1J5WA

Crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
276
Chain Sequence
MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha chain
publication title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
total genus 95
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 1j5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1j5wA01
2FYKA 2AKWA 1YB3A 2E65A 2ZGWA 1EFWA 4P73C 2CGHA 3QO7A 4HWRA 3QO8A 4RQFA 1ATIA 3ICAA 2ZT5A 3IKLA 4NCXA 4RDXA 2CJ9A 2ARTA 1B70A 3A32A 4YRIA 3V7CA 1JJCA 3NELA 4P3OA 2C7IA 5K1XA 4CH4A 4H02A 3HXXA 4L87A 4UPAA 2HNIA 2RHSB 4YRTA 1X2GA 4P74A 2I4LA 11ASA 4BWAA 2DEQA 1EOVA 2DXUA 1E24A 3A5ZA 5C51B 1ASZA 4XTZA 1PYSA 3HXWA 2ZCEA 4P74C 4Q6GA 5ELOA 2AMCA 1H4VB 3NEMA 3REUA 3FJPA 4CS2A 2J3LA 1HC7A 4XTYA 3M4PA 2PMFA 2ZT7A 3DSQA 1KOGA 3UGTA 4RQEA 3MEYA 3HXZA 1YFTA 1EQRA 1X56A 3HY0A 3V7SA 4WI1A 4G84A 4PHCA 4K88A 1J5WA 1WPYA 3A7RA 1G5HA 1GGMA 2XGTA 1EIYB 1E1OA 4XU0A 1B7YA 2ZT8A 4TQFA 4P71A 3HFZB 4G85A 3PCOB 4P71C 4WJ4A 4YRQA 1SETA 4HWPA 3I7FA 4X5OA 2I4NA 3HXUA 1QF6A 2E5AA 3A7AA 3W3SA 3IKMB 1YFRA 2ZINA 1C0AA 4H2XA 3HY1A 5HGQA 2ARSA 1WQWA 3EFRA 3V7RA 1EVKA 4YRCA 3L2ZA 2CJAA 3E9HA 1USYA 3HRIA 4UP7A 2DDZA 4P72A 2DU7A 1VQZA 1HTTA 4HWTA 4YYEA 2P5IA 1USYC 5F5WA 4HWSA 4P72C 1W66A 4P3NA 4E51A 4TVYA 2ZNJA 4CS4A 3VQXA 1H4QA 4XU2A 1E22A 2E41A 2ZXFA 3V8LA 2ZZGA 2EJ9A 1X55A 4YRMA 2ZR3A 4WF2A 1EVLA 1B70B 1X01A 3RACA 3MF1A 1WNLA 2RHSA 3MF2A 2ZZFA 2ZZEA 1NJ2A 1Z7MA 4XEMA 3QNEA 3HXYA 1HXDA 3HXVA 4YRJA 3TEGA 4P75A 4EX5A 2EJFA 2RHQB 4H2SA 2DKGA 2Q7GA 3HRKA 1H4TA 2EL9A 2ODRC 3P8YA 4P75C 1WU7A 2I4OA 3NETA 2CJBA 4YCUA 1FYFA 2DQ0A 3RL6A 3A31A 3TEHB 1G51A 2ZR2A 2P0LA 1WYDA 1X2HA 3IG2A 4UP9A 2QHSA 2Q5IA 4KR2A 3L1AA 3E9IA 2DVEA 3VQYA 3P8VA 2IY5A 1EIYA 2EJGA 2PMEA 1SERA 4DQ2A 4TVAA 2ODRD 3R07A 3HFZA 2J3MA 4HWOA 2QHUA 4HVCA 2E64A 3PCOA 3HTZA 3BJUA 2E1HA 1B8AA 4UP8A 4Q15A 4YRLA 3WQZA 3G1ZA 5KNNA 4TTVA 3UGQA 1BBUA 4TWAA 4CH3A 2ZNIA 1IL2A 4J15A 2DTOA 4H2XB 1ASYA 2I4MA 2Q7EA 3VQVA 1E1TA 3M4QA 3NENA 4H2WA 2CIMA 1BIAA 3QTCA 3RKXA 2ALYB 4AH6A 3L4GB 3V8KA 2QHTA 4XTUA 2DTHA 2EAYA 5C53B 2XTIA 2AKWB 4YRRA 2DU5A 4H2YA 1N9WA 3UH0A 4XU1A 4XEOA 4YRPA 4H2VA 4RMFA 1SESA 1BIBA 1L0WA 1WLEA 3LSSA 1JJCB 1NJ1A 3PZCA 2DZ9A 3CMQA 4BW9A 4YRGA 2ARUA 4YCVA 4KR3A 1B76A 4DPGA 4LNSA 4ZIBA 1NYRA 3RUXA 1KMNA 1WQ7A 1PYSB 3QO5A 4XTWA 2DJZA 1H4SA 4CS3A 2EWNA 2RHQA 1Z7NA 2AMCB 4K87A 4KQEA 3UFGA 2ZT6A 3LSQA 4YPFA 1X54A 4TQDA 1G5IA 2DQ3A 3TEHA 1RIQA 4P3PA 5E3IA 3RKYA 4O2DA 3KFUA 1NJ6A 3RKWA 3RIRA 1NNHA 4OP0A 3VQWA 3IALA 4YCWA 4YRKA 3VBBA 1NJ5A 1YFSA 2DZCA 4YRFA 4XTXA 2C8MA 1B7YB 4YROA 2IY5B 2DXTA 2ZTGA 4XTVA 1NJ8A 12ASA 4HA8A 1YGBA 4TVAB 4EO4A 2ZIMA 4ZTZB 4PG3A 3A5YA 5ELNA 2E3CA 3A7UA 4H2UA 3ERRA 4H2TA 1ADYA 3OD1A 2QHVA 4CH6A 1NYQA 4WJ3M 3TUPA 3RF1A 2E10A 1QE0A 2Q5HA 3EFSA 4YRNA 4K86A 1KMMA 4YREA 4CH5A 3BFMA 1ADJA 4YDQA 1BBWA 1LYLA 4OLFA 1SRYA 2Q7HA 2DTIA 3V8JA 3HFVA 3RGLA 3P8TA 2ZIOA 2G4CA 3REXA 4ZTUB 3LC0A 5K1PA 4YRSA 4YP0A 3A74A 4TVWA 4XU3A 5C52B 2ALYA 3L4GA 4P73A
chains in the Genus database with same CATH superfamily
4GYRA 4KX6A 3RYIE 2AKWA 3JAEA 2ZGWA 1EFWA 3QO7A 3JADA 2XJ7A 3RC3A 1ATIA 3ICAA 4QWNB 3N9PA 3KV6A 2DL1A 3V7CA 4LFCT 1YKEB 3Q5WA 1JJCA 2V6YB 3NELA 4P3OA 5C3JA 2X0HA 4QH4A 4X66T 4CH4A 4L87A 3AEEA 3RKOA 4U7IA 2HNIA 4XBFB 4BA9A 2KXPB 1QUUA 4P74A 2I4LA 4BWAA 3PJAA 1G8XA 4WW0A 3AAAB 3K3OA 1PYSA 5LCYA 3HXWA 4YT0A 2V7JA 3H3MA 1IZNB 2V7MA 5HEHA 2I59A 3NZQA 3RKGA 3FJPA 4WNKA 3REUA 4CS2A 4GK5E 2L8KA 2J3LA 4ZI3C 3AEAA 3M4PA 2XQ4A 4EB6E 3MEYA 3X1DA 4U33A 4K0KT 1KEYA 4PHCA 1DU2A 3HKBE 2QYWA 2V5CA 5FVLA 1G5HA 4B3TT 4XU0A 3EABA 1XZYA 5LBMA 1FIOA 4A97A 3FXEB 5AQSB 3ZSTA 4P71A 2XHEB 4X65T 3PU3A 4NPPA 4G85A 4ZI3D 3KV4A 2UXDT 2WZHA 3B5MA 4LF8T 4HWPA 2VASA 2D0UA 3LJCA 2XM2A 2E9XA 2P9BA 1WLXA 3N2GE 3HXUA 3CQCB 4HE8A 2E5AA 4ILUA 4QXCB 3N2KE 3IKMB 3NKZA 1HNXT 1YFRA 3ONLC 4H2XA 3AEGA 5HGQA 4AI6A 4DR7T 5L3EB 4JI7T 1EVKA 4YRCA 5EK2A 5ETWA 4YJ3E 2IMLA 2WMNA 3E9HA 3HRIA 2DU7A 3I9YA 2LOPA 1N33T 1VQZA 2E5LT 4UVBB 2BKPA 3AXJB 2I0MA 4HWTA 1USYC 4IT4A 4P72C 5JDFA 3I1AA 1W66A 3KV9A 1J5ET 2H7VC 3KV5A 3NWIA 2BBJA 4LF5T 3CX8B 5F3JA 3ZJ2A 3JCFA 2WY2A 2ODUA 2ZXFA 3OPCA 3V8LA 4E7ZA 4TV9E 2CPTA 2CXDA 3LK2B 2D2SA 3R84B 2WAUA 4YRMA 3RHWA 1MNDA 1EVLA 2JIWA 1X01A 4QXBB 3PE0A 3MF1A 3IEEA 2YDSA 3MF2A 4JI0T 3HXYA 3E22E 4DVDA 4QH5A 2Z6EA 4JI3T 4UXNB 2WWUA 2LJLA 5AQFB 4IE6A 4JV5T 3MACA 1H4TA 4DMVA 4NUUA 4LFBT 2DHRA 3T8OA 5LHIB 3NETA 1WCRA 4EEDA 2DQ0A 3RL6A 3ZMZB 4JBWF 3TEHB 4ZS2A 5JTGA 1G51A 2QRXA 1X2HA 3IG2A 3I9WA 3UU6A 2QHSA 1OEDB 2XSBA 4LF4T 3F57A 2LSIA 5IYZE 4EZHA 3P8VA 5ABGA 2IY5A 2EJGA 4DR6T 2UUBT 4TVAA 1XDPA 3MA9A 5HXHA 3ZYKA 2IUBA 3AA1B 4HFHA 4HVCA 4PK4A 5FKYA 2E64A 3WAKA 3HTZA 5JDMA 3SWHA 1W9RA 3VU7H 5L3GB 1O3XA 2UUCT 4DV7T 2KZ7B 4Q15A 5HEOA 4AKHA 2EHOA 2LSYA 3WQZA 3G1ZA 4LFAT 2BKNA 1Z0PA 1YW0A 2J47A 4ZEYA 2ZM2A 2C5IT 1NWMX 5L2LA 3RRCA 4ZHQE 4TWAA 2CE7A 4CH3A 2ZNIA 3KBTA 1IL2A 5LGTB 4J15A 2DTOA 4H2XB 5LMNT 2I4MA 5BMVE 3ZMVB 3M4QA 4NIQA 3ZT7A 3T1HT 4H2WA 2KNDA 2DWKA 3EDUA 4MBQA 1BIAA 4U3CA 2FBWA 5EK4A 4B3MT 3RKXA 4AH6A 3L4GB 1S35A 1ZV4X 3QNUA 4XTUA 2KINB 2EAYA 2XTIA 1VCSA 3ZYLA 5AQIB 4YRPA 2BZBA 4EEBA 4IDQA 4DR4T 1WRDA 1SESA 5LHHB 1L0WA 2CWOA 3EI0A 4EIWA 2KSRA 1UK5A 3LK3B 4H9SE 2X51A 2ARUA 2W61A 3KINB 1N36T 4QXHB 5ADXL 3RUXA 5ABHA 1WQ7A 1HX8A 4JYAT 1Z7NA 3NRYA 3ZSSA 3Q2MA 5ABEA 4TQDA 3OKQA 5CGMA 4EGWA 1G5IA 5KX5E 3P7IA 4DO0A 3PTRB 1RIQA 4O2DA 2BS4A 3ZT5A 4H9NC 2YKSA 3RKWA 2XQ8A 1LVKA 3FBZA 3UTKA 3UUNA 4LMKA 2ZM8A 3IALA 2W0GA 4YRKA 4OHFA 1SE7A 2YK0A 4XTXA 1XWMA 1B7YB 2A9UA 4YROA 2IY5B 2XASB 1CHUA 2LT3A 5HEUA 1BR4A 3A8YC 4LVKA 4E7SA 4YSZA 1HNZT 4U72A 4N78D 4HA8A 1ZP0A 2CLYC 3AA7B 4TVAB 5CJ5A 4FI5A 3K3NA 4ZTZB 2W63A 3WI3A 1IAPA 5ELNA 5KDMC 4TNVA 3ERRA 4H63V 4JLEA 1ADYA 4PK6A 4AQGA 3A5XA 5AQRB 2LSGA 1NYQA 4JI6T 4YJ2E 3TUPA 2BVMA 1QE0A 2YU1A 2D0TA 5LYJE 2A2FX 4YRNA 4HFVA 3D0TA 3QB5A 2FJEA 3UU3A 1ZHCA 4GKJT 3N9LA 5LJNA 2MOZA 1BBWA 1LYLA 2WB5A 4OLFA 1SRYA 2Q7HA 1B7TA 4YTPA 4X1KE 2V26A 1MIVA 5JRCA 2ZIOA 2WDRA 4ZTUB 3LDQB 4YRSA 4YP0A 2IC6A 1HNWT 4U2ZA 4OYJA 3JC6C 4CXYA 2E65A 3AEDA 4P73C 2CGHA 5JR9A 1J1JA 5A1LA 2SPCA 1HFAA 4KMCA 2ZT5A 2KMFA 1G73A 2X0YA 1B70A 3A32A 4YRIA 2YDQA 4DV5T 2WCAA 1R8IA 1US7B 4UPAA 2RHSB 3FZMB 3MZKB 2YOEA 2BS2A 1SUMB 5IHYA 4Q25A 2K24A 3JC6D 1D0ZA 4EV6A 1E24A 3A5ZA 5C51B 4XTZA 4P74C 4YHHT 4A98A 2DI4A 2ZM0A 2L9QA 4OX9T 2AMCA 1H4VB 4MLKA 3SFEA 1SHZC 4XTYA 4X64T 1ZOYA 2PMFA 2ZT7A 3DSQA 1KF6A 2IHR1 3UGTA 4RQEA 1T72A 2JPFA 3HR0A 4GKKT 1YFTA 3V7SA 4G84A 3ANWB 3SFDA 4K88A 1X79A 1WPYA 3BQLA 2XGTA 2CXLA 2CRBA 5ABFA 4Z8XA 2PFVA 3AA0B 4ANJA 4JI2T 3EDVA 4GYSA 3OVUA 4I43B 4KBMB 1ZKEA 3PCOB 4P71C 3HKDE 4LVMA 3FHNA 4YRQA 4IREA 2J4GA 5AQOB 2CHOA 3I7FA 4X5OA 2LSKA 5C8YE 2OA5A 1HR0T 4BJNA 2QGSA 4DR5T 2E9XC 3AEFA 5BR8T 3W3SA 3K1SA 2ZINA 1C0AA 2B1EA 2XQ5A 2DCFA 2D9DA 3EFRA 4YTMA 1HCIA 3V7RA 2OLTA 1UURA 3QUJA 4UP7A 5AQJB 2X67A 2LHNA 5FXZA 3UU5A 4YYEA 3P4QA 5F5WA 5JDHA 3AEBA 2E9XD 3L39A 4P3NA 4E51A 4EXTA 4J2CA 4TVYA 3UU8A 3IHRA 1XNQT 3N9OA 3TLTA 1WYBA 4U7YA 4JI4T 4DV3T 4QKNA 2ZZGA 2EJ9A 2LKHA 5C2TA 1IJ6A 5AQKB 2N2NA 3J9X1 4WF2A 1B70B 2CHNA 2IAKA 1WNLA 3ZC0A 2LEHA 2QVAA 1E1HB 2ZZFA 4TX5A 3PV0F 5E0OA 3AE1A 1D0XA 1HXDA 3IA3A 3TEGA 3AVSA 4P75A 1D0YA 4A56A 2E8IA 2RHQB 5FNVE 2XAQB 2DKGA 2X9XA 2Q7GA 3HRKA 2EL9A 1WU7A 2I4OA 3V5UA 4YXDA 4YCUA 3O1HA 4CI1B 3CK6A 5AQNB 3TLVA 2P0LA 2XAFB 4UP9A 3VQYA 3RX6A 2F4VT 3AB3B 1I6ZA 4PJMA 1EIYA 2CLYB 4ILAA 3DTOA 5AQVB 5HCJA 3KDSE 1SERA 2OV9A 4DQ2A 3UUBA 4DUZT 3FB2A 2MAWA 2NOXA 3ZLIA 3MQZA 1WR0A 3HFZA 4H9RC 1IBLT 2QHUA 1Z8UA 3AE7A 3LG7A 2ZM6T 3F31A 3BJUA 4TN7B 1B8AA 4YRLA 4ZOLE 3GN5A 3F2EA 2XQ6A 1E7PA 5DABA 4QX7B 3UUXB 2EHOC 4TWDA 1BBUA 2VL0A 4F8HA 3DP7A 1BR1A 1LKXA 1HF8A 3RYHE 2V5DA 2XAGB 2BS3A 2JQQA 3Q5DA 5HXCA 3VQVA 5DJQC 1E1TA 4H9OC 2FUPA 2LHRA 2CIMA 1D1CA 3ZCIA 3FBLA 3L8RA 2BBHA 3UULA 2X9WA 2HH7A 2VKDA 2XY8B 5L3BB 5FXVA 2AE9A 3RPUA 2EHOD 2WQYA 2AKWB 4PAGA 2DU5A 1N9WA 3UH0A 2HPJA 2PJQA 4H2VA 3AE6A 4MFRA 4UF0A 4RMFA 4YSYA 1VOMA 2D5UA 4YTNA 3ZKRA 1QSDA 1JJCB 3CQGB 3P8CD 5IWAT 3CMQA 2RA1A 4BW9A 5GONE 4DPGA 2H7OA 4ZIBA 5JDGA 2XM1A 1E2AA 2CM0A 2CA5A 3CQXC 4HEAA 2X66A 4ILBA 1PYSB 4XTWA 1WYCA 2KWIB 1W0BA 4TNWA 4KI0F 2LE8A 2VK9A 2WSSV 1KFYA 1AJ3A 3B13A 3ZJ1A 4KQEA 5J2TE 1X54A 3AA6B 2UXCT 2H89A 5E3IA 3N5LA 3KFUA 4UR9A 1NJ6A 3FXDB 1KNZA 2L3LA 3VQWA 2V6XA 2WDVA 2FJDA 1MIYA 4PNIA 1LVFA 5DQVA 4ASKA 4YRFA 3AE4A 4DBQA 2VVSA 3GMIA 2NW8A 2DWGA 3CKDA 2ZTGA 4X20E 4EYYR 4UELA 2VKHA 2MYSA 1UCUA 4EO4A 3LK42 3LFMA 2WWVA 2ZIMA 4GIWA 2LKGA 2HHHT 3A5YA 3A7UA 4H2UA 4WBNE 2E9XB 3OD1A 2QHVA 3UQ4A 1IBMT 3RF1A 3UT5E 2R6GF 4CXWA 5FL1A 4CXXA 4IE0A 2YINA 3P50A 4L0RA 2LSJA 1UUSA 3V8JA 5HXEA 3RGLA 4QH1A 4XAXB 5LG4A 3C64A 1U4QA 3LC0A 5K1PA 2GK9A 4TVWA 3ZN1B 2ALYA 2W00A 2N1GA 3AAIA 1WR6A 1BR2A 3RC8A 2FYKA 5AQHB 5LXTE 1YB3A 3NVOA 2X68A 4RQFA 4YHJA 3QO8A 1MIWA 3AE2A 4NCXA 3O1JA 3RQUA 5AQPB 2RP4A 4RDXA 2CJ9A 5JR9C 5CB4E 2M6IA 4NUVA 4O4HE 3HKCE 5LJMA 4DV6T 4LVLA 4LMJA 3N9QA 4V1Av 2VQFT 4H02A 3E08A 4H63H 3VR8A 4DV0T 1X2GA 2VKJA 2BG9A 4IDZA 4A5XA 4IGUA 1MMNA 2C5KT 4C91A 2DEQA 1EOVA 1ASZA 4COFA 3KVBA 5ELOA 3PUVF 4HWIB 4EYUA 3EUHA 3N9NA 3NEMA 4YFSA 4OK0A 2BG9E 5LGNB 5CA0E 3RIAA 3ONJA 4DBRA 1HG2A 2G0UA 1JNRA 4JEHB 5AQGB 2X9YA 2YN6A 3HXZA 2UXXB 5LP6E 3HY0A 4WI1A 4KP3C 3PUWF 5LHGB 1J5WA 4AQFA 5HXSA 3SS1A 3W15B 1E1OA 4CN1A 3QOFA 2Q9QA 1UX5A 4AQYT 2ZT8A 1YD8G 3I0OA 4I4TE 3AE9A 3RQWA 5HAXA 2JQ9A 1SA0E 2MTQA 4WJ4A 5J0ZA 4AKGA 3ETUA 2EHOB 4IIJE 3A7AA 3VRBA 3HY1A 2ARSA 2ACXA 1WQWA 2LRKA 3ZCJA 3FZLB 2ACZA 2K9AA 3L09A 2DDZA 4DMWA 2WBLA 1FMWA 3Q9DA 1HTTA 2P5IA 4HFCA 4HWSA 2WU5A 3RIUA 3ZEFB 4LVIA 3PU8A 3O4XE 4ERRA 4UIGA 1ZEEA 2ZNJA 4CS4A 4CN6A 4IE4A 1MMDA 4NXMT 4MALA 1H4QA 1E22A 3M65A 4DUYT 3VRAA 5L3CB 2CCQA 2JJ9A 1X55A 5H6RB 3TKLB 3ZMSB 2V6YA 4WYVA 3RACA 2W2UA 2X0LB 2ZZEA 1NJ2A 4XEMA 3BQKA 5F8PA 3QNEA 2VB6A 2XQAA 4DR2T 2V1DB 5KMGP 4YRJA 2NS6A 4EX5A 2XQ9A 2VWAA 2EJFA 1I94T 4K0UA 4F6RC 1KK7A 4H2SA 2NR4A 3PUAA 1XDOA 2ODRC 3P8YA 4P75C 5AFUL 3N2OA 4P0BA 2DNXA 4AKRB 2NTXA 2V7IA 4JUYA 5LGUB 3LSVA 2DLRA 1UX4A 2Q5IA 4KR2A 3L1AA 1UGOA 3E9IA 3C50A 5AQUB 5FXWA 3G06A 2KWHA 2WDQA 3A7MA 2WM9A 4YLHA 4HWHA 2K48A 3NZPA 4HWDA 4ZXLA 2PMEA 2J1DG 2ODRD 3FZFB 5L3FB 2J3MA 4HWOA 4U2YA 3PUSA 2VURA 1N32T 3OTOT 1OXZA 5AQTB 1M7KA 2WU2A 2E1HA 4UP8A 4G2AA 1D1BA 3HKEE 4DV4T 3R6NA 4IDOA 4TTVA 4WZXA 3C4XA 1D1AA 5LB7B 3P4RA 1BR0A 2A72A 2XSAA 5LBQB 3Q5EA 2Q7EA 5JRCB 4IDPA 3C4ZA 4GOUA 4WBOA 1FJGT 2M6BA 2BKOA 3AXJA 2IIUA 1MMGA 5L4EA 5HCMA 2QHTA 1KNPA 2XQYA 4YRRA 2CWYA 3C4WA 3ZMUB 4EZ4A 5JR9B 4XEOA 4QHOA 4UV9B 3O9XA 4PJNA 1X9BA 3AECA 4QX8B 4TZ4C 4PJLA 1BIBA 4PK5A 4ZI7E 1KNRA 4H9PC 2HN1A 4X62T 3LSSA 1S94A 3L3PA 2NTYA 3K8PC 4B3RT 4FJOA 4O8SA 5TAOA 4LNSA 1MNEA 4DV1T 1Y64B 4JEUB 5FYMA 4HFIA 4UVCB 2DJZA 2JQKA 1H4SA 2EWNA 5FMNA 5HEGA 4TWHA 2AMCB 4DV2T 3PUYF 2ZT6A 3KFWX 3LSQA 4YPFA 5FXXA 3PURA 3TEHA 4KUMB 4AIUA 3RKYA 1HTJF 1OEDA 1T8BA 3VR9A 3EHZA 3MJXA 3SRZA 3VBBA 1NJ5A 2DZCA 4AKLA 2PTFA 2C8MA 2MBGA 5ABFB 3OYZA 4P1NA 3VKHA 5HEJA 2IDOB 2ZLYA 2VQET 3N9MA 4XTVA 12ASA 1OEDE 3CWZB 2MPKA 4LF7T 2JMHA 4PG3A 4CH6A 1HG5A 1JNZA 4WJ3M 4NXNT 5DQWA 4I0UA 5FY1A 2Q5HA 3EFSA 5AQQB 2BVLA 3H3AA 5HXRA 2AXDS 1GQEA 4LF6T 1KMMA 1YKHB 4CH5A 1VRBA 3BFMA 1ADJA 4YDQA 4M1PA 3CIRA 3CPZA 3P4PA 2DTIA 3H37A 3HFVA 3P8TA 3HI2A 5FY7A 2G4CA 2K3WA 3REXA 3RI5A 4CQIA 3UFEA 3QB5K 2CMRA 4XU3A 3RYFE 5CFBA 3L4GA 2CXFA 5JVDE 2ES0A 4Z91A 2CBJA 2FJAA 5FY0A 4HWRA 3IKLA 4OYKA 4X1YE 4HTEA 3U3IA 3ZT6A 2ARTA 4I50E 4ZZBA 1V9DA 5HWXA 4IDNA 5IUXA 4TWFA 2C7IA 5K1XA 3ONXA 3HXXA 5FL0A 1FEWA 4YRTA 3PJAJ 4U74A 4XZCA 11ASA 1U5PA 2Y8DA 4HKAA 5H6QB 1EZ3A 2LOSA 3OYXA 2DXUA 2YDRA 2BG9C 4DR3T 2ZCEA 4Q6GA 1XMQT 4O4IE 3TLWA 5JDLA 3MK7C 3M3ZB 3HA4A 4UV8B 3WAJA 4B6XA 1HC7A 5EK3A 1KOGA 5HYAA 4IL9A 2NP9A 1XNRT 1EQRA 1X56A 2PBIA 2VKOA 4B3ST 5EZYE 4L5GA 2X9HA 1WFDA 4HFBA 3A7RA 1GGMA 4ISTA 1N34T 1EIYB 2V7LA 2XAJB 5L3DB 1B7YA 2HPLA 4TQFA 5AQLB 4AQFC 4U31A 1W0AA 2B76A 3ZMTB 3AE3A 4C90A 3HFZB 2Q9QC 4CI2B 1M62A 2Y48B 4DR1T 3ABVA 2I6HA 2V7KA 1SETA 4LVJA 5LOVE 3S4UA 1HX1B 2LM9A 3HL6A 3GN5B 5L47A 2I4NA 1T98A 4TV8E 1QF6A 4JI8T 4PFPA 4HT4A 3BQIA 4CN4A 3RLFF 2Q9QD 5FVKA 2KLQA 3PUGA 2W62A 3L2ZA 2CJAA 4HN9A 2LLYA 2IW5B 1USYA 4P72A 2C0SA 3UU4A 2FJBA 4ADZA 2UU9T 3I0QA 3T1YT 5HWYA 5JQGE 4G63A 1NAFA 3CX6B 3EAMA 2XZEA 3MKDA 3RIUC 2QA7A 4UF0B 3VQXA 4O2AE 4EAHA 4LF9T 4H9QC 4HGAA 4XU2A 1H7CA 2XAHB 2E41A 4IE5A 4O2BE 2K5BB 4UEMA 2ZR3A 4L9IA 4PFOA 5JH7E 3E0ZA 2RHSA 3P4WA 3ZPOA 3ESLA 3DJBA 1Z7MA 2Y6XA 3C98B 4HWFA 3HXVA 3ZC1A 3PUXF 2ODVA 3ZN0B 3GA8A 1YQ4A 4OFZA 4HFDA 4JI5T 4EOZB 1IBKT 2CJBA 1FYFA 5JDQA 2NW7A 3LBXA 5FP3A 4IHJE 3A31A 3UUMA 2WP9A 2ZR2A 4DNDA 1HS7A 1WYDA 5JDNA 3K3QC 4MHCA 3O1IA 3PUZF 4HWCA 2DVEA 3ANWA 2UXNB 3NRXA 2VVNA 1Y01A 4O4LE 4O4JE 5KXJA 3CMLA 2XQ3A 4Z90A 2V8SV 5M4YA 3R07A 4KHZF 3IF8B 2KT9A 3J7Yq 4P09A 5LA6E 3PCOA 3FZKB 1YXRA 3ZYMA 3AAEB 1L0VA 4ZI2C 2M67A 1T7SA 2ZMAA 5KNNA 3UGQA 4KHPT 4ISSA 3V5SA 5J1GA 2BDEA 1NEKA 3GWHA 2A3DA 3P4SA 1YQ3A 1ASYA 2NW9A 4YY3T 3NENA 3PDYA 3TLUA 1W09A 3QTCA 2ALYB 4ZI2D 3V8KA 2IC9A 3QK6A 2WS3A 4DIDB 3MXZA 1MMAA 2UUAT 3RRWA 4AKIA 2JMKA 2DTHA 5C53B 3RH3A 4AXPA 2W4XA 1OWAA 2LRLA 4ZS3A 4H2YA 3TLSA 4XU1A 2CBIA 5JREA 3VHLA 3EVYA 3B57A 2W67A 1WLEA 3U78A 2WMOA 2XTLA 1NJ1A 3PZCA 2DZ9A 3IBPA 3SOLA 4JI1T 2A8EA 4YSXA 4YRGA 4YCVA 4KR3A 2NWBA 3OJAA 1B76A 2BG9B 3C51A 3AVRA 2H3RA 4UVAB 2JQHA 1NYRA 1KMNA 4PW8A 2LM2A 3QO5A 2XPKA 4CS3A 2RHQA 2UXBT 3QC9A 4I55E 2JRKA 2W66A 4ILCA 4K87A 1QLBA 2RPAA 4BAYB 1CUNA 3CX7B 3UFGA 4ZZCA 2YEVC 1NENA 2DQ3A 4PJJA 2H88A 5LNKA 4P3PA 3LBXB 3OBVE 4X1IE 3RIRA 1NNHA 4OP0A 3AE5A 4YCWA 2CEAA 1YFSA 1OEDC 1VCTA 2Q9QB 3KBUA 5AQMB 3FZHB 3AE8A 2DXTA 2E5VA 3CVRA 3ETVA 2HN2A 3VKGA 1NJ8A 3NBXX 4IL4A 1YGBA 4HFEA 2PG8A 4CI3B 4CZZB 5J2UE 1LRZA 2E3CA 5LG3A 4H2TA 5CA1E 2XUEA 3PUQA 2C5JA 4P0AA 3JAFA 2E10A 1IJ5A 4IE7A 4GK0E 2J62A 4X5TA 2VL8A 4K86A 4AISA 4YREA 3UQ7A 2E2AA 4LMLA 3RIFA 3RYCE 2XQ7A 3BK9A 5L4HA 4TUYE 3Q5XA 1XMOT 3KVAA 2N9DA 2WZIA 3A74A 5C52B 2YU2A 4P73A 1FMVA 4BJMA 5LMUT
chains in the Genus database with same CATH topology
2FYKA 2AKWA 1YB3A 2E65A 2ZGWA 1EFWA 4P73C 2CGHA 3QO7A 4HWRA 3QO8A 4RQFA 1ATIA 3ICAA 2ZT5A 3IKLA 4NCXA 4RDXA 2CJ9A 2ARTA 1B70A 3A32A 4YRIA 3V7CA 1JJCA 4LVLA 3NELA 4P3OA 2C7IA 5K1XA 4CH4A 4H02A 3HXXA 4L87A 4UPAA 2HNIA 2RHSB 4YRTA 1X2GA 4P74A 2I4LA 11ASA 4BWAA 2DEQA 1EOVA 2DXUA 1E24A 3A5ZA 5C51B 1ASZA 4XTZA 1PYSA 3HXWA 2ZCEA 4P74C 4Q6GA 5ELOA 2AMCA 1H4VB 3NEMA 3REUA 3FJPA 4CS2A 2J3LA 1HC7A 4XTYA 3M4PA 2PMFA 2ZT7A 3DSQA 1KOGA 3UGTA 4RQEA 3MEYA 3HXZA 1YFTA 1EQRA 1X56A 3HY0A 3V7SA 4WI1A 4G84A 4PHCA 4K88A 1J5WA 1WPYA 3A7RA 1G5HA 1GGMA 2XGTA 1EIYB 1E1OA 4XU0A 1B7YA 2ZT8A 4TQFA 4P71A 3HFZB 4G85A 3PCOB 4P71C 4LVMA 4WJ4A 4YRQA 1SETA 4LVJA 4HWPA 3I7FA 4X5OA 2I4NA 3HXUA 1QF6A 2E5AA 3A7AA 4HT4A 3W3SA 3IKMB 1YFRA 2ZINA 1C0AA 4H2XA 3HY1A 5HGQA 2ARSA 1WQWA 3EFRA 3V7RA 1EVKA 4YRCA 3L2ZA 2CJAA 3E9HA 1USYA 3HRIA 4UP7A 2DDZA 4P72A 2DU7A 1VQZA 1HTTA 4HWTA 4YYEA 2P5IA 1USYC 5F5WA 4HWSA 4P72C 1W66A 4LVIA 4P3NA 4E51A 4TVYA 2ZNJA 4CS4A 3VQXA 1H4QA 4XU2A 1E22A 2E41A 2ZXFA 3V8LA 2ZZGA 2EJ9A 1X55A 4YRMA 2ZR3A 4WF2A 1EVLA 1B70B 1X01A 3RACA 3MF1A 1WNLA 2RHSA 3MF2A 2ZZFA 2ZZEA 1NJ2A 1Z7MA 4XEMA 3QNEA 3HXYA 1HXDA 3HXVA 4YRJA 3TEGA 2NS6A 4P75A 4EX5A 2EJFA 2RHQB 4H2SA 2DKGA 2Q7GA 3HRKA 1H4TA 2EL9A 2ODRC 3P8YA 4P75C 1WU7A 2I4OA 3NETA 2CJBA 4YCUA 1FYFA 2DQ0A 3RL6A 3A31A 3TEHB 1G51A 2ZR2A 2P0LA 1WYDA 1X2HA 3IG2A 4UP9A 2QHSA 2Q5IA 4KR2A 3L1AA 3E9IA 2DVEA 3VQYA 3P8VA 2IY5A 1EIYA 2EJGA 2PMEA 1SERA 4DQ2A 4TVAA 2ODRD 3MQZA 3R07A 3HFZA 2J3MA 4HWOA 2QHUA 4HVCA 2E64A 3PCOA 3HTZA 3BJUA 2E1HA 1B8AA 4UP8A 4Q15A 4YRLA 3WQZA 3G1ZA 5KNNA 4TTVA 3UGQA 1BBUA 4TWAA 4CH3A 2ZNIA 1IL2A 4J15A 2DTOA 4H2XB 1ASYA 2I4MA 2Q7EA 3VQVA 1E1TA 3M4QA 3NENA 4H2WA 2CIMA 1BIAA 3QTCA 3RKXA 2ALYB 4AH6A 3L4GB 3V8KA 2QHTA 4XTUA 2DTHA 2EAYA 5C53B 2XTIA 2AKWB 4YRRA 2DU5A 4H2YA 1N9WA 3UH0A 4XU1A 4XEOA 4YRPA 4H2VA 4RMFA 1SESA 1BIBA 1L0WA 1WLEA 3LSSA 1JJCB 1NJ1A 3PZCA 2DZ9A 2A8EA 3CMQA 4BW9A 4YRGA 2ARUA 4YCVA 4KR3A 1B76A 4DPGA 4LNSA 4ZIBA 1NYRA 3RUXA 1KMNA 1WQ7A 1PYSB 3QO5A 4XTWA 2DJZA 1H4SA 4CS3A 2EWNA 2RHQA 1Z7NA 2AMCB 4K87A 4KQEA 3UFGA 2ZT6A 3LSQA 4YPFA 1X54A 4TQDA 1G5IA 2DQ3A 3TEHA 1RIQA 4P3PA 5E3IA 3RKYA 4O2DA 3KFUA 1NJ6A 3RKWA 3RIRA 1NNHA 4OP0A 3VQWA 3IALA 4YCWA 4YRKA 3VBBA 1NJ5A 1YFSA 2DZCA 4YRFA 4XTXA 2C8MA 1B7YB 4YROA 2IY5B 2DXTA 4LVKA 2ZTGA 4XTVA 1NJ8A 12ASA 4HA8A 1YGBA 4TVAB 4EO4A 2ZIMA 4ZTZB 4PG3A 3A5YA 5ELNA 2E3CA 3A7UA 4H2UA 3ERRA 4H2TA 1ADYA 3OD1A 2QHVA 4CH6A 1NYQA 4WJ3M 3TUPA 3RF1A 2E10A 1QE0A 2Q5HA 3EFSA 4YRNA 4K86A 1KMMA 4YREA 4CH5A 3BFMA 1ADJA 4YDQA 1BBWA 1LYLA 4OLFA 1SRYA 2Q7HA 2DTIA 3V8JA 3HFVA 3RGLA 3P8TA 2ZIOA 2G4CA 3REXA 4ZTUB 3LC0A 5K1PA 4YRSA 4YP0A 3A74A 4TVWA 4XU3A 5C52B 2ALYA 3L4GA 4P73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYK A;  2AKW A;  1YB3 A;  2E65 A;  2ZGW A;  1EFW A;  4P73 C;  2CGH A;  3QO7 A;  4HWR A;  3QO8 A;  4RQF A;  1ATI A;  3ICA A;  2ZT5 A;  3IKL A;  4NCX A;  4RDX A;  2CJ9 A;  2ART A;  1B70 A;  3A32 A;  4YRI A;  3V7C A;  1JJC A;  3NEL A;  4P3O A;  2C7I A;  5K1X A;  4CH4 A;  4H02 A;  3HXX A;  4L87 A;  4UPA A;  2HNI A;  2RHS B;  4YRT A;  1X2G A;  4P74 A;  2I4L A;  11AS A;  4BWA A;  2DEQ A;  1EOV A;  2DXU A;  1E24 A;  3A5Z A;  5C51 B;  1ASZ A;  4XTZ A;  1PYS A;  3HXW A;  2ZCE A;  4P74 C;  4Q6G A;  5ELO A;  2AMC A;  1H4V B;  3NEM A;  3REU A;  3FJP A;  4CS2 A;  2J3L A;  1HC7 A;  4XTY A;  3M4P A;  2PMF A;  2ZT7 A;  3DSQ A;  1KOG A;  3UGT A;  4RQE A;  3MEY A;  3HXZ A;  1YFT A;  1EQR A;  1X56 A;  3HY0 A;  3V7S A;  4WI1 A;  4G84 A;  4PHC A;  4K88 A;  1J5W A;  1WPY A;  3A7R A;  1G5H A;  1GGM A;  2XGT A;  1EIY B;  1E1O A;  4XU0 A;  1B7Y A;  2ZT8 A;  4TQF A;  4P71 A;  3HFZ B;  4G85 A;  3PCO B;  4P71 C;  4WJ4 A;  4YRQ A;  1SET A;  4HWP A;  3I7F A;  4X5O A;  2I4N A;  3HXU A;  1QF6 A;  2E5A A;  3A7A A;  3W3S A;  3IKM B;  1YFR A;  2ZIN A;  1C0A A;  4H2X A;  3HY1 A;  5HGQ A;  2ARS A;  1WQW A;  3EFR A;  3V7R A;  1EVK A;  4YRC A;  3L2Z A;  2CJA A;  3E9H A;  1USY A;  3HRI A;  4UP7 A;  2DDZ A;  4P72 A;  2DU7 A;  1VQZ A;  1HTT A;  4HWT A;  4YYE A;  2P5I A;  1USY C;  5F5W A;  4HWS A;  4P72 C;  1W66 A;  4P3N A;  4E51 A;  4TVY A;  2ZNJ A;  4CS4 A;  3VQX A;  1H4Q A;  4XU2 A;  1E22 A;  2E41 A;  2ZXF A;  3V8L A;  2ZZG A;  2EJ9 A;  1X55 A;  4YRM A;  2ZR3 A;  4WF2 A;  1EVL A;  1B70 B;  1X01 A;  3RAC A;  3MF1 A;  1WNL A;  2RHS A;  3MF2 A;  2ZZF A;  2ZZE A;  1NJ2 A;  1Z7M A;  4XEM A;  3QNE A;  3HXY A;  1HXD A;  3HXV A;  4YRJ A;  3TEG A;  4P75 A;  4EX5 A;  2EJF A;  2RHQ B;  4H2S A;  2DKG A;  2Q7G A;  3HRK A;  1H4T A;  2EL9 A;  2ODR C;  3P8Y A;  4P75 C;  1WU7 A;  2I4O A;  3NET A;  2CJB A;  4YCU A;  1FYF A;  2DQ0 A;  3RL6 A;  3A31 A;  3TEH B;  1G51 A;  2ZR2 A;  2P0L A;  1WYD A;  1X2H A;  3IG2 A;  4UP9 A;  2QHS A;  2Q5I A;  4KR2 A;  3L1A A;  3E9I A;  2DVE A;  3VQY A;  3P8V A;  2IY5 A;  1EIY A;  2EJG A;  2PME A;  1SER A;  4DQ2 A;  4TVA A;  2ODR D;  3R07 A;  3HFZ A;  2J3M A;  4HWO A;  2QHU A;  4HVC A;  2E64 A;  3PCO A;  3HTZ A;  3BJU A;  2E1H A;  1B8A A;  4UP8 A;  4Q15 A;  4YRL A;  3WQZ A;  3G1Z A;  5KNN A;  4TTV A;  3UGQ A;  1BBU A;  4TWA A;  4CH3 A;  2ZNI A;  1IL2 A;  4J15 A;  2DTO A;  4H2X B;  1ASY A;  2I4M A;  2Q7E A;  3VQV A;  1E1T A;  3M4Q A;  3NEN A;  4H2W A;  2CIM A;  1BIA A;  3QTC A;  3RKX A;  2ALY B;  4AH6 A;  3L4G B;  3V8K A;  2QHT A;  4XTU A;  2DTH A;  2EAY A;  5C53 B;  2XTI A;  2AKW B;  4YRR A;  2DU5 A;  4H2Y A;  1N9W A;  3UH0 A;  4XU1 A;  4XEO A;  4YRP A;  4H2V A;  4RMF A;  1SES A;  1BIB A;  1L0W A;  1WLE A;  3LSS A;  1JJC B;  1NJ1 A;  3PZC A;  2DZ9 A;  3CMQ A;  4BW9 A;  4YRG A;  2ARU A;  4YCV A;  4KR3 A;  1B76 A;  4DPG A;  4LNS A;  4ZIB A;  1NYR A;  3RUX A;  1KMN A;  1WQ7 A;  1PYS B;  3QO5 A;  4XTW A;  2DJZ A;  1H4S A;  4CS3 A;  2EWN A;  2RHQ A;  1Z7N A;  2AMC B;  4K87 A;  4KQE A;  3UFG A;  2ZT6 A;  3LSQ A;  4YPF A;  1X54 A;  4TQD A;  1G5I A;  2DQ3 A;  3TEH A;  1RIQ A;  4P3P A;  5E3I A;  3RKY A;  4O2D A;  3KFU A;  1NJ6 A;  3RKW A;  3RIR A;  1NNH A;  4OP0 A;  3VQW A;  3IAL A;  4YCW A;  4YRK A;  3VBB A;  1NJ5 A;  1YFS A;  2DZC A;  4YRF A;  4XTX A;  2C8M A;  1B7Y B;  4YRO A;  2IY5 B;  2DXT A;  2ZTG A;  4XTV A;  1NJ8 A;  12AS A;  4HA8 A;  1YGB A;  4TVA B;  4EO4 A;  2ZIM A;  4ZTZ B;  4PG3 A;  3A5Y A;  5ELN A;  2E3C A;  3A7U A;  4H2U A;  3ERR A;  4H2T A;  1ADY A;  3OD1 A;  2QHV A;  4CH6 A;  1NYQ A;  4WJ3 M;  3TUP A;  3RF1 A;  2E10 A;  1QE0 A;  2Q5H A;  3EFS A;  4YRN A;  4K86 A;  1KMM A;  4YRE A;  4CH5 A;  3BFM A;  1ADJ A;  4YDQ A;  1BBW A;  1LYL A;  4OLF A;  1SRY A;  2Q7H A;  2DTI A;  3V8J A;  3HFV A;  3RGL A;  3P8T A;  2ZIO A;  2G4C A;  3REX A;  4ZTU B;  3LC0 A;  5K1P A;  4YRS A;  4YP0 A;  3A74 A;  4TVW A;  4XU3 A;  5C52 B;  2ALY A;  3L4G A;  4P73 A; 
#chains in the Genus database with same CATH topology
 4GYR A;  4KX6 A;  3RYI E;  2AKW A;  3JAE A;  2ZGW A;  1EFW A;  3QO7 A;  3JAD A;  2XJ7 A;  3RC3 A;  1ATI A;  3ICA A;  4QWN B;  3N9P A;  3KV6 A;  2DL1 A;  3V7C A;  4LFC T;  1YKE B;  3Q5W A;  1JJC A;  2V6Y B;  3NEL A;  4P3O A;  5C3J A;  2X0H A;  4QH4 A;  4X66 T;  4CH4 A;  4L87 A;  3AEE A;  3RKO A;  4U7I A;  2HNI A;  4XBF B;  4BA9 A;  2KXP B;  1QUU A;  4P74 A;  2I4L A;  4BWA A;  3PJA A;  1G8X A;  4WW0 A;  3AAA B;  3K3O A;  1PYS A;  5LCY A;  3HXW A;  4YT0 A;  2V7J A;  3H3M A;  1IZN B;  2V7M A;  5HEH A;  2I59 A;  3NZQ A;  3RKG A;  3FJP A;  4WNK A;  3REU A;  4CS2 A;  4GK5 E;  2L8K A;  2J3L A;  4ZI3 C;  3AEA A;  3M4P A;  2XQ4 A;  4EB6 E;  3MEY A;  3X1D A;  4U33 A;  4K0K T;  1KEY A;  4PHC A;  1DU2 A;  3HKB E;  2QYW A;  2V5C A;  5FVL A;  1G5H A;  4B3T T;  4XU0 A;  3EAB A;  1XZY A;  5LBM A;  1FIO A;  4A97 A;  3FXE B;  5AQS B;  3ZST A;  4P71 A;  2XHE B;  4X65 T;  3PU3 A;  4NPP A;  4G85 A;  4ZI3 D;  3KV4 A;  2UXD T;  2WZH A;  3B5M A;  4LF8 T;  4HWP A;  2VAS A;  2D0U A;  3LJC A;  2XM2 A;  2E9X A;  2P9B A;  1WLX A;  3N2G E;  3HXU A;  3CQC B;  4HE8 A;  2E5A A;  4ILU A;  4QXC B;  3N2K E;  3IKM B;  3NKZ A;  1HNX T;  1YFR A;  3ONL C;  4H2X A;  3AEG A;  5HGQ A;  4AI6 A;  4DR7 T;  5L3E B;  4JI7 T;  1EVK A;  4YRC A;  5EK2 A;  5ETW A;  4YJ3 E;  2IML A;  2WMN A;  3E9H A;  3HRI A;  2DU7 A;  3I9Y A;  2LOP A;  1N33 T;  1VQZ A;  2E5L T;  4UVB B;  2BKP A;  3AXJ B;  2I0M A;  4HWT A;  1USY C;  4IT4 A;  4P72 C;  5JDF A;  3I1A A;  1W66 A;  3KV9 A;  1J5E T;  2H7V C;  3KV5 A;  3NWI A;  2BBJ A;  4LF5 T;  3CX8 B;  5F3J A;  3ZJ2 A;  3JCF A;  2WY2 A;  2ODU A;  2ZXF A;  3OPC A;  3V8L A;  4E7Z A;  4TV9 E;  2CPT A;  2CXD A;  3LK2 B;  2D2S A;  3R84 B;  2WAU A;  4YRM A;  3RHW A;  1MND A;  1EVL A;  2JIW A;  1X01 A;  4QXB B;  3PE0 A;  3MF1 A;  3IEE A;  2YDS A;  3MF2 A;  4JI0 T;  3HXY A;  3E22 E;  4DVD A;  4QH5 A;  2Z6E A;  4JI3 T;  4UXN B;  2WWU A;  2LJL A;  5AQF B;  4IE6 A;  4JV5 T;  3MAC A;  1H4T A;  4DMV A;  4NUU A;  4LFB T;  2DHR A;  3T8O A;  5LHI B;  3NET A;  1WCR A;  4EED A;  2DQ0 A;  3RL6 A;  3ZMZ B;  4JBW F;  3TEH B;  4ZS2 A;  5JTG A;  1G51 A;  2QRX A;  1X2H A;  3IG2 A;  3I9W A;  3UU6 A;  2QHS A;  1OED B;  2XSB A;  4LF4 T;  3F57 A;  2LSI A;  5IYZ E;  4EZH A;  3P8V A;  5ABG A;  2IY5 A;  2EJG A;  4DR6 T;  2UUB T;  4TVA A;  1XDP A;  3MA9 A;  5HXH A;  3ZYK A;  2IUB A;  3AA1 B;  4HFH A;  4HVC A;  4PK4 A;  5FKY A;  2E64 A;  3WAK A;  3HTZ A;  5JDM A;  3SWH A;  1W9R A;  3VU7 H;  5L3G B;  1O3X A;  2UUC T;  4DV7 T;  2KZ7 B;  4Q15 A;  5HEO A;  4AKH A;  2EHO A;  2LSY A;  3WQZ A;  3G1Z A;  4LFA T;  2BKN A;  1Z0P A;  1YW0 A;  2J47 A;  4ZEY A;  2ZM2 A;  2C5I T;  1NWM X;  5L2L A;  3RRC A;  4ZHQ E;  4TWA A;  2CE7 A;  4CH3 A;  2ZNI A;  3KBT A;  1IL2 A;  5LGT B;  4J15 A;  2DTO A;  4H2X B;  5LMN T;  2I4M A;  5BMV E;  3ZMV B;  3M4Q A;  4NIQ A;  3ZT7 A;  3T1H T;  4H2W A;  2KND A;  2DWK A;  3EDU A;  4MBQ A;  1BIA A;  4U3C A;  2FBW A;  5EK4 A;  4B3M T;  3RKX A;  4AH6 A;  3L4G B;  1S35 A;  1ZV4 X;  3QNU A;  4XTU A;  2KIN B;  2EAY A;  2XTI A;  1VCS A;  3ZYL A;  5AQI B;  4YRP A;  2BZB A;  4EEB A;  4IDQ A;  4DR4 T;  1WRD A;  1SES A;  5LHH B;  1L0W A;  2CWO A;  3EI0 A;  4EIW A;  2KSR A;  1UK5 A;  3LK3 B;  4H9S E;  2X51 A;  2ARU A;  2W61 A;  3KIN B;  1N36 T;  4QXH B;  5ADX L;  3RUX A;  5ABH A;  1WQ7 A;  1HX8 A;  4JYA T;  1Z7N A;  3NRY A;  3ZSS A;  3Q2M A;  5ABE A;  4TQD A;  3OKQ A;  5CGM A;  4EGW A;  1G5I A;  5KX5 E;  3P7I A;  4DO0 A;  3PTR B;  1RIQ A;  4O2D A;  2BS4 A;  3ZT5 A;  4H9N C;  2YKS A;  3RKW A;  2XQ8 A;  1LVK A;  3FBZ A;  3UTK A;  3UUN A;  4LMK A;  2ZM8 A;  3IAL A;  2W0G A;  4YRK A;  4OHF A;  1SE7 A;  2YK0 A;  4XTX A;  1XWM A;  1B7Y B;  2A9U A;  4YRO A;  2IY5 B;  2XAS B;  1CHU A;  2LT3 A;  5HEU A;  1BR4 A;  3A8Y C;  4LVK A;  4E7S A;  4YSZ A;  1HNZ T;  4U72 A;  4N78 D;  4HA8 A;  1ZP0 A;  2CLY C;  3AA7 B;  4TVA B;  5CJ5 A;  4FI5 A;  3K3N A;  4ZTZ B;  2W63 A;  3WI3 A;  1IAP A;  5ELN A;  5KDM C;  4TNV A;  3ERR A;  4H63 V;  4JLE A;  1ADY A;  4PK6 A;  4AQG A;  3A5X A;  5AQR B;  2LSG A;  1NYQ A;  4JI6 T;  4YJ2 E;  3TUP A;  2BVM A;  1QE0 A;  2YU1 A;  2D0T A;  5LYJ E;  2A2F X;  4YRN A;  4HFV A;  3D0T A;  3QB5 A;  2FJE A;  3UU3 A;  1ZHC A;  4GKJ T;  3N9L A;  5LJN A;  2MOZ A;  1BBW A;  1LYL A;  2WB5 A;  4OLF A;  1SRY A;  2Q7H A;  1B7T A;  4YTP A;  4X1K E;  2V26 A;  1MIV A;  5JRC A;  2ZIO A;  2WDR A;  4ZTU B;  3LDQ B;  4YRS A;  4YP0 A;  2IC6 A;  1HNW T;  4U2Z A;  4OYJ A;  3JC6 C;  4CXY A;  2E65 A;  3AED A;  4P73 C;  2CGH A;  5JR9 A;  1J1J A;  5A1L A;  2SPC A;  1HFA A;  4KMC A;  2ZT5 A;  2KMF A;  1G73 A;  2X0Y A;  1B70 A;  3A32 A;  4YRI A;  2YDQ A;  4DV5 T;  2WCA A;  1R8I A;  1US7 B;  4UPA A;  2RHS B;  3FZM B;  3MZK B;  2YOE A;  2BS2 A;  1SUM B;  5IHY A;  4Q25 A;  2K24 A;  3JC6 D;  1D0Z A;  4EV6 A;  1E24 A;  3A5Z A;  5C51 B;  4XTZ A;  4P74 C;  4YHH T;  4A98 A;  2DI4 A;  2ZM0 A;  2L9Q A;  4OX9 T;  2AMC A;  1H4V B;  4MLK A;  3SFE A;  1SHZ C;  4XTY A;  4X64 T;  1ZOY A;  2PMF A;  2ZT7 A;  3DSQ A;  1KF6 A;  2IHR 1;  3UGT A;  4RQE A;  1T72 A;  2JPF A;  3HR0 A;  4GKK T;  1YFT A;  3V7S A;  4G84 A;  3ANW B;  3SFD A;  4K88 A;  1X79 A;  1WPY A;  3BQL A;  2XGT A;  2CXL A;  2CRB A;  5ABF A;  4Z8X A;  2PFV A;  3AA0 B;  4ANJ A;  4JI2 T;  3EDV A;  4GYS A;  3OVU A;  4I43 B;  4KBM B;  1ZKE A;  3PCO B;  4P71 C;  3HKD E;  4LVM A;  3FHN A;  4YRQ A;  4IRE A;  2J4G A;  5AQO B;  2CHO A;  3I7F A;  4X5O A;  2LSK A;  5C8Y E;  2OA5 A;  1HR0 T;  4BJN A;  2QGS A;  4DR5 T;  2E9X C;  3AEF A;  5BR8 T;  3W3S A;  3K1S A;  2ZIN A;  1C0A A;  2B1E A;  2XQ5 A;  2DCF A;  2D9D A;  3EFR A;  4YTM A;  1HCI A;  3V7R A;  2OLT A;  1UUR A;  3QUJ A;  4UP7 A;  5AQJ B;  2X67 A;  2LHN A;  5FXZ A;  3UU5 A;  4YYE A;  3P4Q A;  5F5W A;  5JDH A;  3AEB A;  2E9X D;  3L39 A;  4P3N A;  4E51 A;  4EXT A;  4J2C A;  4TVY A;  3UU8 A;  3IHR A;  1XNQ T;  3N9O A;  3TLT A;  1WYB A;  4U7Y A;  4JI4 T;  4DV3 T;  4QKN A;  2ZZG A;  2EJ9 A;  2LKH A;  5C2T A;  1IJ6 A;  5AQK B;  2N2N A;  3J9X 1;  4WF2 A;  1B70 B;  2CHN A;  2IAK A;  1WNL A;  3ZC0 A;  2LEH A;  2QVA A;  1E1H B;  2ZZF A;  4TX5 A;  3PV0 F;  5E0O A;  3AE1 A;  1D0X A;  1HXD A;  3IA3 A;  3TEG A;  3AVS A;  4P75 A;  1D0Y A;  4A56 A;  2E8I A;  2RHQ B;  5FNV E;  2XAQ B;  2DKG A;  2X9X A;  2Q7G A;  3HRK A;  2EL9 A;  1WU7 A;  2I4O A;  3V5U A;  4YXD A;  4YCU A;  3O1H A;  4CI1 B;  3CK6 A;  5AQN B;  3TLV A;  2P0L A;  2XAF B;  4UP9 A;  3VQY A;  3RX6 A;  2F4V T;  3AB3 B;  1I6Z A;  4PJM A;  1EIY A;  2CLY B;  4ILA A;  3DTO A;  5AQV B;  5HCJ A;  3KDS E;  1SER A;  2OV9 A;  4DQ2 A;  3UUB A;  4DUZ T;  3FB2 A;  2MAW A;  2NOX A;  3ZLI A;  3MQZ A;  1WR0 A;  3HFZ A;  4H9R C;  1IBL T;  2QHU A;  1Z8U A;  3AE7 A;  3LG7 A;  2ZM6 T;  3F31 A;  3BJU A;  4TN7 B;  1B8A A;  4YRL A;  4ZOL E;  3GN5 A;  3F2E A;  2XQ6 A;  1E7P A;  5DAB A;  4QX7 B;  3UUX B;  2EHO C;  4TWD A;  1BBU A;  2VL0 A;  4F8H A;  3DP7 A;  1BR1 A;  1LKX A;  1HF8 A;  3RYH E;  2V5D A;  2XAG B;  2BS3 A;  2JQQ A;  3Q5D A;  5HXC A;  3VQV A;  5DJQ C;  1E1T A;  4H9O C;  2FUP A;  2LHR A;  2CIM A;  1D1C A;  3ZCI A;  3FBL A;  3L8R A;  2BBH A;  3UUL A;  2X9W A;  2HH7 A;  2VKD A;  2XY8 B;  5L3B B;  5FXV A;  2AE9 A;  3RPU A;  2EHO D;  2WQY A;  2AKW B;  4PAG A;  2DU5 A;  1N9W A;  3UH0 A;  2HPJ A;  2PJQ A;  4H2V A;  3AE6 A;  4MFR A;  4UF0 A;  4RMF A;  4YSY A;  1VOM A;  2D5U A;  4YTN A;  3ZKR A;  1QSD A;  1JJC B;  3CQG B;  3P8C D;  5IWA T;  3CMQ A;  2RA1 A;  4BW9 A;  5GON E;  4DPG A;  2H7O A;  4ZIB A;  5JDG A;  2XM1 A;  1E2A A;  2CM0 A;  2CA5 A;  3CQX C;  4HEA A;  2X66 A;  4ILB A;  1PYS B;  4XTW A;  1WYC A;  2KWI B;  1W0B A;  4TNW A;  4KI0 F;  2LE8 A;  2VK9 A;  2WSS V;  1KFY A;  1AJ3 A;  3B13 A;  3ZJ1 A;  4KQE A;  5J2T E;  1X54 A;  3AA6 B;  2UXC T;  2H89 A;  5E3I A;  3N5L A;  3KFU A;  4UR9 A;  1NJ6 A;  3FXD B;  1KNZ A;  2L3L A;  3VQW A;  2V6X A;  2WDV A;  2FJD A;  1MIY A;  4PNI A;  1LVF A;  5DQV A;  4ASK A;  4YRF A;  3AE4 A;  4DBQ A;  2VVS A;  3GMI A;  2NW8 A;  2DWG A;  3CKD A;  2ZTG A;  4X20 E;  4EYY R;  4UEL A;  2VKH A;  2MYS A;  1UCU A;  4EO4 A;  3LK4 2;  3LFM A;  2WWV A;  2ZIM A;  4GIW A;  2LKG A;  2HHH T;  3A5Y A;  3A7U A;  4H2U A;  4WBN E;  2E9X B;  3OD1 A;  2QHV A;  3UQ4 A;  1IBM T;  3RF1 A;  3UT5 E;  2R6G F;  4CXW A;  5FL1 A;  4CXX A;  4IE0 A;  2YIN A;  3P50 A;  4L0R A;  2LSJ A;  1UUS A;  3V8J A;  5HXE A;  3RGL A;  4QH1 A;  4XAX B;  5LG4 A;  3C64 A;  1U4Q A;  3LC0 A;  5K1P A;  2GK9 A;  4TVW A;  3ZN1 B;  2ALY A;  2W00 A;  2N1G A;  3AAI A;  1WR6 A;  1BR2 A;  3RC8 A;  2FYK A;  5AQH B;  5LXT E;  1YB3 A;  3NVO A;  2X68 A;  4RQF A;  4YHJ A;  3QO8 A;  1MIW A;  3AE2 A;  4NCX A;  3O1J A;  3RQU A;  5AQP B;  2RP4 A;  4RDX A;  2CJ9 A;  5JR9 C;  5CB4 E;  2M6I A;  4NUV A;  4O4H E;  3HKC E;  5LJM A;  4DV6 T;  4LVL A;  4LMJ A;  3N9Q A;  4V1A v;  2VQF T;  4H02 A;  3E08 A;  4H63 H;  3VR8 A;  4DV0 T;  1X2G A;  2VKJ A;  2BG9 A;  4IDZ A;  4A5X A;  4IGU A;  1MMN A;  2C5K T;  4C91 A;  2DEQ A;  1EOV A;  1ASZ A;  4COF A;  3KVB A;  5ELO A;  3PUV F;  4HWI B;  4EYU A;  3EUH A;  3N9N A;  3NEM A;  4YFS A;  4OK0 A;  2BG9 E;  5LGN B;  5CA0 E;  3RIA A;  3ONJ A;  4DBR A;  1HG2 A;  2G0U A;  1JNR A;  4JEH B;  5AQG B;  2X9Y A;  2YN6 A;  3HXZ A;  2UXX B;  5LP6 E;  3HY0 A;  4WI1 A;  4KP3 C;  3PUW F;  5LHG B;  1J5W A;  4AQF A;  5HXS A;  3SS1 A;  3W15 B;  1E1O A;  4CN1 A;  3QOF A;  2Q9Q A;  1UX5 A;  4AQY T;  2ZT8 A;  1YD8 G;  3I0O A;  4I4T E;  3AE9 A;  3RQW A;  5HAX A;  2JQ9 A;  1SA0 E;  2MTQ A;  4WJ4 A;  5J0Z A;  4AKG A;  3ETU A;  2EHO B;  4IIJ E;  3A7A A;  3VRB A;  3HY1 A;  2ARS A;  2ACX A;  1WQW A;  2LRK A;  3ZCJ A;  3FZL B;  2ACZ A;  2K9A A;  3L09 A;  2DDZ A;  4DMW A;  2WBL A;  1FMW A;  3Q9D A;  1HTT A;  2P5I A;  4HFC A;  4HWS A;  2WU5 A;  3RIU A;  3ZEF B;  4LVI A;  3PU8 A;  3O4X E;  4ERR A;  4UIG A;  1ZEE A;  2ZNJ A;  4CS4 A;  4CN6 A;  4IE4 A;  1MMD A;  4NXM T;  4MAL A;  1H4Q A;  1E22 A;  3M65 A;  4DUY T;  3VRA A;  5L3C B;  2CCQ A;  2JJ9 A;  1X55 A;  5H6R B;  3TKL B;  3ZMS B;  2V6Y A;  4WYV A;  3RAC A;  2W2U A;  2X0L B;  2ZZE A;  1NJ2 A;  4XEM A;  3BQK A;  5F8P A;  3QNE A;  2VB6 A;  2XQA A;  4DR2 T;  2V1D B;  5KMG P;  4YRJ A;  2NS6 A;  4EX5 A;  2XQ9 A;  2VWA A;  2EJF A;  1I94 T;  4K0U A;  4F6R C;  1KK7 A;  4H2S A;  2NR4 A;  3PUA A;  1XDO A;  2ODR C;  3P8Y A;  4P75 C;  5AFU L;  3N2O A;  4P0B A;  2DNX A;  4AKR B;  2NTX A;  2V7I A;  4JUY A;  5LGU B;  3LSV A;  2DLR A;  1UX4 A;  2Q5I A;  4KR2 A;  3L1A A;  1UGO A;  3E9I A;  3C50 A;  5AQU B;  5FXW A;  3G06 A;  2KWH A;  2WDQ A;  3A7M A;  2WM9 A;  4YLH A;  4HWH A;  2K48 A;  3NZP A;  4HWD A;  4ZXL A;  2PME A;  2J1D G;  2ODR D;  3FZF B;  5L3F B;  2J3M A;  4HWO A;  4U2Y A;  3PUS A;  2VUR A;  1N32 T;  3OTO T;  1OXZ A;  5AQT B;  1M7K A;  2WU2 A;  2E1H A;  4UP8 A;  4G2A A;  1D1B A;  3HKE E;  4DV4 T;  3R6N A;  4IDO A;  4TTV A;  4WZX A;  3C4X A;  1D1A A;  5LB7 B;  3P4R A;  1BR0 A;  2A72 A;  2XSA A;  5LBQ B;  3Q5E A;  2Q7E A;  5JRC B;  4IDP A;  3C4Z A;  4GOU A;  4WBO A;  1FJG T;  2M6B A;  2BKO A;  3AXJ A;  2IIU A;  1MMG A;  5L4E A;  5HCM A;  2QHT A;  1KNP A;  2XQY A;  4YRR A;  2CWY A;  3C4W A;  3ZMU B;  4EZ4 A;  5JR9 B;  4XEO A;  4QHO A;  4UV9 B;  3O9X A;  4PJN A;  1X9B A;  3AEC A;  4QX8 B;  4TZ4 C;  4PJL A;  1BIB A;  4PK5 A;  4ZI7 E;  1KNR A;  4H9P C;  2HN1 A;  4X62 T;  3LSS A;  1S94 A;  3L3P A;  2NTY A;  3K8P C;  4B3R T;  4FJO A;  4O8S A;  5TAO A;  4LNS A;  1MNE A;  4DV1 T;  1Y64 B;  4JEU B;  5FYM A;  4HFI A;  4UVC B;  2DJZ A;  2JQK A;  1H4S A;  2EWN A;  5FMN A;  5HEG A;  4TWH A;  2AMC B;  4DV2 T;  3PUY F;  2ZT6 A;  3KFW X;  3LSQ A;  4YPF A;  5FXX A;  3PUR A;  3TEH A;  4KUM B;  4AIU A;  3RKY A;  1HTJ F;  1OED A;  1T8B A;  3VR9 A;  3EHZ A;  3MJX A;  3SRZ A;  3VBB A;  1NJ5 A;  2DZC A;  4AKL A;  2PTF A;  2C8M A;  2MBG A;  5ABF B;  3OYZ A;  4P1N A;  3VKH A;  5HEJ A;  2IDO B;  2ZLY A;  2VQE T;  3N9M A;  4XTV A;  12AS A;  1OED E;  3CWZ B;  2MPK A;  4LF7 T;  2JMH A;  4PG3 A;  4CH6 A;  1HG5 A;  1JNZ A;  4WJ3 M;  4NXN T;  5DQW A;  4I0U A;  5FY1 A;  2Q5H A;  3EFS A;  5AQQ B;  2BVL A;  3H3A A;  5HXR A;  2AXD S;  1GQE A;  4LF6 T;  1KMM A;  1YKH B;  4CH5 A;  1VRB A;  3BFM A;  1ADJ A;  4YDQ A;  4M1P A;  3CIR A;  3CPZ A;  3P4P A;  2DTI A;  3H37 A;  3HFV A;  3P8T A;  3HI2 A;  5FY7 A;  2G4C A;  2K3W A;  3REX A;  3RI5 A;  4CQI A;  3UFE A;  3QB5 K;  2CMR A;  4XU3 A;  3RYF E;  5CFB A;  3L4G A;  2CXF A;  5JVD E;  2ES0 A;  4Z91 A;  2CBJ A;  2FJA A;  5FY0 A;  4HWR A;  3IKL A;  4OYK A;  4X1Y E;  4HTE A;  3U3I A;  3ZT6 A;  2ART A;  4I50 E;  4ZZB A;  1V9D A;  5HWX A;  4IDN A;  5IUX A;  4TWF A;  2C7I A;  5K1X A;  3ONX A;  3HXX A;  5FL0 A;  1FEW A;  4YRT A;  3PJA J;  4U74 A;  4XZC A;  11AS A;  1U5P A;  2Y8D A;  4HKA A;  5H6Q B;  1EZ3 A;  2LOS A;  3OYX A;  2DXU A;  2YDR A;  2BG9 C;  4DR3 T;  2ZCE A;  4Q6G A;  1XMQ T;  4O4I E;  3TLW A;  5JDL A;  3MK7 C;  3M3Z B;  3HA4 A;  4UV8 B;  3WAJ A;  4B6X A;  1HC7 A;  5EK3 A;  1KOG A;  5HYA A;  4IL9 A;  2NP9 A;  1XNR T;  1EQR A;  1X56 A;  2PBI A;  2VKO A;  4B3S T;  5EZY E;  4L5G A;  2X9H A;  1WFD A;  4HFB A;  3A7R A;  1GGM A;  4IST A;  1N34 T;  1EIY B;  2V7L A;  2XAJ B;  5L3D B;  1B7Y A;  2HPL A;  4TQF A;  5AQL B;  4AQF C;  4U31 A;  1W0A A;  2B76 A;  3ZMT B;  3AE3 A;  4C90 A;  3HFZ B;  2Q9Q C;  4CI2 B;  1M62 A;  2Y48 B;  4DR1 T;  3ABV A;  2I6H A;  2V7K A;  1SET A;  4LVJ A;  5LOV E;  3S4U A;  1HX1 B;  2LM9 A;  3HL6 A;  3GN5 B;  5L47 A;  2I4N A;  1T98 A;  4TV8 E;  1QF6 A;  4JI8 T;  4PFP A;  4HT4 A;  3BQI A;  4CN4 A;  3RLF F;  2Q9Q D;  5FVK A;  2KLQ A;  3PUG A;  2W62 A;  3L2Z A;  2CJA A;  4HN9 A;  2LLY A;  2IW5 B;  1USY A;  4P72 A;  2C0S A;  3UU4 A;  2FJB A;  4ADZ A;  2UU9 T;  3I0Q A;  3T1Y T;  5HWY A;  5JQG E;  4G63 A;  1NAF A;  3CX6 B;  3EAM A;  2XZE A;  3MKD A;  3RIU C;  2QA7 A;  4UF0 B;  3VQX A;  4O2A E;  4EAH A;  4LF9 T;  4H9Q C;  4HGA A;  4XU2 A;  1H7C A;  2XAH B;  2E41 A;  4IE5 A;  4O2B E;  2K5B B;  4UEM A;  2ZR3 A;  4L9I A;  4PFO A;  5JH7 E;  3E0Z A;  2RHS A;  3P4W A;  3ZPO A;  3ESL A;  3DJB A;  1Z7M A;  2Y6X A;  3C98 B;  4HWF A;  3HXV A;  3ZC1 A;  3PUX F;  2ODV A;  3ZN0 B;  3GA8 A;  1YQ4 A;  4OFZ A;  4HFD A;  4JI5 T;  4EOZ B;  1IBK T;  2CJB A;  1FYF A;  5JDQ A;  2NW7 A;  3LBX A;  5FP3 A;  4IHJ E;  3A31 A;  3UUM A;  2WP9 A;  2ZR2 A;  4DND A;  1HS7 A;  1WYD A;  5JDN A;  3K3Q C;  4MHC A;  3O1I A;  3PUZ F;  4HWC A;  2DVE A;  3ANW A;  2UXN B;  3NRX A;  2VVN A;  1Y01 A;  4O4L E;  4O4J E;  5KXJ A;  3CML A;  2XQ3 A;  4Z90 A;  2V8S V;  5M4Y A;  3R07 A;  4KHZ F;  3IF8 B;  2KT9 A;  3J7Y q;  4P09 A;  5LA6 E;  3PCO A;  3FZK B;  1YXR A;  3ZYM A;  3AAE B;  1L0V A;  4ZI2 C;  2M67 A;  1T7S A;  2ZMA A;  5KNN A;  3UGQ A;  4KHP T;  4ISS A;  3V5S A;  5J1G A;  2BDE A;  1NEK A;  3GWH A;  2A3D A;  3P4S A;  1YQ3 A;  1ASY A;  2NW9 A;  4YY3 T;  3NEN A;  3PDY A;  3TLU A;  1W09 A;  3QTC A;  2ALY B;  4ZI2 D;  3V8K A;  2IC9 A;  3QK6 A;  2WS3 A;  4DID B;  3MXZ A;  1MMA A;  2UUA T;  3RRW A;  4AKI A;  2JMK A;  2DTH A;  5C53 B;  3RH3 A;  4AXP A;  2W4X A;  1OWA A;  2LRL A;  4ZS3 A;  4H2Y A;  3TLS A;  4XU1 A;  2CBI A;  5JRE A;  3VHL A;  3EVY A;  3B57 A;  2W67 A;  1WLE A;  3U78 A;  2WMO A;  2XTL A;  1NJ1 A;  3PZC A;  2DZ9 A;  3IBP A;  3SOL A;  4JI1 T;  2A8E A;  4YSX A;  4YRG A;  4YCV A;  4KR3 A;  2NWB A;  3OJA A;  1B76 A;  2BG9 B;  3C51 A;  3AVR A;  2H3R A;  4UVA B;  2JQH A;  1NYR A;  1KMN A;  4PW8 A;  2LM2 A;  3QO5 A;  2XPK A;  4CS3 A;  2RHQ A;  2UXB T;  3QC9 A;  4I55 E;  2JRK A;  2W66 A;  4ILC A;  4K87 A;  1QLB A;  2RPA A;  4BAY B;  1CUN A;  3CX7 B;  3UFG A;  4ZZC A;  2YEV C;  1NEN A;  2DQ3 A;  4PJJ A;  2H88 A;  5LNK A;  4P3P A;  3LBX B;  3OBV E;  4X1I E;  3RIR A;  1NNH A;  4OP0 A;  3AE5 A;  4YCW A;  2CEA A;  1YFS A;  1OED C;  1VCT A;  2Q9Q B;  3KBU A;  5AQM B;  3FZH B;  3AE8 A;  2DXT A;  2E5V A;  3CVR A;  3ETV A;  2HN2 A;  3VKG A;  1NJ8 A;  3NBX X;  4IL4 A;  1YGB A;  4HFE A;  2PG8 A;  4CI3 B;  4CZZ B;  5J2U E;  1LRZ A;  2E3C A;  5LG3 A;  4H2T A;  5CA1 E;  2XUE A;  3PUQ A;  2C5J A;  4P0A A;  3JAF A;  2E10 A;  1IJ5 A;  4IE7 A;  4GK0 E;  2J62 A;  4X5T A;  2VL8 A;  4K86 A;  4AIS A;  4YRE A;  3UQ7 A;  2E2A A;  4LML A;  3RIF A;  3RYC E;  2XQ7 A;  3BK9 A;  5L4H A;  4TUY E;  3Q5X A;  1XMO T;  3KVA A;  2N9D A;  2WZI A;  3A74 A;  5C52 B;  2YU2 A;  4P73 A;  1FMV A;  4BJM A;  5LMU T; 
#chains in the Genus database with same CATH homology
 2FYK A;  2AKW A;  1YB3 A;  2E65 A;  2ZGW A;  1EFW A;  4P73 C;  2CGH A;  3QO7 A;  4HWR A;  3QO8 A;  4RQF A;  1ATI A;  3ICA A;  2ZT5 A;  3IKL A;  4NCX A;  4RDX A;  2CJ9 A;  2ART A;  1B70 A;  3A32 A;  4YRI A;  3V7C A;  1JJC A;  4LVL A;  3NEL A;  4P3O A;  2C7I A;  5K1X A;  4CH4 A;  4H02 A;  3HXX A;  4L87 A;  4UPA A;  2HNI A;  2RHS B;  4YRT A;  1X2G A;  4P74 A;  2I4L A;  11AS A;  4BWA A;  2DEQ A;  1EOV A;  2DXU A;  1E24 A;  3A5Z A;  5C51 B;  1ASZ A;  4XTZ A;  1PYS A;  3HXW A;  2ZCE A;  4P74 C;  4Q6G A;  5ELO A;  2AMC A;  1H4V B;  3NEM A;  3REU A;  3FJP A;  4CS2 A;  2J3L A;  1HC7 A;  4XTY A;  3M4P A;  2PMF A;  2ZT7 A;  3DSQ A;  1KOG A;  3UGT A;  4RQE A;  3MEY A;  3HXZ A;  1YFT A;  1EQR A;  1X56 A;  3HY0 A;  3V7S A;  4WI1 A;  4G84 A;  4PHC A;  4K88 A;  1J5W A;  1WPY A;  3A7R A;  1G5H A;  1GGM A;  2XGT A;  1EIY B;  1E1O A;  4XU0 A;  1B7Y A;  2ZT8 A;  4TQF A;  4P71 A;  3HFZ B;  4G85 A;  3PCO B;  4P71 C;  4LVM A;  4WJ4 A;  4YRQ A;  1SET A;  4LVJ A;  4HWP A;  3I7F A;  4X5O A;  2I4N A;  3HXU A;  1QF6 A;  2E5A A;  3A7A A;  4HT4 A;  3W3S A;  3IKM B;  1YFR A;  2ZIN A;  1C0A A;  4H2X A;  3HY1 A;  5HGQ A;  2ARS A;  1WQW A;  3EFR A;  3V7R A;  1EVK A;  4YRC A;  3L2Z A;  2CJA A;  3E9H A;  1USY A;  3HRI A;  4UP7 A;  2DDZ A;  4P72 A;  2DU7 A;  1VQZ A;  1HTT A;  4HWT A;  4YYE A;  2P5I A;  1USY C;  5F5W A;  4HWS A;  4P72 C;  1W66 A;  4LVI A;  4P3N A;  4E51 A;  4TVY A;  2ZNJ A;  4CS4 A;  3VQX A;  1H4Q A;  4XU2 A;  1E22 A;  2E41 A;  2ZXF A;  3V8L A;  2ZZG A;  2EJ9 A;  1X55 A;  4YRM A;  2ZR3 A;  4WF2 A;  1EVL A;  1B70 B;  1X01 A;  3RAC A;  3MF1 A;  1WNL A;  2RHS A;  3MF2 A;  2ZZF A;  2ZZE A;  1NJ2 A;  1Z7M A;  4XEM A;  3QNE A;  3HXY A;  1HXD A;  3HXV A;  4YRJ A;  3TEG A;  2NS6 A;  4P75 A;  4EX5 A;  2EJF A;  2RHQ B;  4H2S A;  2DKG A;  2Q7G A;  3HRK A;  1H4T A;  2EL9 A;  2ODR C;  3P8Y A;  4P75 C;  1WU7 A;  2I4O A;  3NET A;  2CJB A;  4YCU A;  1FYF A;  2DQ0 A;  3RL6 A;  3A31 A;  3TEH B;  1G51 A;  2ZR2 A;  2P0L A;  1WYD A;  1X2H A;  3IG2 A;  4UP9 A;  2QHS A;  2Q5I A;  4KR2 A;  3L1A A;  3E9I A;  2DVE A;  3VQY A;  3P8V A;  2IY5 A;  1EIY A;  2EJG A;  2PME A;  1SER A;  4DQ2 A;  4TVA A;  2ODR D;  3MQZ A;  3R07 A;  3HFZ A;  2J3M A;  4HWO A;  2QHU A;  4HVC A;  2E64 A;  3PCO A;  3HTZ A;  3BJU A;  2E1H A;  1B8A A;  4UP8 A;  4Q15 A;  4YRL A;  3WQZ A;  3G1Z A;  5KNN A;  4TTV A;  3UGQ A;  1BBU A;  4TWA A;  4CH3 A;  2ZNI A;  1IL2 A;  4J15 A;  2DTO A;  4H2X B;  1ASY A;  2I4M A;  2Q7E A;  3VQV A;  1E1T A;  3M4Q A;  3NEN A;  4H2W A;  2CIM A;  1BIA A;  3QTC A;  3RKX A;  2ALY B;  4AH6 A;  3L4G B;  3V8K A;  2QHT A;  4XTU A;  2DTH A;  2EAY A;  5C53 B;  2XTI A;  2AKW B;  4YRR A;  2DU5 A;  4H2Y A;  1N9W A;  3UH0 A;  4XU1 A;  4XEO A;  4YRP A;  4H2V A;  4RMF A;  1SES A;  1BIB A;  1L0W A;  1WLE A;  3LSS A;  1JJC B;  1NJ1 A;  3PZC A;  2DZ9 A;  2A8E A;  3CMQ A;  4BW9 A;  4YRG A;  2ARU A;  4YCV A;  4KR3 A;  1B76 A;  4DPG A;  4LNS A;  4ZIB A;  1NYR A;  3RUX A;  1KMN A;  1WQ7 A;  1PYS B;  3QO5 A;  4XTW A;  2DJZ A;  1H4S A;  4CS3 A;  2EWN A;  2RHQ A;  1Z7N A;  2AMC B;  4K87 A;  4KQE A;  3UFG A;  2ZT6 A;  3LSQ A;  4YPF A;  1X54 A;  4TQD A;  1G5I A;  2DQ3 A;  3TEH A;  1RIQ A;  4P3P A;  5E3I A;  3RKY A;  4O2D A;  3KFU A;  1NJ6 A;  3RKW A;  3RIR A;  1NNH A;  4OP0 A;  3VQW A;  3IAL A;  4YCW A;  4YRK A;  3VBB A;  1NJ5 A;  1YFS A;  2DZC A;  4YRF A;  4XTX A;  2C8M A;  1B7Y B;  4YRO A;  2IY5 B;  2DXT A;  4LVK A;  2ZTG A;  4XTV A;  1NJ8 A;  12AS A;  4HA8 A;  1YGB A;  4TVA B;  4EO4 A;  2ZIM A;  4ZTZ B;  4PG3 A;  3A5Y A;  5ELN A;  2E3C A;  3A7U A;  4H2U A;  3ERR A;  4H2T A;  1ADY A;  3OD1 A;  2QHV A;  4CH6 A;  1NYQ A;  4WJ3 M;  3TUP A;  3RF1 A;  2E10 A;  1QE0 A;  2Q5H A;  3EFS A;  4YRN A;  4K86 A;  1KMM A;  4YRE A;  4CH5 A;  3BFM A;  1ADJ A;  4YDQ A;  1BBW A;  1LYL A;  4OLF A;  1SRY A;  2Q7H A;  2DTI A;  3V8J A;  3HFV A;  3RGL A;  3P8T A;  2ZIO A;  2G4C A;  3REX A;  4ZTU B;  3LC0 A;  5K1P A;  4YRS A;  4YP0 A;  3A74 A;  4TVW A;  4XU3 A;  5C52 B;  2ALY A;  3L4G A;  4P73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...