;  2I4M A;  4ZI7 B;  4OGQ B;  1GO3 F;  4WFG A;  4XEM A;  3OGI B;  4JI6 O;  1KUQ A;  4GX5 A;  3E22 B;  4IIJ A;  4JAS A;  4RQF A;  1N34 O;  1HC7 A;  1EOV A;  4EO4 A;  5KHH A;  2DJV A;  2IU3 A;  3HFV A;  2HJF C;  5J2U B;  1NI8 A;  3LNM B;  5GON B;  4LF9 O;  3CXC U;  1TA8 A;  2ARH A;  3ZRW B;  3O65 A;  1VQP V;  3TXS A;  3CMQ A;  4YRE A;  5EBW C;  5LGN A;  2ZE6 A;  1G4Y B;  4NXM O;  4P9O A;  5BZB A;  1JPX A;  3ABK B;  5JH7 A;  1Y6X A;  3STL C;  5LL6 Y;  4K35 A;  2E10 A;  4EEQ A;  2EBO A;  3FAV A;  3A5Z A;  5B1O A;  4QPK A;  4UVA A;  2JGU A;  2B1G A;  1Q8I A;  1D5N A;  4WBN B;  1RIQ A;  4PEL A;  1XMO B;  4F6E A;  4LR3 A;  5EYP B;  2NR5 A;  3JCZ A;  2Y4T A;  3PZC A;  3WB2 A;  1XIL A;  4UXN A;  4OX9 B;  1ORQ C;  3ZN1 A;  4MW8 A;  4H2S A;  2PYJ A;  1V55 C;  5DN6 G;  1JFF A;  3HKE A;  1PKX A;  1BIA A;  4MVO A;  2ZT7 A;  1VQ4 V;  3VQV A;  4LFA O;  3AK3 A;  3ZHS A;  1GN3 A;  5L3B A;  3BJU A;  2QGN A;  3BVO A;  4X1K A;  1JA8 A;  4X1I A;  3V7R A;  4R50 A;  2PI4 A;  1QF6 A;  4CH4 A;  1AP5 A;  2WA3 A;  4P9P A;  2ARS A;  2AKW B;  5B3S B;  1KQS U;  1KMI Z;  2DU7 A;  4MTX A;  2QM4 A;  4FFB A;  5CMU A;  2FTK A;  4LF7 B;  4R8C A;  2QHV A;  2KKW A;  1FPO A;  1R6N A;  2AHZ A;  4EX5 A;  4TVY A;  4OLF A;  4X62 B;  2ZIN A;  4DQ2 A;  4DR1 B;  4BIO A;  1BBW A;  4HBN A;  2XT9 A;  5ITZ B;  3E8B A;  5C8Y A;  2UU9 B;  2RDC A;  1EIY B;  4AQY O;  4YJ2 A;  3JAL B;  2HFE C;  1MNG A;  4DR5 B;  2F1M A;  2DXT A;  1OCO B;  3A2F A;  3CRR A;  3FB5 C;  4DV6 B;  4I55 B;  1YJW V;  2HVJ C;  3P8Y A;  3FFQ A;  4H33 A;  3L72 H;  3OEH G;  2P4K A;  3E9I A;  1GM8 A;  2J3M A;  3HFZ B;  4LF5 O;  4K0K O;  4FLZ A;  4YIP A;  1M56 B;  1Z2G A;  4XU3 A;  4X1I B;  3GWK C;  4UVC A;  3TCU A;  1X54 A;  4FM0 A;  3D3I A;  3NEM A;  1DF4 A;  2L6L A;  1ENV A;  4UV9 A;  4YY3 O;  4TV9 B;  1B7Y A;  4XDJ A;  2QWQ B;  4Q20 A;  2N74 A;  3BFR A;  4JF3 A;  2DZC A;  1XOU A;  4PV1 B;  1YXB A;  2Q73 A;  3M7M X;  4J11 A;  4YRC A;  2WLJ A;  4KP4 A;  3WQZ A;  4GZR B;  1I08 A;  3NR7 A;  4NTX A;  1P7B A;  2JRI A;  5ITZ A;  4IIJ B;  3SPJ A;  4ABM A;  3CJH B;  3CCM V;  4DR4 O;  3MQZ A;  3TJT A;  2X6C A;  3T1H O;  1K5S A;  2F93 B;  4JI6 B;  2QHS A;  1KB9 F;  3ICA A;  3K5L A;  2G38 A;  3A7U A;  4H44 B;  1B6Q A;  3A0H Z;  1UJW B;  2Y69 B;  2E75 B;  1KD1 W;  1SS3 A;  4B3S B;  1IUR A;  3HKC B;  1K9M W;  1BHA A;  4DV7 B;  3QO8 A;  1IX9 A;  2I4L A;  5FLX N;  2I4O A;  4ZHQ B;  1JJC A;  1H2N A;  1F4M A;  3H9V A;  1US6 A;  2ZTG A;  2BSK B;  3N27 A;  4JAV A;  4OXS A;  2KG7 B;  2DTO A;  3MF2 A;  2DQ0 A;  4JTC B;  2PY5 A;  5L3D A;  3CB2 A;  5LP6 C;  3OUF A;  3BHP A;  3W7S A;  4IYI A;  3V8J A;  3DSQ A;  3K0G A;  2IJH A;  3KCX A;  1WNL A;  1M57 C;  1KEC A;  2AW9 A;  3C3T A;  1NJ5 A;  4FFB B;  5EZY A;  5E1A C;  3T1Y O;  1ZL8 B;  4LFA B;  2Y0I A;  3RFR A;  4JYA O;  2YXH A;  5LGU A;  4HNA B;  3STZ C;  1B3Q A;  3ZIA G;  4CS2 A;  2FML A;  1FJG O;  2CH7 A;  4DV5 B;  4HWR A;  1N32 B;  2ZT6 A;  4LWS B;  2YXY A;  2G4C A;  3E83 A;  2Y4U A;  4LF6 B;  3JYC A;  4YHH B;  2A0L A;  4NTW A;  3K5O A;  2Z0A A;  4X66 O;  3BPZ A;  3B09 A;  1S5L Z;  1KYO F;  1Q6I A;  4DW0 A;  1BMF G;  4H2U A;  1I5X A;  4GX1 A;  3CE2 A;  5DM6 V;  3JAL A;  3Q4H B;  1M9N A;  1NTZ H;  1MSD A;  2W0X A;  4DR1 O;  3HFZ A;  4OP0 A;  5LMN B;  2RHQ B;  3J7A U;  4UP8 A;  4XU0 A;  1TVK B;  1G5H A;  2UUB B;  1B04 A;  1TUB A;  5LHH A;  5LXT A;  4PI2 A;  1M56 C;  4DR5 O;  2NN4 A;  5EC1 C;  4PG3 A;  1HNZ B;  1HNW B;  2XAJ A;  1EZJ A;  3K03 A;  4LVI A;  2OTL V;  1OV9 A;  3G6B A;  4ZOL A;  1VF6 A;  1YGB A;  3RT3 C;  3ETQ A;  3MAQ A;  5B3S C;  4PDV A;  3IC7 A;  4HWO A;  4K0K B;  3D36 A;  1L0L H;  2VS0 A;  4WFE A;  5BMV A;  2LGW A;  3A0B Z;  4TQF A;  3OT7 A;  4XBF A;  4DV3 B;  4YJ2 B;  4P75 A;  3NEN A;  1I7F A;  2DWE C;  1E1O A;  5TIS Z;  4RWU A;  2F23 A;  4H2X B;  2DMX A;  2RHS B;  4O2A B;  1KU9 A;  1MOF A;  1NR7 A;  1NKD A;  1H2K A;  1L0N H;  4XTZ A;  4DV0 O;  1BT8 A;  4NTY A;  3JAM N;  2R9R B;  3CEI A;  3T2M A;  2N04 A;  3HR0 A;  4EFB A;  1OCO C;  1I94 B;  4AHC A;  3JAT A;  4FIP C;  1BBU A;  4YYE A;  2ZQM A;  1XEQ A;  1YSC A;  2IM9 A;  1T5E A;  1XBL A;  2C2A A;  5D5P A;  4FVM A;  3M99 B;  1WU7 A;  2LGQ A;  5KHJ A;  5JH7 B;  1BS3 A;  1ZX3 A;  4G2K A;  4J10 A;  1MSW D;  1HNX O;  2CE4 A;  5GTH Z;  4G28 B;  5H6Q A;  1D5A A;  1JX9 A;  4KR2 A;  5CN0 A;  1DTO A;  4O2B A;  5LP6 B;  2B1I A;  2ZD9 A;  3WFV A;  4BAY A;  1F23 A;  3ZRV A;  2X6B A;  4IGG A;  2ODR C;  2DTH A;  1OCR B;  4FZ1 A;  4DR6 O;  2QKS A;  5BMV B;  1G51 A;  1S76 D;  1PNM A;  2W6J G;  2OCC C;  1XDC A;  3P8V A;  3SYA A;  2YC0 A;  3K3W A;  2Q5H A;  2QR4 A;  4FLX A;  1RPR A;  2JEU A;  3ZMV A;  1PYS B;  4HAM A;  4H2X A;  3ZMT A;  5JVD B;  2OYQ A;  2XUM A;  2ZXF A;  4LC1 A;  1RFY A;  1NTM H;  4O4J A;  3P3P A;  3HKD B;  1S0V A;  4DO2 A;  3W3S A;  1X2G A;  3FKS G;  1GMG A;  2A9H A;  1VQK V;  4GKJ B;  3L71 H;  4LVL A;  2LJ2 A;  3OD4 A;  4G27 B;  2CTW A;  4H2W A;  2Q0A A;  3I5D A;  2IBZ H;  4P3P A;  5H5N A;  4P72 A;  2F4V O;  3IAL A;  4KQE A;  1FXK A;  4DUZ B;  2OWO A;  4B3R B;  2CJ9 A;  4IHJ B;  1OJH A;  4ZI7 A;  1H2M A;  2HG5 C;  3CC4 V;  4MW3 A;  3W7U A;  1TGO A;  4FFK A;  2JGD A;  3VQW A;  5B5E Z;  2WA4 A;  3FB7 C;  1IBL O;  1EBO A;  4TV9 A;  4X66 B;  3MD0 A;  4F4L A;  3B8N A;  3ABM C;  3RYC B;  3JAR A;  5L3F A;  3GVM A;  4RAI A;  1RSO A;  4PA6 A;  2EZO A;  4YRS A;  2WLL A;  2CGN A;  3CMA V;  1N0N A;  5IJ0 B;  3TK1 A;  3ZS8 C;  1M93 A;  2BCC H;  2QWP B;  1AB3 A;  3WG7 B;  1WAZ A;  3C3S A;  1NVP B;  1URF A;  2ZXW B;  4DV4 B;  1ZAU A;  1H4T A;  3L1A A;  1Q81 W;  4RMF A;  1SZX A;  1FYJ A;  1HNZ O;  1AJQ A;  5CA1 B;  3IAY A;  3V8K A;  1AIL A;  3CCU V;  4O4L B;  4O4H B;  1P49 A;  3J80 N;  2RHQ A;  3BRC A;  1L0W A;  3REX A;  4DPG A;  3IKL A;  1H4V B;  4GKK O;  2JEX A;  3THO A;  5KA6 A;  4X5O A;  4K8Z A;  4DV3 O;  4FM2 A;  1FD9 A;  2P0L A;  1F7Y A;  1YVW A;  2B5U A;  3MDS A;  3PJS K;  2EJG A;  4XTV A;  4NVP A;  4XDL A;  1JMK C;  2C8M A;  3R66 A;  2EIM B;  5KAI Z;  4WFH A;  3TET A;  3CC7 V;  2YUA A;  4B3M B;  4XU1 A;  5B66 Z;  5JWP A;  3ABU A;  3G1Z A;  4UCO A;  4GT1 A;  3I55 V;  1SQF A;  3OMA B;  5IY5 B;  1TAE A;  1MZF A;  2ZCE A;  2LP7 A;  4X89 A;  3ZMS A;  2VWJ A;  2H8P C;  1XHX A;  2ITC C;  1I94 O;  4LF8 O;  3EFF K;  5EBM C;  2HLD G;  3BEH A;  1Z5W A;  2IJJ A;  3ZRX A;  3ZHU A;  1NJ8 A;  2ZZE A;  4DR2 B;  5IDJ A;  4CC5 A;  2DVE A;  2CTQ A;  1K97 A;  4O4I A;  1MMM A;  2AMC A;  3QF7 A;  1M5I A;  1W0J G;  3PCO A;  3SJC C;  2Q68 A;  4LFC O;  3RYI A;  1UPG A;  5LGT A;  1LUV A;  2UXC B;  1Q90 D;  2QWO B;  1XNR O;  4ZTU B;  4RQE A;  3X2Q C;  4CS4 A;  5LYJ A;  1SQX H;  1EZV H;  2R70 A;  3K58 A;  4JV5 O;  3H01 A;  2ODR D;  2F66 C;  3B2E E;  2E5L B;  4P75 C;  3D36 C;  3ZRW A;  4PJ0 Z;  2E74 B;  4CH5 A;  4G84 A;  1L1F A;  2GSM B;  1ZTE A;  1ZWI C;  3MHS C;  5CBF A;  3CRA A;  2ZM6 O;  3GB7 C;  11AS A;  2WLM A;  1N36 B;  4TV8 A;  4WF2 A;  3KKY A;  4YCW A;  3CME V;  4WFB V;  5EIB C;  3JD1 A;  1FXH A;  2QWN B;  3HPL C;  2GTA A;  3CWB H;  1AJP A;  4FLU A;  5C53 B;  1WB8 A;  3AK2 A;  4X8A A;  1LUW A;  3RKW A;  3UCS C;  4KHP O;  4L87 A;  1FFT B;  4UVB A;  1JJO A;  1B8A A;  4YRM A;  4ZOL B;  2HHH B;  1XL4 A;  1Q43 A;  3QTC A;  1R3J C;  5LOV A;  1X59 A;  2EIJ C;  3OW2 U;  4FJC C;  4JI4 O;  4JI0 B;  2X7R B;  3H1I H;  4JI7 B;  5L3E A;  2BE3 A;  3D8C A;  1C0A A;  4LFB B;  4TV8 B;  1JFF B;  3HKE B;  1QU7 A;  5EBL C;  4H0L B;  1IBK B;  2ADP A;  4P71 C;  4B3T B;  3ASO C;  1IZ3 A;  4FPP A;  1VQN V;  3TUP A;  1J5E O;  1GN6 A;  3FAV B;  4DV1 B;  1QR8 A;  1AI5 A;  1WNS A;  4NXN B;  1ZSP A;  1J95 A;  3JAK B;  5AG2 A;  3I56 V;  1KBH A;  5KHK A;  2DYR C;  1V54 C;  4WFF A;  1M4U A;  3E2E A;  2A7W A;  3T4Z A;  1EN6 A;  3IKM B;  1WP8 A;  1UFI A;  1XL6 A;  3RYH A;  1Q6U A;  2VQF O;  1P7G A;  4I9Q A;  4DV4 O;  1Y66 A;  1H8H G;  3VBB A;  2PI5 A;  2QM8 A;  1X55 A;  5IYB O;  3APQ A;  1GRJ A;  1R1B A;  3K9A A;  1QE0 A;  1QCE A;  4J7Z A;  4JYC A;  2EJ9 A;  4C7U A;  3ZJZ A;  5J2U A;  2Q67 A;  2EJR A;  3OEE G;  4YCU A;  4YRT A;  3ETE A;  2XTA A;  4GKK B;  4MVR A;  2V4D A;  5JVD A;  1QR9 A;  5E3I A;  3CC2 V;  3RKY A;  1EFR G;  1WLE A;  4JPR A;  2UUC B;  1A32 A;  5EYP A;  1JJ2 U;  5KX5 A;  5FL7 G;  2BOB C;  3SDL A;  2HKO A;  3RYH B;  3JD3 A;  4LF9 B;  5CA3 A;  4UPA A;  2UXD B;  1P4R A;  1H4Q A;  1PL0 A;  3H1L H;  3JAT B;  4I0X A;  5KHI A;  3ASN C;  4DR3 B;  3BAB A;  4JI8 B;  1AP6 A;  2GDS A;  1KKC A;  4CC6 A;  4NR1 A;  1ADY A;  2EIK B;  2V7Q G;  1HR0 B;  1EVL A;  2ZIM A;  1QVF U;  4ZHQ A;  1VQL V;  4KL1 A;  4NB5 A;  1VAR A;  2QKA A;  3FX7 A;  5FPR A;  1Q6H A;  1H8E G;  5CA0 B;  4DR2 O;  2WLH A;  1RM1 C;  3ETD A;  1XI1 A;  2CH7 B;  3K9S A;  4HT4 A;  5FPO A;  2Q7H A;  4QIW F;  4U3J B;  2EJF A;  2OTJ V;  2ZNI A;  2B9Z A;  2OIE A;  4MVS A;  1XNR B;  1SQQ H;  3ABL B;  3RYF B;  3HXU A;  1F4N A;  1WP7 A;  5E79 Z;  5KAF Z;  1THZ A;  2DE0 X;  3JAK A;  2E5L O;  3ZCC A;  4U3J A;  2DOS A;  2E1H A;  3E8H A;  4XTX A;  2CTP A;  2KSD A;  3REU A;  2RHS A;  1QLE C;  5CA0 A;  3P30 A;  1XMQ O;  4QGP A;  3TEG A;  2MW2 B;  3CSX A;  4LF7 O;  2ZM6 B;  4IT5 A;  3DGE A;  5IJ0 A;  1WPX A;  4I0X B;  2EX3 A;  1XNQ O;  3E8G A;  5CA1 A;  1PPJ H;  1K33 A;  4YRL A;  4I5S A;  3DC6 A;  4JZ2 A;  1QLN A;  1Y76 A;  3BA9 A;  3JAW B;  3K08 A;  4ZTZ B;  2CJA A;  3N2G A;  4FM1 A;  1B06 A;  3ZX6 A;  5BY1 A;  1N33 B;  4KHP B;  3CCS V;  4YRP A;  3RGL A;  1Q7Y W;  3LSU A;  1SA0 A;  4X1Y A;  4P73 C;  2M6Y A;  2HHH O;  4PD4 F;  1V9P A;  2HR3 A;  4LP8 A;  1ARO P;  1FS0 G;  3E22 A;  5KX5 B;  3E8F A;  4JI0 O;  4X20 A;  4JI7 O;  3JD4 A;  2ZR3 A;  1TVK A;  1VQ9 V;  3ZHR A;  4XEO A;  1K8A W;  1FXK B;  4LFB O;  2E41 A;  4UP9 A;  3ASN B;  5GON A;  1IBK O;  3G6E V;  1YIJ V;  4B3T O;  3Q4H A;  1K4C C;  3TEH A;  3OR7 C;  2A8E A;  3SJA C;  4DV1 O;  2GBO A;  5IJ9 B;  3A8T A;  4JTA B;  3CCQ V;  4AI8 A;  3BA8 A;  1NR1 A;  5IWA B;  4K8X A;  4F6R A;  4H2Y A;  4BIU A;  1B7Y B;  4OPA A;  3V7S A;  3HXZ A;  2Q0O C;  4R7C A;  3L70 H;  1GM9 A;  1PV0 A;  2RN9 A;  4X20 B;  1SRY A;  3IGA C;  4DXW A;  2QJ1 A;  2IJI A;  4LF4 B;  4MVM A;  3N2G B;  1JOY A;  4KUM A;  1YF2 A;  4TVW A;  4LBE C;  4P3N A;  5C8Y B;  1H2G A;  3UGT A;  4DR4 B;  1SQG A;  3L4G B;  2P67 A;  1S72 V;  1PM9 A;  3D3Q A;  4XTW A;  4D7T A;  1HDJ A;  1AI4 A;  3JD2 A;  4HZ3 A;  4TUY B;  2CIM A;  5J2T B;  2Q7G A;  1W66 A;  1KC8 W;  12AS A;  5LOV B;  2UUC O;  3UH0 A;  4MVZ A;  4B3S O;  3UO2 A;  2ZE8 A;  4DV7 O;  3QO7 A;  1Q3E A;  4YDQ A;  2BTQ B;  1JVM A;  4O4L A;  2ZXW C;  2UXD O;  2FB5 A;  2MK3 A;  3M4P A;  3ZMZ A;  2ZDI A;  3A32 A;  1V55 B;  2ART A;  4Z1M G;  1RM1 B;  4JI8 O;  3RVY A;  1R6T A;  2EUL A;  4I7Z B;  4F6R B;  1ZUQ A;  5EIB D;  3B4S A;  3KCY A;  5BR8 B;  3G71 V;  1KKD A;  4JGS A;  1OZ0 A;  1HR0 O;  3NEL A;  1BHB A;  2C7I A;  3RYF A;  2EIK C;  3L74 H;  4WI1 A;  1IXM A;  3FYI B;  4NCX A;  4X64 B;  1Y67 A;  2E3C A;  3ABL C;  2P5O A;  1I0H A;  4H13 B;  2GTS A;  1AR1 B;  4EKW A;  2D3O W;  1BCC H;  3B40 A;  2ALY A;  2H3O A;  1DK1 A;  3T1Y B;  3UKM A;  2YEV B;  4JI1 O;  4JYA B;  3PN1 A;  3AG1 B;  5B1B C;  1HTT A;  5KNN A;  1S5H C;  4P74 A;  2FKX A;  3IFX A;  2WWW A;  5JCO A;  1JQ0 A;  1EM1 A;  4TWA A;  3NXS A;  1FJG B;  4DV5 O;  1I5Y A;  1N32 O;  1B70 B;  3KFU A;  2AMC B;  1YEW A;  4P72 C;  3AG3 B;  1CXZ B;  2YEV A;  4WJ4 A;  4YHH O;  1X56 A;  2VQE O;  2WPD G;  2P22 C;  1XMQ B;  1GN4 A;  2NS6 A;  4LNU B;  1VF7 A;  3CYO A;  1YTF B;  2HNI A;  3RF1 A;  3OTO O;  3ETG A;  3H1K H;  4B7E A;  4HWT A;  2EIN C;  2R72 A;  5LMN O;  5D5Q A;  4XU2 A;  2JIZ G;  1G6U A;  1N33 O;  2PUS A;  1K5Q A;  1PNL A;  2UUB O;  2BTO A;  3OM3 B;  4TOI A;  3J81 N;  3CHX A;  2PF4 E;  1P84 F;  2WLK A;  3HXW A;  3S3W A;  1MA1 A;  2CTR A;  1NJI W;  1LR1 A;  5A2Q N;  1H2S B;  2P7T C;  3MEY A;  4HA8 A;  1EIY A;  2KB1 A;  3ABM B;  5GW7 A;  2F43 G;  3A7R A;  4E51 A;  1VMG A;  1NYQ A;  4YRF A;  1FXK C;  1NS1 A;  1W2B U;  3UFG A;  1GN2 A;  2JGD B;  1NJ1 A;  2R9A A;  3DTU B;  3QG5 A;  1CEZ A;  5IWA O;  4TVA B;  2W6I G;  2KQX A;  3SPC A;  3A5Y A;  1NQT A;  4DK1 A;  4YXW G;  2LQT A;  4I4T B;  3CJH A;  1COW G;  1RP3 B;  3OGC C;  4UCT A;  2AZ0 A;  3FYE B;  1BGY H;  1WQ7 A;  1BZK A;  1VQ7 V;  5IT9 N;  4CS3 A;  3EFR A;  5KUM A;  2RCV A;  4GUN A;  3A31 A;  2QEX V;  4LF4 O;  2BSK A;  1GKF A;  1R3I C;  1KMM A;  4FLY A;  3PCO B;  4EB6 B;  4XTY A;  2ZKO A;  1ATI A;  3OMI B;  4ZBM A;  2R9I A;  1XHZ A;  4O2D A;  2H94 A;  1WN7 A;  1G5I A;  3JSN A;  2DTI A;  2YDE A;  3W7X A;  1Q82 W;  3JCU Z;  1LYL A;  2WAM A;  1WJZ A;  2QA4 V;  2E76 B;  1D2D A;  5IYZ B;  1E22 A;  3U0Z A;  2Q69 A;  4MTG A;  3ERR A;  1GTO A;  2XAG A;  4MTO A;  4DYL A;  5GTI Z;  3WB0 A;  1USY C;  2W0F C;  3UQ8 A;  4NXM B;  3BY6 A;  4DR6 B;  3EVK A;  4IL6 Z;  4O2B B;  5LP6 A;  3ZHT A;  2PYL A;  1VQ6 V;  4QE9 A;  5A9G A;  3K59 A;  4GLX A;  1SZT A;  4KR3 A;  1VP7 A;  2XAS A;  5BR8 O;  3QNE A;  4N23 A;  1XMO O;  1EN4 A;  2ZT8 A;  3L9D A;  4ASU G;  1YFR A;  1S77 D;  1O9G A;  3E9H A;  2ODM A;  2YXL A;  3SJB C;  4B7K A;  1VEW A;  5K1X A;  3SYC A;  2RMK B;  4OX9 O;  1TUE B;  3WG7 C;  4U3F H;  4GKJ O;  3KG2 A;  3NET A;  2HEP A;  3T4D A;  3RVZ A;  2YIA A;  3H1H H;  4CZZ A;  2Q5Z A;  4LH6 A;  3CPW U;  1VIB A;  2Q4P A;  2ADQ B;  4YRO A;  1KOG A;  1Y76 B;  4TTV A;  4KXR A;  2VWK A;  4B3R O;  1FAF A;  1SC5 B;  3VQX A;  2A06 H;  2YIC A;  1Q5O A;  4E4E A;  3CXH F;  2XAH A;  2Z5U A;  1SKV A;  3L2Z A;  3UM7 A;  4YRQ A;  3RGB A;  3LDE A;  2NNU A;  3JAW A;  4J9Z B;  2DJZ A;  1IBL B;  2VQE B;  3P32 A;  4WCE V;  1H4S A;  3IC9 A;  1B70 A;  4E2L A;  2VRZ A;  3G80 A;  1Z7N A;  3ZBH A;  4K88 A;  2JJ1 G;  4LWS A;  1SES A;  5C52 B;  3WU2 Z;  4X62 O;  1H2L A;  4W4L A;  1PD3 A;  1EFW A;  4K86 A;  3SGI A;  2E64 A;  2AKW A;  2UU9 O;  2LW7 A;  5JJE B;  4X65 O;  2LFS A;  1R6K A;  1RPO A;  4MS2 A;  1N9W A;  2QDO A;  4EFE A;  4AQY B;  2Q8V A;  1F51 A;  3HKB A;  4XDK A;  1HWY A;  3BFM A;  5L3G A;  2JJ2 G;  4JAA A;  4O2A A;  5LBQ A;  3CRM A;  4PHZ A;  5EZY B;  4P73 A;  2A3Q A;  2LO1 A;  1N8R W;  3V7C A;  2OIG A;  4DW1 A;  2CK3 G;  5IYD O;  2UXX A;  3N2K B;  1WPY A;  4LH7 A;  1S3J A;  4WFA V;  3HY0 A;  3CX5 F;  1YJ9 V;  3IG2 A;  1YZB A;  4U7N A;  2ZE5 A;  4FLV A;  5CBG A;  2OT5 A;  2LFR A;  4K87 A;  2EIM C;  3LDD A;  4D7S A;  4FK5 C;  1FFX A;  3HXV A;  2ZNJ A;  4HWS A;  3K57 A;  1PNK A;  4YIO A;  1NJ6 A;  5DEC A;  2ALY B;  1YB3 A;  1YDX A;  2X6A A;  1VQ5 V;  4Z2W A;  2ZZG A;  3L4G A;  5J9P C;  4PA3 A;  4H37 A;  2AHY A;  3ABK C;  2CUG A;  2ZR2 A;  3HXX A;  2WLI B;  2ZT9 B;  1TUB B;  1AVM A;  3CP1 A;  1Z5V A;  2FL4 A;  1X01 A;  1QLE B;  4BW9 A;  4AIL C;  3T1H B;  3SYO A;  2XTI A;  4UB6 Z;  1WA8 A;  2ETN A;  1EQR A;  2K9P A;  2DYS B;  1OCC C;  4UV8 A;  1ASZ A;  2ZGW A;  5C51 B;  2DYR B;  3O9O A;  2KG7 A;  4J80 A;  1FKA O;  2UXC O;  1LNQ A;  2M7W A;  3K5M A;  4LCU C;  2Y69 C;  3TEH B;  5LA6 B;  1E24 A;  3EXA A;  3RW0 A;  4DUY O;  3E89 A;  2YI9 A;  4JV5 B;  2IY5 B;  1VQO V;  3R07 A;  2UXB B;  2QE7 G;  2WSS G;  2ZIO A;  3RAC A;  3AG3 C;  1K4D C;  4D6T H;  1YI2 V;  5HGQ A;  1YCI A;  5F5W A;  1NZ6 A;  5KMG B;  1CPY A;  1V54 B;  3OMN B;  1N36 O;  4UCU A;  1ZL8 A;  3E35 A;  4IYH A;  4MVU A;  2AZ2 A;  1ROP A;  1OCR C;  1QBZ A;  1OCZ B;  3AG4 C;  5IY5 C;  2FYU H;  3RN4 A;  1ZLZ A;  2CDY A;  1Z7M A;  1M57 B;  4PA9 A;  2OCH A;  2EIN B;  2WLI A;  3LNN A;  2XAF A;  2A79 B;  1Q86 W;  3OUS A;  2E65 A;  2JVD A;  4TUY A;  2AGA A;  2HJD A;  2P90 A;  4JI2 B;  4H02 A;  5H2F Z;  3RBZ A;  3JAR B;  3RL6 A;  3IJ4 A;  5ELO A;  1BIB A;  3GWO A;  1IXB A;  2EL9 A;  4JI4 B;  3APO A;  2QKC A;  4LF6 O;  3DXR A;  3RUX A;  1EVK A;  1YTF D;  3QO5 A;  4DR7 O;  2HVK C;  4ZIB A;  1Y4M A;  4JI3 O;  4X1K B;  4RUE A;  4GCZ A;  3V8L A;  3SR2 C;  2DDZ A;  4P71 A;  1S5J A;  1AR5 A;  3CCV V;  4YJ3 A;  4NKG B;  2YIB A;  2BOC C;  4NXN O;  4TWK A;  3SJQ C;  1QHT A;  4J7K A;  4XTU A;  4CBC A;  1PP9 H;  3TXQ A;  3ZN0 A;  2ARU A;  1WB7 A;  2QM7 A;  5EC2 C;  1SF9 A;  2K1E A;  4DRX A;  4X65 B;  4LVJ A;  1GM7 A;  3CCR V;  3RYC A;  2HP8 A;  2VQF B;  5KHG A;  4HYO A;  4P2Z A;  2ITD C;  2QHU A;  4ICG A;  1GK9 A;  1IBM B;  2GV9 A;  4YRG A;  3LSS A;  1HNW O;  3HY1 A;  2UUA B;  1IL2 A;  3FB8 C;  2PGG A;  3HKB B;  2IJK A;  3ZMU A;  4BR6 A;  1MZE A;  2I4N A;  4DRX B;  3CRC A;  3LC0 A;  1IVS A;  4TSF G;  3UT5 A;  1SQP H;  1W0K G;  1GAX A;  1K73 W;  3P8T A;  1FFX B;  3BAA A;  5K1P A;  3S3X A;  1HP8 A;  4RDX A;  4CH3 A;  3W7W A;  2NLJ C;  2Q9L A;  2RQ6 A;  1E79 G;  1N4C A;  3HTZ A;  4I55 A;  1Y74 B;  3ZHV A;  3MF1 A;  3A0R A;  1BQ0 A;  4JYY A;  3SYQ A;  4RO2 A;  4UCS A;  4EB6 A;  1YFS A;  4H2T A;  4FLW A;  3N2K A;  4DR3 O;  1O9H A;  3AG1 C;  4PDL A;  3MHH C;  5IE9 A;  1E1R G;  3QVN A;  2WLN A;  4DV0 B;  1M1K W;  2CGO A;  4P30 A;  4UUJ C;  3HB3 B;  2P06 A;  3OAA G;  2CAZ C;  1N0J A;  3K04 A;  5H9C A;  4Q6G A;  4HVC A;  4UFZ A;  2ZE7 A;  3ZRS A;  3I7F A;  5LYJ B;  2XHB A;  2ZT5 A;  5B1A B;  2BTQ A;  1HNX B;  4P74 C;  4TQD A;  4PA7 A;  1DF5 A;  3OFN G;  3ICX A;  4KFM A;  2DYS C;  1MAB G;  4LVK A;  3EFS A;  3A74 A;  4NYK A;  3F5T A; 
#chains in the Genus database with same CATH homology
 4UVC A;  3K79 A;  4Q15 A;  3TCU A;  1NYQ A;  1X54 A;  4YRF A;  3D3I A;  1FXK C;  1NH2 B;  3NEM A;  1W2B U;  1DF4 A;  3H01 A;  2ODR D;  1ENV A;  4UV9 A;  4J15 A;  3UFG A;  1NJ1 A;  2QHT A;  3DTU B;  3JD0 A;  4MSW C;  1NNH A;  4P75 C;  1CEZ A;  1OHH G;  4XU3 A;  5HFL A;  3ZRW A;  1B7Y A;  4TVA B;  2W6I G;  4CH5 A;  3SPC A;  3A5Y A;  1OCZ C;  3AG4 B;  4XDJ A;  4G84 A;  1L1F A;  1NQT A;  2GSM B;  4Q20 A;  4JF3 A;  2DZC A;  1ZWI C;  3MHS C;  4YXW G;  5CBF A;  1JJC B;  4FMT A;  1COW G;  3GB7 C;  11AS A;  2XND G;  1R73 A;  3OGC C;  2WLM A;  3CCL V;  3FYE B;  1WQ7 A;  4WF2 A;  4YCW A;  3CME V;  4N21 A;  4WFB V;  2DEQ A;  1VQ7 V;  1ASY A;  3JD1 A;  1VQZ A;  4CS3 A;  2P6J A;  5C93 A;  5KUM A;  2WLJ A;  3EHB B;  4KP4 A;  5EK0 A;  3A31 A;  3EFR A;  1J5W A;  3HRK A;  1FXH A;  3HPL C;  4QPJ A;  2QEX V;  4PHC A;  1GKF A;  1K3E A;  1R3I C;  5B1N A;  2IH3 C;  1VQM V;  1KMM A;  1AJP A;  3PCO B;  5C53 B;  1P7B A;  3HRI A;  4XTY A;  4PA4 A;  4X8A A;  4QJF B;  3RKW A;  4L87 A;  1ATI A;  1FFT B;  4UVB A;  3SPJ A;  3OMI B;  4ZBM A;  2Q5I A;  3CCM V;  1B8A A;  1G8M A;  3MQZ A;  4YRM A;  2X6C A;  2R9I A;  1K5S A;  4O2D A;  2H94 A;  1XL4 A;  1G5I A;  4AH6 A;  2QHS A;  1NVP D;  3QTC A;  3UGQ A;  1E1Q G;  1R3J C;  1YJN V;  2DTI A;  3ICA A;  3A7U A;  2EIJ C;  2ZZF A;  2DWD C;  3W7X A;  3OW2 U;  2IW5 A;  4FJC C;  1B6Q A;  3FB6 C;  1Q82 W;  4BIZ A;  1K92 A;  2X7R B;  1UJW B;  2Y69 B;  1LYL A;  2WAM A;  1KD1 W;  1BL8 A;  5L3E A;  2QA4 V;  2CGH A;  1K9M W;  1VQ8 V;  1BHA A;  1C0A A;  1E22 A;  3QO8 A;  2I4L A;  2Q69 A;  4MTG A;  3ERR A;  2IH1 C;  4G85 A;  5EBL C;  2I4O A;  1GTO A;  2XAG A;  4MTO A;  2OCC B;  5CBH A;  1F4M A;  1JJC A;  2EWN A;  4P71 C;  2GHY A;  3ASO C;  4FPP A;  2W0F C;  1VQN V;  1USY C;  3BY6 A;  1YFT A;  3TUP A;  1SET A;  2ZTG A;  4JAV A;  4OXS A;  3OD1 A;  4YRR A;  1QR8 A;  4X88 A;  1VQ6 V;  2DTO A;  1AI5 A;  4QE9 A;  3F5W C;  1J95 A;  3I56 V;  1SZT A;  5K1P A;  4CH6 A;  4KR3 A;  3MF2 A;  2DQ0 A;  2XAS A;  4JTC B;  5L3D A;  5HFM A;  3SPG A;  2DYR C;  3QNE A;  2E5A A;  1V54 C;  4N23 A;  3OUF A;  4WFF A;  2ZT8 A;  3E2E A;  4YRJ A;  4ASU G;  5ELN A;  3T4Z A;  3W7S A;  1YFR A;  3IKM B;  1S77 D;  3ABT A;  4MT8 A;  3E9H A;  4BW5 A;  3OE7 G;  1NYR A;  1XL6 A;  3V8J A;  3K0G A;  3DSQ A;  2Q6A A;  4YRK A;  3BFM A;  1R3L C;  1R3K C;  5K1X A;  3SYC A;  2IJH A;  1TUE B;  3WG7 C;  1WNL A;  1Y66 A;  3KG2 A;  1H8H G;  3VBB A;  1M57 C;  3AG2 B;  2PI5 A;  3NET A;  1KEC A;  3T4D A;  3RVZ A;  2QM8 A;  1NJ5 A;  4CZZ A;  1DLB A;  5IYB O;  1X55 A;  2YSU B;  3CPW U;  4LVM A;  5E1A C;  4YRO A;  1KOG A;  4TTV A;  1AJN A;  3K9A A;  1QE0 A;  2UXN A;  2QTO A;  2V1D A;  1QCE A;  4JYC A;  3M4Q A;  2WLL B;  5LGU A;  1SER A;  2EJ9 A;  3WQZ A;  3E86 A;  3ZJZ A;  2Q67 A;  2EJR A;  3OEE G;  3STZ C;  4YCU A;  3VQX A;  4YP0 A;  3ETE A;  4YRT A;  3F7Y C;  3ZIA G;  4CS2 A;  4MVR A;  1QR9 A;  5E3I A;  2J3L A;  4HWR A;  3CC2 V;  2ZT6 A;  2XAH A;  2Z5U A;  3RKY A;  1EFR G;  2EZP A;  5LHI A;  2DU5 A;  1WLE A;  3E83 A;  4JPR A;  2G4C A;  3L2Z A;  3UM7 A;  4YRQ A;  3LDE A;  2NNU A;  2XAQ A;  5FL7 G;  3JYC A;  4ZKI A;  1JJ2 U;  4J9Z B;  2DJZ A;  2BOB C;  1USY A;  1OCC B;  2HKO A;  2DKG A;  3JD3 A;  2A0L A;  5CA3 A;  4UPA A;  1WQW A;  3P32 A;  4WCE V;  4TT3 G;  3X2Q C;  4P3O A;  1H4S A;  1P4R A;  1B70 A;  1H4Q A;  4E2L A;  1PL0 A;  1JCH A;  2PME A;  3ASN C;  1Z7N A;  3RIR A;  4K88 A;  1BMF G;  1X2H A;  2JJ1 G;  3LDC A;  4H2U A;  1I5X A;  1SES A;  4GX1 A;  5C52 B;  5DM6 V;  3F7V C;  5B1A C;  1ADY A;  4YRN A;  1PD3 A;  2EIK B;  1M9N A;  1EFW A;  4K86 A;  3VQY A;  1K7D A;  2V7Q G;  1EVL A;  4MVQ A;  2Y48 A;  2AKW A;  2E64 A;  2RHQ B;  2ZIM A;  3HFZ A;  1QVF U;  4UP8 A;  1VQL V;  1B76 A;  2LFS A;  4XU0 A;  1R6K A;  1RPO A;  4MS2 A;  1G5H A;  1N9W A;  2XGT A;  4JTD B;  1F51 A;  2CJB A;  5LHH A;  1H8E G;  2WLH A;  1AI6 A;  1K34 A;  1HWY A;  1M56 C;  4XDK A;  3X2Q B;  1RM1 C;  3ETD A;  5L3G A;  2JJ2 G;  5EC1 C;  5LBQ A;  1NH2 D;  2ZDI C;  4PG3 A;  4P73 A;  4WF9 V;  4JAU A;  1N8R W;  3V7C A;  4HT4 A;  4PDM A;  2XAJ A;  2EIL B;  2IY5 A;  1EZJ A;  2Q7H A;  3K03 A;  2CK3 G;  5IYD O;  4QIW F;  2Q7E A;  4LVI A;  4GX0 A;  4PDR A;  2OTL V;  1KP3 A;  4R6Z A;  2UXX A;  2EJF A;  2ATK C;  2OTJ V;  1YGB A;  1WPY A;  2ZNI A;  3K06 A;  1S3J A;  4MVS A;  2DXU A;  4UP7 A;  5B3S C;  5IYC O;  4PDV A;  3IC7 A;  4WFA V;  3ABL B;  3W7T A;  3D36 A;  3HY0 A;  3LUT B;  1YJ9 V;  4HWO A;  3IG2 A;  4QNH B;  1YHQ V;  4U7N A;  4WFE A;  4TQF A;  4XBF A;  3HXU A;  1F4N A;  3G4S V;  5CBG A;  1THZ A;  4YCV A;  2OT5 A;  3NEN A;  2LFR A;  4K87 A;  4P75 A;  4QE7 A;  2EIM C;  3LDD A;  3RKX A;  4FK5 C;  4YPF A;  5KA5 A;  3HXV A;  3ZCC A;  2ZNJ A;  5LHG A;  2DWE C;  3E8H A;  2E1H A;  2FYK A;  4HWS A;  1E1O A;  4XTX A;  4WJ3 M;  3CD6 V;  3REU A;  2RHS A;  1QLE C;  3OR6 C;  1PNK A;  3P30 A;  5B1B B;  4H2X B;  3TEG A;  1MG1 A;  2RHS B;  2XOK G;  3DGE A;  1NJ6 A;  2ALY B;  1WPX A;  1YB3 A;  4HWP A;  2X6A A;  1VQ5 V;  4YRI A;  3SPI A;  1MOF A;  1NR7 A;  5KUK A;  3E8G A;  1NKD A;  2ZZG A;  3L4G A;  1K33 A;  4YRL A;  4I5S A;  3R65 A;  3SPH A;  5J9P C;  4PA3 A;  3B8M A;  4H37 A;  1QLN A;  3FJP A;  2AHY A;  3ABK C;  4XTZ A;  4H2V A;  1FYF A;  4MTF A;  2EIJ B;  3K08 A;  2R9R B;  2ZR2 A;  4ZTZ B;  3T2M A;  1AI7 A;  3HXX A;  1PYS A;  1FXV A;  2CJA A;  3LSQ A;  3SYP A;  1OCO C;  4JYB A;  2WLI B;  3HXY A;  1BBU A;  4FIP C;  4YYE A;  3CP1 A;  2ZQM A;  3CCS V;  1X01 A;  4LNS A;  4YRP A;  1YSC A;  1CP9 A;  3RGL A;  2C2A A;  1QLE B;  5H6R A;  3CCJ V;  1Q7Y W;  3T1C A;  4BW9 A;  4P73 C;  3SYO A;  2XTI A;  5L3C A;  2JK5 C;  3M99 B;  2DZ9 A;  1WU7 A;  4TVA A;  2HR3 A;  2Z3Y A;  1EQR A;  4G2K A;  2DYS B;  4LP8 A;  1ARO P;  3AEI A;  2EAY A;  1MSW D;  1FS0 G;  1OCC C;  4UV8 A;  3E8F A;  5H6Q A;  4G28 B;  1ASZ A;  4P71 A;  1JX9 A;  1E1T A;  1ADJ A;  3JD4 A;  2ZGW A;  5C51 B;  2DYR B;  2ZR3 A;  2JDI G;  1H38 A;  2P5I A;  5CN0 A;  1DTO A;  1VQ9 V;  2PMF A;  3ML0 A;  4XEO A;  2X0L A;  2B1I A;  1LNQ A;  1FXK B;  2ZD9 A;  1K8A W;  2E41 A;  4UP9 A;  2M7W A;  3ASN B;  4LCU C;  2Y69 C;  3WFV A;  4BAY A;  3A7A A;  3B77 A;  4E51 A;  3G6E V;  1F23 A;  3ZRV A;  2X6B A;  3TEH B;  1YIJ V;  2IU0 A;  1E24 A;  2ODR C;  2DTH A;  1K4C C;  1NBM G;  1OCR B;  2DW4 A;  3OR7 C;  2QKS A;  3E89 A;  4U7O A;  3RW0 A;  1G51 A;  1VQO V;  1QVG U;  1S76 D;  1PNM A;  2W6J G;  2IY5 B;  4I9W A;  2OCC C;  3R07 A;  4JTA B;  3P8V A;  3SYA A;  3ASO B;  3K3W A;  2Q5H A;  3CCQ V;  1NR1 A;  2QE7 G;  1RPR A;  2DQ3 A;  2JEU A;  2WSS G;  4HAM A;  3ZMV A;  1PYS B;  4H2X A;  3ZMT A;  2ZXF A;  2ZIO A;  3RAC A;  4LC1 A;  3AG3 C;  1WYD A;  4H2Y A;  1K4D C;  3VOU A;  4BIU A;  1YI2 V;  3TEH A;  4RUF A;  5HGQ A;  3K0D A;  4OP0 A;  1M90 W;  1S0V A;  5F5W A;  1B7Y B;  1YIT V;  3V7S A;  1CPY A;  1V54 B;  3OMN B;  1KP2 A;  2A8E A;  4DO2 A;  3HXZ A;  4R7C A;  1GGM A;  1KMN A;  3E35 A;  3W3S A;  2EIL C;  1GM9 A;  3FKS G;  4MVU A;  1X2G A;  1GMG A;  1ROP A;  2A9H A;  1VQK V;  4LVL A;  1SRY A;  3IGA C;  4DXW A;  1OCR C;  1HXD A;  2IJI A;  4MVM A;  1QBZ A;  4GX2 A;  4G27 B;  1OCZ B;  3AG4 C;  4H2W A;  3CCE V;  5IY5 C;  1JOY A;  4KUM A;  1Z7M A;  1M57 B;  3AG2 C;  4J9Y B;  4PA9 A;  4LBE C;  4P3P A;  4P72 A;  4TVW A;  4BWA A;  1NJ2 A;  2EIN B;  2I4M A;  3IAL A;  1H2G A;  4KQE A;  4P3N A;  1FXK A;  3UGT A;  2WLI A;  2XAF A;  2A79 B;  1Q86 W;  3OUS A;  2E65 A;  3L4G B;  2P67 A;  2CJ9 A;  1GO3 F;  2P90 A;  4WFG A;  1S72 V;  4H02 A;  4XEM A;  3RBZ A;  4XTW A;  1AI4 A;  3JD2 A;  4GX5 A;  4HZ3 A;  2CIM A;  3RL6 A;  2Q7G A;  2HG5 C;  1BIB A;  5ELO A;  3CC4 V;  4JAS A;  4MW3 A;  3GWO A;  4RQF A;  1KC8 W;  1W66 A;  1HC7 A;  2EL9 A;  3W7U A;  12AS A;  1EOV A;  4EO4 A;  3UH0 A;  2IU3 A;  4MVZ A;  3HFV A;  2HJF C;  3RUX A;  1EVK A;  3VQW A;  3LNM B;  3FB7 C;  1YTF D;  3QO5 A;  1EBO A;  2HVK C;  3QO7 A;  3CXC U;  4ZIB A;  3ZRW B;  4YDQ A;  1Y4M A;  1JVM A;  3MD0 A;  1VQP V;  2ZXW C;  3CMQ A;  4YRE A;  4RUE A;  5EBW C;  4F4L A;  5LGN A;  4GCZ A;  3B8N A;  1G4Y B;  3ABM C;  3V8L A;  2MK3 A;  4P9O A;  3M4P A;  2DDZ A;  5L3F A;  5BZB A;  1JPX A;  3ABK B;  3ZMZ A;  2ZDI A;  3CCV V;  3A32 A;  1V55 B;  4RAI A;  4Z1M G;  2ART A;  1RM1 B;  3STL C;  2E10 A;  2BOC C;  3A5Z A;  2EBO A;  4TWK A;  3RVY A;  5B1O A;  4PA6 A;  3SJQ C;  4QPK A;  4UVA A;  2EZO A;  4YRS A;  3G71 V;  4XTU A;  2B1G A;  2WLL A;  4CBC A;  1KKD A;  4JGS A;  3CMA V;  1RIQ A;  3ZN0 A;  2ARU A;  1OZ0 A;  4PEL A;  3NEL A;  2QM7 A;  3TK1 A;  5EC2 C;  1BHB A;  2C7I A;  2K1E A;  3WG7 B;  2EIK C;  4LVJ A;  1GM7 A;  3CCR V;  4WI1 A;  1IXM A;  3FYI B;  3JCZ A;  3PZC A;  4NCX A;  3ABL C;  1NVP B;  2E3C A;  4HYO A;  2ZXW B;  4UXN A;  4P2Z A;  1AR1 B;  1ORQ C;  2ITD C;  3ZN1 A;  4EKW A;  2QHU A;  1GK9 A;  4MW8 A;  1H4T A;  4H2S A;  3L1A A;  1Q81 W;  4RMF A;  2D3O W;  4YRG A;  3LSS A;  1V55 C;  2ALY A;  5DN6 G;  1AJQ A;  3HY1 A;  1IL2 A;  1PKX A;  3FB8 C;  1BIA A;  4MVO A;  2IJK A;  3ZMU A;  1VQ4 V;  3UKM A;  2ZT7 A;  2YEV B;  3V8K A;  2I4N A;  3VQV A;  3LC0 A;  5L3B A;  3CCU V;  4TSF G;  3BJU A;  3AG1 B;  1W0K G;  5B1B C;  1HTT A;  5KNN A;  1K73 W;  3P8T A;  1S5H C;  2RHQ A;  4P74 A;  1L0W A;  3REX A;  4DPG A;  3IFX A;  3IKL A;  3V7R A;  2WWW A;  4R50 A;  2PI4 A;  1QF6 A;  1H4V B;  1JQ0 A;  4CH4 A;  2JEX A;  4RDX A;  4TWA A;  3NXS A;  5KA6 A;  4X5O A;  4CH3 A;  1I5Y A;  4P9P A;  3W7W A;  2ARS A;  2AKW B;  2NLJ C;  1B70 B;  5B3S B;  1KQS U;  1E79 G;  3HTZ A;  3KFU A;  2AMC B;  2P0L A;  2B5U A;  3PJS K;  3A0R A;  3AG3 B;  2EJG A;  2DU7 A;  3MF1 A;  4P72 C;  4XTV A;  4MTX A;  2YEV A;  4WJ4 A;  3SYQ A;  1X56 A;  4YRC A;  4XDL A;  4RO2 A;  5CMU A;  2C8M A;  2EIM B;  2WPD G;  1YFS A;  4WFH A;  4H2T A;  2NS6 A;  3TET A;  3CC7 V;  2FTK A;  3CYO A;  4R8C A;  3AG1 C;  1YTF B;  2QHV A;  4XU1 A;  2HNI A;  3RF1 A;  3ABU A;  3G1Z A;  4PDL A;  3MHH C;  1E1R G;  1R6N A;  2AHZ A;  4EX5 A;  3ETG A;  4TVY A;  1M1K W;  2WLN A;  4GT1 A;  3I55 V;  4OLF A;  3OMA B;  5IY5 B;  4P30 A;  2ZIN A;  4DQ2 A;  4UUJ C;  2ZCE A;  4HWT A;  2LP7 A;  3HB3 B;  4X89 A;  1BBW A;  2EIN C;  3ZMS A;  3OAA G;  3E8B A;  4XU2 A;  2H8P C;  2ITC C;  3K04 A;  2JIZ G;  3EFF K;  1EIY B;  5EBM C;  1K5Q A;  2HLD G;  1PNL A;  3BEH A;  5H9C A;  2IJJ A;  1NJ8 A;  3ZRX A;  2ZZE A;  4Q6G A;  4HVC A;  2HFE C;  3OM3 B;  3ZRS A;  2DXT A;  1OCO B;  5IDJ A;  3I7F A;  2DVE A;  2ZT5 A;  1K97 A;  2WLK A;  3FB5 C;  5B1A B;  1YJW V;  2AMC A;  3HXW A;  4KR2 A;  2HVJ C;  1NJI W;  3P8Y A;  1W0J G;  3PCO A;  4P74 C;  4TQD A;  4PA7 A;  1DF5 A;  3OFN G;  3OEH G;  4H33 A;  2P7T C;  2Q68 A;  4KFM A;  3MEY A;  5LGT A;  2DYS C;  4HA8 A;  4LVK A;  1EIY A;  3EFS A;  3E9I A;  1GM8 A;  2KB1 A;  3ABM B;  2J3M A;  3HFZ B;  5GW7 A;  2F43 G;  3A7R A;  3A74 A;  4ZTU B;  4RQE A;  1MAB G;  1M56 B;  4CS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...