1J5WA

Crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
276
Chain Sequence
MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha chain
publication title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Ligase
total genus 95
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 1j5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1j5wA01
5KNNA 1B7YB 3RF1A 2DTIA 3V8LA 4PG3A 1NJ2A 4HWPA 3A7AA 2ZGWA 4EX5A 1ATIA 2XGTA 2E41A 1SETA 4O2DA 2AKWA 3HXYA 4RMFA 3PCOB 1EFWA 1EIYB 1H4VB 3VBBA 2EJ9A 5K1XA 3PZCA 1C0AA 1YB3A 1WU7A 3A31A 2CJ9A 2PMEA 4YRIA 3V8JA 1KMMA 4HA8A 3A5YA 2EAYA 3E9HA 3RACA 4ZIBA 2ZT6A 4WI1A 1PYSB 1SERA 4TWAA 5E3IA 2ZZFA 4J15A 4P72A 2ZZEA 4P74A 1QF6A 4RQEA 1W66A 4YRJA 3ERRA 3IALA 2Q7EA 2AKWB 3TEGA 3I7FA 3QO7A 2ZT5A 4TVAA 4DPGA 3V7SA 11ASA 1B70B 1NJ1A 4K88A 4YRPA 2RHSA 3NETA 1WYDA 1NYRA 2CJAA 2I4LA 4TTVA 1Z7MA 1LYLA 1BBUA 4UPAA 3RIRA 2ZXFA 3ICAA 3CMQA 3HY1A 2ARSA 4CS2A 2DXUA 4UP8A 3TUPA 3P8TA 4ZTZB 4TQFA 1HC7A 1Z7NA 4YRSA 1USYC 3NELA 2DQ3A 4G85A 4YRRA 1H4QA 2Q5IA 1J5WA 4Q6GA 4WJ4A 4CH5A 5ELOA 5HGQA 4G84A 1ADYA 3RL6A 2ZIMA 1X56A 4XTZA 2XTIA 3M4PA 4YRMA 4H2WA 4CS4A 3EFSA 1WQWA 4CH6A 4XTWA 4XTVA 2EJFA 3VQYA 3TEHA 1EQRA 1QE0A 4EO4A 2RHQA 3BJUA 4AH6A 3HXXA 2DTHA 2CIMA 4YRLA 4XEMA 4ZTUB 2QHTA 4YRQA 4HWRA 1VQZA 1NNHA 4H2XB 2ALYB 2E10A 2AMCB 1EVLA 3HFZA 2G4CA 1HTTA 1ASZA 1YFSA 4YRFA 4P75C 1H4SA 2FYKA 3UGTA 5ELNA 4YRNA 12ASA 4CH4A 2ZR2A 1YFTA 3REXA 1HXDA 2QHUA 1SRYA 1G5IA 4PHCA 4XU2A 2E3CA 4CH3A 3UGQA 4H02A 4X5OA 2E1HA 1E1OA 2IY5A 4YYEA 3R07A 4XTUA 4TVYA 3IG2A 1NJ5A 4YROA 1E24A 3A74A 3LC0A 1WPYA 3L2ZA 3WQZA 4E51A 1KMNA 2DZ9A 1USYA 1YFRA 3LSQA 1L0WA 4P71C 1FYFA 4K87A 2ZZGA 3M4QA 2ZINA 4UP7A 2EWNA 1WLEA 2E5AA 3L4GA 1H4TA 4P73C 3VQWA 2C7IA 1EVKA 2E65A 1EOVA 4UP9A 4XEOA 3VQVA 4KQEA 4BW9A 3IKLA 1BIBA 2I4NA 2P0LA 4YRCA 4OLFA 3HRKA 4WJ3M 3RGLA 3L1AA 2ODRD 4P3PA 5K1PA 4TVAB 4YCVA 4CS3A 4RDXA 3BFMA 4XU1A 2RHSB 3RUXA 4DQ2A 2DDZA 2J3MA 1NJ6A 2CJBA 4HWTA 3MEYA 3HXUA 4XU0A 4L87A 3V7CA 3L4GB 3G1ZA 3P8VA 4YRKA 4YCUA 4P75A 2Q5HA 4OP0A 3A32A 3HFVA 2ZT7A 1IL2A 4H2TA 2EL9A 2ARTA 3HXZA 4H2SA 4YP0A 2DTOA 2DU5A 3A7RA 4HVCA 3FJPA 4KR3A 1EIYA 1B8AA 3HXWA 3UH0A 4TQDA 3P8YA 3OD1A 4RQFA 4XTXA 4K86A 3RKYA 1PYSA 3QO8A 4P71A 3RKWA 3V8KA 2ODRC 2ZTGA 3MF2A 3NEMA 4YPFA 4YRGA 3IKMB 1X01A 2QHSA 2DXTA 4P73A 3A5ZA 2DZCA 2DVEA 1BIAA 3TEHB 1B70A 2ZNJA 1G51A 2RHQB 1GGMA 1JJCA 4HWOA 1X55A 2P5IA 2PMFA 2C8MA 1RIQA 4YDQA 4YCWA 4LNSA 4WF2A 2HNIA 2I4OA 3MF1A 3REUA 3HFZB 2E64A 2Q7GA 2DEQA 3QTCA 4HWSA 1E1TA 3A7UA 5C53B 1YGBA 4H2YA 1X2GA 2I4MA 3KFUA 1X2HA 1WQ7A 3VQXA 2Q7HA 2DJZA 2EJGA 4P3OA 2DQ0A 1X54A 4Q15A 4YREA 2IY5B 1JJCB 4BWAA 2J3LA 3QO5A 1ADJA 4YRTA 1N9WA 2ARUA 3E9IA 5F5WA 1KOGA 2ZT8A 4NCXA 3HXVA 3RKXA 1ASYA 1NJ8A 3HY0A 3NENA 4P72C 4P74C 2QHVA 5C52B 4XTYA 1B7YA 3DSQA 2ZCEA 4XU3A 2ZNIA 2DKGA 2ZIOA 1G5HA 3EFRA 1E22A 3HRIA 4P3NA 1NYQA 1B76A 1WNLA 3UFGA 3LSSA 2CGHA 4H2UA 3W3SA 3PCOA 4H2XA 2ALYA 2AMCA 2DU7A 3HTZA 5C51B 1SESA 2ZR3A 4KR2A 4H2VA 3V7RA 4TVWA 3QNEA 1BBWA
chains in the Genus database with same CATH superfamily
2WWVA 1B7YB 2WSSV 2DTIA 4XBFB 2X0HA 4B3RT 4ISTA 3V8LA 2A72A 5LMUT 1NEKA 3KBTA 5FXXA 3A5XA 3EHZA 5J1GA 3VKGA 4X65T 4X20E 4U7YA 2XGTA 2E41A 2V1DB 3C4XA 1SETA 4ZXLA 5DJQC 5FL0A 3ZCJA 1I94T 3C4ZA 4LF5T 1IJ5A 2CPTA 4IDNA 3AA7B 3AAEB 1EFWA 5HEJA 5AQVB 2CEAA 2K3WA 5K1XA 2BBHA 3B5MA 4HWHA 2BG9B 4TWDA 1MMDA 4AKHA 2PMEA 1MIWA 1ZOYA 3ZLIA 4JYAT 3ZYMA 5IHYA 3E9HA 4ZIBA 4KBMB 1GQEA 4O4JE 3LDQB 5L3BB 4IT4A 4ZI7E 2ZZEA 1FMVA 4N78D 2N2NA 4JI5T 3JAFA 3PUSA 3RQWA 1D0XA 4HWDA 3QO7A 2ZT5A 4K88A 1YW0A 2EHOD 2JRKA 3GA8A 3L09A 3QB5K 4PJMA 1NYRA 2NWBA 2I4LA 4GYSA 5LB7B 2V7MA 5LGTB 4UPAA 3HY1A 3MACA 3ZJ1A 1ZKEA 3WAKA 4AQFA 1S35A 4JI8T 2BDEA 4UP8A 3C51A 1HS7A 4A5XA 3KBUA 5L4EA 2LSKA 4WW0A 4G85A 4CI2B 3I1AA 4U2YA 2ODUA 3CQXC 4HTEA 4YRRA 4F8HA 4WJ4A 4CH5A 1L0VA 4PJJA 5JR9B 1ADYA 1HG5A 2JIWA 2R6GF 5LG3A 4ILCA 4YSXA 4XTZA 1HG2A 2I0MA 3PUYF 1SE7A 4X64T 3M4PA 3UU8A 4YRMA 4H2WA 5AQHB 4A97A 5AQPB 3OYZA 2XQ6A 4TZ4C 3U78A 4JEUB 5LOVE 2BKOA 2NW9A 3BQIA 3HXXA 2DTHA 4H9NC 4ERRA 1XDPA 1XNQT 4DV4T 1UX4A 4ILUA 4CN4A 5FVLA 2H3RA 4YRQA 2XAFB 4UELA 3RPUA 3KVBA 3MKDA 3HFZA 1CHUA 3O1IA 4IL9A 3VKHA 4HFEA 2WZHA 4TWFA 2WCAA 3UGTA 4HE8A 2CRBA 4X1YE 2Y8DA 5J2TE 2UUBT 5ELNA 4JV5T 5L3DB 4CH4A 2NTYA 2WZIA 4X5TA 1YFTA 5KDMC 1SRYA 1G5IA 3UGQA 5ADXL 2E1HA 3JADA 2IY5A 4YYEA 5BR8T 3NRXA 4O8SA 2J4GA 1E24A 1DU2A 4DR6T 4YTMA 2J47A 4E51A 2IDOB 3HI2A 1USYA 4H9QC 2LOPA 3N9MA 2DNXA 2V7JA 4OYJA 1WYCA 3RIFA 2ZINA 4LF8T 4ISSA 2A9UA 1BR4A 2W61A 3L4GA 3TLWA 5AQUB 3VQWA 2M6IA 4I55E 4MHCA 4IREA 1EOVA 3VQVA 4AIUA 1E2AA 2KINB 2I4NA 2WP9A 3PE0A 3L1AA 2D0TA 4Z8XA 3RYCE 2YDSA 2WY2A 5K1PA 3VR9A 4CS3A 1OEDA 3K8PC 1W9RA 3RUXA 4IDPA 1CUNA 2PBIA 2J3MA 1NJ6A 4HWTA 3ZJ2A 3OYXA 5HXSA 3V7CA 2Q9QC 4HWIB 3UQ4A 4OX9T 2IUBA 2L9QA 4CXWA 4YCUA 4P75A 5HEGA 1YQ4A 4LFBT 4YY3T 4LMLA 4O4LE 3K1SA 2V6YB 1KK7A 1HFAA 2ARTA 4YP0A 3ZMSB 2DTOA 2K9AA 2DU5A 2FUPA 2LE8A 4UV8B 3HXWA 5AQSB 2BG9E 2UXCT 3M3ZB 1VCSA 5AQQB 4JBWF 4RQFA 3C50A 1XWMA 1V9DA 2FBWA 2KLQA 3EDUA 4QXBB 5LGUB 4MBQA 3RKWA 3GMIA 4EGWA 3NEMA 4YPFA 3AVRA 4EYUA 3EVYA 2QHSA 4LF4T 1NWMX 1H7CA 4P73A 1D0ZA 3AEEA 2DZCA 2DVEA 3TEHB 2ZNJA 4UXNB 2RHQB 4GIWA 4HFVA 4L5GA 4CXYA 3L3PA 3AEFA 1X55A 2BG9C 3E08A 5L3EB 2IAKA 1RIQA 2VVSA 2HNIA 3AVSA 5JQGE 4HKAA 1QSDA 3QTCA 1BR2A 4HWSA 3B57A 4YHHT 2VQET 1YGBA 2E9XA 4PK6A 4H2YA 3MQZA 5EK4A 1JNZA 4X66T 4GKJT 1MNDA 3UU6A 4Q15A 2MYSA 2XQ7A 4CXXA 4BAYB 3CQCB 2Z6EA 3EI0A 1N9WA 3TLUA 2ARUA 5F5WA 2ZT8A 4NCXA 2NW7A 2BVLA 3RKXA 1Y01A 2LSIA 2Y48B 2VWAA 2IC6A 5GONE 4A98A 4H63V 3DSQA 5DABA 3LFMA 2ZIOA 4HT4A 4DV0T 2DL1A 4P3NA 3N9PA 5JR9C 3AA0B 2YDQA 2CGHA 3W3SA 5KX5E 3ZEFB 5JREA 3HTZA 5C51B 3C64A 2V5CA 3MK7C 2JQ9A 4U2ZA 3NZPA 4JI1T 4H9SE 4TVWA 3ZMTB 1G73A 4TNWA 1YQ3A 3ZN0B 4LF7T 2MPKA 2HPLA 1Z0PA 5LXTE 4LVKA 4EEBA 4PW8A 1B7TA 4I43B 1XMOT 5FXZA 4PG3A 4IGUA 3R84B 4DV2T 1NJ2A 3RKOA 1MNEA 4IE4A 3AE8A 3RIAA 5LG4A 2NS6A 4O2DA 3ZKRA 4KHZF 3HXYA 5LA6E 2E8IA 5IYZE 4C90A 3VBBA 4B3MT 5AQGB 3VU7H 2X67A 2YK0A 3VHLA 1M7KA 2CHNA 2LM2A 3RRWA 1YB3A 2UUCT 4ZZCA 2CJ9A 2LKHA 1WYBA 5JDHA 3RACA 2LT3A 5FVKA 1PYSB 2LHNA 4TWAA 1SUMB 2W00A 2ZZFA 4OFZA 4G63A 4NIQA 4P72A 1T8BA 2A8EA 5LJNA 1YKHB 4RQEA 4WYVA 3ANWB 3H3MA 3J7Yq 4YRJA 3ERRA 5CB4E 4UVCB 11ASA 4JI6T 4AKLA 2VKOA 3ZT5A 1KEYA 4O2BE 3NKZA 3UUXB 3PUVF 1Z7MA 2WDQA 3UTKA 3RIRA 4DNDA 2OA5A 3ICAA 4AI6A 4AQYT 2Y6XA 2ARSA 2X68A 4WBNE 4ZTZB 4DBRA 5ABEA 2X9WA 3UFEA 4I0UA 2VB6A 1Z7NA 2Q9QB 2ACXA 2WWUA 2D5UA 1H4QA 3RC3A 3Q5EA 5KXJA 3QNUA 4QH4A 4G84A 5H6RB 2JJ9A 3KV9A 4HN9A 2B1EA 3RL6A 2ZIMA 4H63H 1X56A 2LSJA 3ZSTA 5AQNB 2XTIA 2LLYA 5JTGA 1D1CA 3EFSA 4CH6A 3VQYA 5CJ5A 3WAJA 2XAGB 4DV1T 3M65A 1ZHCA 3Q5DA 1HTJF 3BJUA 2VK9A 3EDVA 2CIMA 4XEMA 1MIVA 1BBWA 4ZTUB 1MMGA 2B76A 2QHTA 2P9BA 3LK2B 4HWRA 1Y64B 1VQZA 3N9LA 4AKIA 4H2XB 3U3IA 2AMCB 4Z90A 1H4SA 3GN5B 3KDSE 4YRNA 2X66A 4JI2T 5LGNB 4DV5T 5FNVE 3LBXA 3ETVA 5LJMA 3C4WA 1BR1A 5FY7A 3UT5E 1HXDA 4DV3T 3D0TA 4JEHB 4CH3A 2JMHA 3RKGA 3RLFF 1E1OA 3AE7A 2Q9QD 2QGSA 4YTPA 2DHRA 5AQIB 4IDZA 4LFAT 2NW8A 4TVYA 3IG2A 4YROA 4JLEA 1WPYA 1M62A 2N9DA 3AE5A 1KMNA 2DZ9A 3P7IA 4WZXA 1T98A 3A7MA 1FYFA 2MAWA 2VQFT 1VRBA 3CKDA 3M4QA 5LHHB 2FJEA 2E5AA 1NAFA 3TLTA 2C0SA 1H4TA 5ABFA 4PJLA 2C7IA 2KT9A 1EVKA 4TWHA 3OTOT 3QC9A 4IDQA 3HKCE 5AQRB 4KQEA 2XQ5A 1FMWA 1WFDA 4YRCA 3ZC0A 2EHOA 3ZT7A 3RGLA 3P8CD 5TAOA 3ZCIA 4I4TE 2NP9A 1MMAA 2WDRA 5AQOB 4TVAB 4PNIA 3AEBA 2HN2A 4UF0B 5JRCB 2RHSB 4NXNT 3FBZA 2CJBA 3MEYA 5LYJE 2C5IT 5FKYA 4LVIA 4EV6A 4L87A 4B3ST 4U74A 3L4GB 3P8VA 3ZN1B 3A32A 3HFVA 2V7LA 4P09A 5LP6E 3AE4A 4EZHA 4DV7T 2EL9A 3ONLC 3CPZA 4H2SA 3MA9A 4YSZA 2X9YA 2JQHA 3OVUA 3A7RA 4HVCA 4KR3A 1B8AA 4LF6T 4GOUA 2K48A 3UUBA 2JQQA 5AQMB 3T1YT 2YINA 3OD1A 4CN6A 2XASB 5LCYA 4XTXA 2CHOA 2V5DA 4HFDA 1KNRA 4XAXB 4K86A 3CK6A 3NBXX 2KWIB 2KZ7B 4HFCA 4GK0E 4P71A 3OKQA 4AKGA 5A1LA 1UK5A 3HKBE 1YKEB 1X01A 3PJAJ 4DMVA 2WBLA 3UQ7A 2W2UA 1BR0A 2L8KA 3P4SA 2WS3A 4ZOLE 2N1GA 5M4YA 2DXTA 2SPCA 5HYAA 2V7IA 4IHJE 3N9NA 4EOZB 1BIAA 1VOMA 3E22E 1J1JA 2XZEA 5HWXA 1LVKA 2PMFA 3ZC1A 1X9BA 4CN1A 3PUAA 4YDQA 4LNSA 3KV6A 4QHOA 5FY1A 3MF1A 3REUA 2IW5B 2E64A 2WDVA 3E0ZA 4U3CA 3NRYA 4U31A 4DR2T 3A7UA 4ILBA 3ONJA 4H9OC 4GYRA 2XY8B 2VASA 2F4VT 5JDGA 2W0GA 1X2GA 2L3LA 1IJ6A 1WQ7A 2K24A 1HNWT 4YT0A 4P3OA 3ZSSA 2PTFA 2XHEB 1LVFA 4YREA 2JMKA 4BWAA 2I59A 2K5BB 1HR0T 4KI0F 1ADJA 2V7KA 4M1PA 4EEDA 3KV4A 4DR1T 4WNKA 1XMQT 1NJ8A 2QHVA 2DI4A 2XUEA 3T8OA 1FIOA 2X9HA 5L3GB 5IUXA 4TN7B 2H88A 3CX7B 4COFA 1G5HA 4ZI2C 1B76A 1WNLA 4G2AA 3UFGA 5C2TA 2LKGA 3PCOA 4YJ3E 4ZS2A 4KR2A 5H6QB 3N9QA 2VL8A 3QNEA 5KNNA 4AQFC 4PFOA 2D2SA 3RF1A 4JI0T 5HWYA 3A7AA 3O4XE 2YDRA 5HXEA 4EX5A 1ATIA 3RIUA 2XM2A 4EIWA 2AKWA 2YEVC 4RMFA 2CA5A 5ABGA 3ONXA 4U7IA 3N2KE 1N33T 4O4IE 1EIYB 3I0QA 3F57A 5FY0A 3ZYLA 4MALA 3A31A 2YU2A 3V8JA 3PUXF 4HA8A 2VVNA 4JI4T 5ETWA 4WI1A 4P74A 1QF6A 2G0UA 3RYFE 3IALA 2Q7EA 1VCTA 4IE0A 5JH7E 1WR0A 2C5KT 4U33A 1B70B 2IMLA 4QWNB 1FEWA 3C98B 4EZ4A 2XAQB 3AA1B 2CJAA 4TTVA 1BBUA 2LM9A 4X1KE 2LHRA 4HFIA 5J0ZA 5FYMA 3OPCA 3RHWA 3CIRA 4CI1B 3CMQA 1U4QA 3UU3A 4ANJA 1LRZA 3BQLA 3FZHB 4YJ2E 4CS2A 2DXUA 4F6RC 1HC7A 5HXCA 3AA6B 4I50E 2LSYA 1USYC 2DQ3A 3CWZB 4UVAB 4DIDB 4Q6GA 4ZHQE 4TV8E 5HCJA 4LF9T 5ELOA 4DUYT 5HGQA 3ZMVB 3V5SA 4PJNA 3V5UA 4KMCA 4ILAA 2XJ7A 4CQIA 4IE5A 2UXBT 2XQYA 4UV9B 1WQWA 4XTVA 2YKSA 2EJFA 3QOFA 2NR4A 1T7SA 3TEHA 2CM0A 2V26A 3QB5A 3B13A 1D0YA 4EO4A 4E7ZA 3G06A 2RHQA 4AH6A 4QX7B 4YRLA 4X62T 3FXDB 4K0UA 4DBQA 1QLBA 3SRZA 2LRLA 5JDLA 3NVOA 2DLRA 1NNHA 3EUHA 3VRBA 2ALYB 4O4HE 2CWYA 1EVLA 3PURA 2LOSA 4P75C 4HGAA 1XDOA 3N5LA 4OHFA 2LEHA 2C5JA 5FP3A 1KNZA 2LRKA 2PFVA 12ASA 2ZR2A 5AQJB 4ZZBA 2QHUA 3SOLA 3KV5A 2E3CA 3FB2A 3O1JA 4H02A 3AAIA 4Q25A 3ESLA 4EXTA 3R07A 1FJGT 3AE1A 4PK4A 5HEUA 4OK0A 4AQGA 3A74A 4LVMA 3WQZA 3TKLB 1KF6A 2MBGA 1L0WA 2NOXA 2BBJA 4K87A 3AE2A 1HF8A 3KINB 3MZKB 4DR3T 4P73C 2E65A 3ZT6A 4O2AE 3HA4A 3MXZA 5HXRA 2VKJA 3P4RA 2H7VC 4LMKA 5HEHA 4BW9A 2UXNB 2DCFA 2P0LA 3N2GE 2QVAA 3PUZF 3LK42 3AEGA 3RH3A 3PJAA 2OV9A 5FXWA 3UUMA 4RDXA 3BFMA 3P4WA 5CGMA 4XU1A 3L8RA 1WCRA 3H37A 2BKPA 2DDZA 2CXDA 3TLVA 2JQKA 2E9XC 1J5ET 3G1ZA 4QKNA 1KFYA 2CXLA 2X0YA 3AXJA 3UU5A 3RI5A 4GKKT 2XQ8A 5FL1A 4H2TA 1HX1B 5EK3A 3ZMZB 2RA1A 2XAJB 4H9RC 1ZV4X 3AE3A 1IBKT 2QRXA 4JI7T 3RKYA 1D1BA 2QA7A 2XTLA 1PYSA 2XQ3A 2KNDA 4Z91A 3V8KA 2ODRC 3KFWX 2ZTGA 3MF2A 4YRGA 2VURA 2WB5A 3IKMB 4NUUA 3ANWA 2XAHB 2XM1A 4BJMA 3SFEA 3A5ZA 1LKXA 4UIGA 1G51A 4X1IE 2LJLA 2PG8A 2BS4A 3TLSA 1JJCA 4HWOA 2P5IA 4LMJA 3A8YC 3IA3A 2CCQA 3LK3B 3CX8B 4YFSA 1IAPA 3FZLB 4ZI2D 2I4OA 4WF2A 2UUAT 5EZYE 3HFZB 3O9XA 2DEQA 4FI5A 1U5PA 4KUMB 2X51A 1E1TA 1IBMT 3JAEA 4AISA 5C53B 5FXVA 4DUZT 3N2OA 1OXZA 2Q9QA 3X1DA 3J9X1 2I4MA 1X2HA 2DJZA 4IIJE 2EJGA 1NENA 4HWCA 4QXHB 1X54A 5HCMA 1UX5A 2IY5B 3AEDA 2BS2A 2J3LA 2CBJA 4YRTA 4YTNA 2E5VA 3E9IA 2M6BA 2GK9A 4J2CA 3IBPA 2ODVA 1YXRA 3HY0A 4P72C 2AE9A 5JDQA 5C52B 4XTYA 1B7YA 5AQKB 5LNKA 1MMNA 3IEEA 3FBLA 3RC8A 1N34T 5J2UE 2ZNIA 3IHRA 3AB3B 3LJCA 1T72A 1E22A 5HAXA 2XSBA 5BMVE 4U72A 4DMWA 1Z8UA 5C8YE 2UXDT 2H89A 2YN6A 4ZI3D 5AFUL 3EABA 3K3NA 4HWFA 1MIYA 3LSSA 3AECA 4H2XA 2AMCA 2V8SV 3MJXA 1SESA 3IF8B 2ZR3A 1IBLT 1OEDB 3GN5A 2WM9A 4H9PC 1HNZT 4H2VA 3AEAA 2BG9A 1EZ3A 1W0BA 2VKHA 1JNRA 2IIUA 2ZM6T 5DQVA 1UCUA 4LVLA 4TV9E 2J1DG 4HWPA 1WLXA 2KSRA 5JDNA 3WI3A 2CLYC 3PUGA 2ZGWA 3I9YA 2BS3A 3N9OA 2LSGA 1R8IA 1HCIA 5L3FB 3PCOB 5AQTB 1ZEEA 4EAHA 2A2FX 4V1Av 3Q2MA 1H4VB 2HH7A 4QH5A 2EJ9A 4IE7A 2W66A 3PZCA 4ZS3A 1C0AA 2DWKA 3VR8A 3F2EA 4YHJA 1WU7A 1QUUA 4YRIA 1KMMA 5CA0E 3A5YA 3DP7A 2EAYA 3F31A 3Q9DA 2ZT6A 1O3XA 4B6XA 1SERA 3K3QC 5E3IA 2CXFA 1HNXT 3H3AA 4J15A 2PJQA 3HR0A 1US7B 2W63A 5LMNT 4YLHA 4ADZA 1W66A 3PTRB 2X0LB 4NPPA 5EK2A 2AKWB 2A3DA 3TEGA 3I7FA 2IHR1 4TVAA 4DPGA 3V7SA 5CA1E 1UUSA 1NJ1A 4UF0A 5JRCA 1OWAA 4YRPA 2RHSA 5LBMA 3NETA 1WYDA 5JR9A 1ZP0A 3OJAA 3I9WA 1LYLA 2XQ4A 2ZXFA 4QXCB 2WQYA 2UXXB 4DV6T 3CX6B 2E2AA 4MFRA 3TUPA 3P8TA 4L0RA 3Q5WA 4TQFA 3UU4A 2E9XB 4YRSA 3NWIA 3ETUA 3NELA 5KMGP 4EYYR 2Q5IA 1J5WA 4PAGA 2AXDS 3P4PA 4DR4T 4HFHA 1SHZC 3RX6A 5CFBA 2CBIA 3ZMUB 2ZM8A 2DWGA 5ABHA 2W62A 2W4XA 2YU1A 3FZMB 4CS4A 2M67A 2EHOC 4XTWA 4PFPA 1EQRA 5JVDE 4AKRB 1QE0A 2V6XA 1XZYA 2CWOA 5LBQB 1IZNB 3PU8A 2XSAA 3RYHE 3FXEB 3I0OA 2IC9A 2NTXA 3RRCA 2E10A 3ZPOA 2G4CA 1HTTA 1ASZA 1YFSA 4YRFA 2FYKA 3JC6D 2ZLYA 2FJAA 5F3JA 4XZCA 5F8PA 3P50A 3LSVA 4KP3C 3OBVE 5HEOA 4ZI3C 2HPJA 3FHNA 3REXA 4DVDA 1YD8G 4DO0A 4PHCA 4XU2A 3GWHA 1D1AA 4X5OA 3DTOA 2E9XD 4EB6E 4JI3T 4QH1A 5JDMA 4XTUA 1S94A 1N36T 1NJ5A 3LC0A 1KNPA 3L2ZA 4P0AA 2ZMAA 4MLKA 2D9DA 4GK5E 2BVMA 2RPAA 1YFRA 3LSQA 4E7SA 4P71C 1E1HB 2XQAA 2ACZA 2HHHT 4AXPA 4YXDA 1N32T 4HEAA 4L9IA 2ZZGA 4UR9A 4CI3B 4UP7A 2EWNA 1WLEA 3K3OA 2QYWA 3R6NA 4B3TT 3BK9A 3NZQA 3ZYKA 4UP9A 4XEOA 3AAAB 3IKLA 4LFCT 1BIBA 2V6YA 3P4QA 5AQFB 4OLFA 1AJ3A 4BA9A 3HRKA 4WJ3M 2ODRD 3S4UA 1OEDE 2WMOA 4P3PA 4YCVA 3CMLA 5DQWA 2XPKA 4KX6A 4TUYE 4ZEYA 4DQ2A 4QX8B 2ZM0A 1W0AA 3HXUA 4XU0A 3AE9A 4FJOA 2OLTA 3PDYA 1WR6A 4DR7T 2KWHA 4YRKA 2UU9T 3SFDA 3HL6A 2Q5HA 4OP0A 3JCFA 2ZM2A 4DR5T 2WAUA 5IWAT 4P0BA 2ZT7A 5LHIB 3ABVA 1IL2A 4UEMA 3HXZA 5E0OA 3FJPA 1EIYA 3KVAA 1OEDC 3UH0A 2D0UA 5LHGB 4TQDA 3P8YA 2CLYB 2VL0A 3RQUA 3O1HA 4YSYA 4IE6A 3QO8A 3AXJB 4IDOA 5HXHA 4K0KT 2I6HA 1E7PA 2H7OA 2WU2A 4PK5A 2CMRA 3UUNA 1B70A 2BZBA 5JDFA 1W09A 4C91A 1GGMA 2VKDA 1HX8A 4KHPT 1X79A 2KMFA 3EAMA 5FMNA 5L47A 3SS1A 3FZFB 2C8MA 1UGOA 4YCWA 2FJDA 4BJNA 1G8XA 3FZKB 4IL4A 2BKNA 2RP4A 2E5LT 4TX5A 2Q7GA 4UVBB 3L39A 3PUWF 3PV0F 4OYKA 2WMNA 5AQLB 3RIUC 4HFBA 2J62A 2MTQA 2X9XA 3VRAA 3QK6A 3LBXB 3KFUA 3DJBA 1SA0E 3VQXA 2Q7HA 3BQKA 4TNVA 2DQ0A 3PU3A 1JJCB 4WBOA 3QO5A 3JC6C 2HN1A 5L3CB 2FJBA 3PUQA 4JUYA 1KOGA 4CZZB 3HXVA 4LVJA 2ES0A 4A56A 1ASYA 3NENA 4P74C 2WU5A 3SWHA 4NXMT 5L4HA 1I6ZA 2ZCEA 4XU3A 2DKGA 1WRDA 3CQGB 2YOEA 5ABFB 3HKEE 2KXPB 5C3JA 3UULA 3EFRA 1UURA 3HRIA 2XQ9A 3HKDE 1NYQA 2JPFA 2CE7A 4ASKA 3QUJA 2W67A 1XNRT 2EHOB 4H2UA 3AE6A 3Q5XA 3CVRA 4NUVA 2ALYA 2DU7A 4P1NA 3RYIE 3W15B 2MOZA 3V7RA 3LG7A 3T1HT 5L2LA
chains in the Genus database with same CATH topology
5KNNA 1B7YB 3RF1A 2DTIA 4LVKA 4LVLA 3V8LA 4PG3A 1NJ2A 4HWPA 3A7AA 2ZGWA 4EX5A 1ATIA 2XGTA 2E41A 2NS6A 1SETA 4O2DA 2AKWA 3HXYA 4RMFA 3PCOB 1EFWA 1EIYB 1H4VB 3VBBA 2EJ9A 5K1XA 3PZCA 1C0AA 1YB3A 1WU7A 3A31A 2CJ9A 2PMEA 4YRIA 3V8JA 1KMMA 4HA8A 3A5YA 2EAYA 3E9HA 3RACA 4ZIBA 2ZT6A 4WI1A 1PYSB 1SERA 4TWAA 5E3IA 2ZZFA 4J15A 4P72A 2ZZEA 4P74A 2A8EA 1QF6A 4RQEA 1W66A 4YRJA 3ERRA 3IALA 2Q7EA 2AKWB 3TEGA 3I7FA 3QO7A 2ZT5A 4TVAA 4DPGA 3V7SA 11ASA 1B70B 1NJ1A 4K88A 4YRPA 2RHSA 3NETA 1WYDA 1NYRA 2CJAA 2I4LA 4TTVA 1Z7MA 1LYLA 1BBUA 4UPAA 3RIRA 2ZXFA 3ICAA 3CMQA 3HY1A 2ARSA 4CS2A 2DXUA 4UP8A 3TUPA 3P8TA 4ZTZB 4TQFA 1HC7A 1Z7NA 4YRSA 1USYC 3NELA 2DQ3A 4G85A 4YRRA 1H4QA 2Q5IA 1J5WA 4Q6GA 4WJ4A 4CH5A 5ELOA 5HGQA 4G84A 1ADYA 3RL6A 2ZIMA 1X56A 4XTZA 2XTIA 3M4PA 4YRMA 4H2WA 4CS4A 3EFSA 1WQWA 4CH6A 4XTWA 4XTVA 2EJFA 3VQYA 3TEHA 1EQRA 1QE0A 4EO4A 2RHQA 3BJUA 4AH6A 3HXXA 2DTHA 2CIMA 4YRLA 4XEMA 4ZTUB 2QHTA 4YRQA 4HWRA 1VQZA 1NNHA 4H2XB 2ALYB 2E10A 2AMCB 1EVLA 3HFZA 2G4CA 1HTTA 1ASZA 1YFSA 4YRFA 4P75C 1H4SA 2FYKA 3UGTA 5ELNA 4YRNA 12ASA 4CH4A 2ZR2A 1YFTA 3REXA 1HXDA 2QHUA 1SRYA 1G5IA 4PHCA 4XU2A 2E3CA 4CH3A 3UGQA 4H02A 4X5OA 2E1HA 1E1OA 2IY5A 4YYEA 3R07A 4XTUA 4TVYA 3IG2A 1NJ5A 4YROA 1E24A 3A74A 3LC0A 4LVMA 1WPYA 3L2ZA 3WQZA 4E51A 1KMNA 2DZ9A 1USYA 1YFRA 3LSQA 1L0WA 4P71C 1FYFA 4K87A 2ZZGA 3M4QA 2ZINA 4UP7A 2EWNA 1WLEA 2E5AA 3L4GA 1H4TA 4P73C 3VQWA 2C7IA 1EVKA 2E65A 1EOVA 4UP9A 4XEOA 3VQVA 4KQEA 4BW9A 3IKLA 1BIBA 2I4NA 2P0LA 4YRCA 4OLFA 3HRKA 4WJ3M 3RGLA 3L1AA 2ODRD 4P3PA 5K1PA 4TVAB 4YCVA 4CS3A 4RDXA 3BFMA 4XU1A 2RHSB 3RUXA 4DQ2A 2DDZA 2J3MA 1NJ6A 2CJBA 4HWTA 3MEYA 4LVIA 3HXUA 4XU0A 4L87A 3V7CA 3L4GB 3G1ZA 3P8VA 4YRKA 4YCUA 4P75A 2Q5HA 4OP0A 3A32A 3HFVA 2ZT7A 1IL2A 4H2TA 2EL9A 2ARTA 3HXZA 4H2SA 4YP0A 2DTOA 2DU5A 3A7RA 4HVCA 3FJPA 4KR3A 1EIYA 1B8AA 3HXWA 3UH0A 4TQDA 3P8YA 3OD1A 4RQFA 4XTXA 4K86A 3RKYA 1PYSA 3QO8A 4P71A 3RKWA 3V8KA 2ODRC 2ZTGA 3MF2A 3NEMA 4YPFA 4YRGA 3IKMB 1X01A 2QHSA 2DXTA 4P73A 3A5ZA 2DZCA 2DVEA 1BIAA 3TEHB 1B70A 2ZNJA 1G51A 2RHQB 1GGMA 1JJCA 4HWOA 1X55A 2P5IA 2PMFA 2C8MA 1RIQA 4YDQA 4YCWA 4LNSA 4WF2A 2HNIA 2I4OA 3MF1A 3REUA 3HFZB 2E64A 2Q7GA 2DEQA 3QTCA 4HWSA 1E1TA 3A7UA 5C53B 1YGBA 4H2YA 3MQZA 1X2GA 2I4MA 3KFUA 1X2HA 1WQ7A 3VQXA 2Q7HA 2DJZA 2EJGA 4P3OA 2DQ0A 1X54A 4Q15A 4YREA 2IY5B 1JJCB 4BWAA 2J3LA 3QO5A 1ADJA 4YRTA 1N9WA 2ARUA 3E9IA 5F5WA 1KOGA 2ZT8A 4NCXA 3HXVA 4LVJA 3RKXA 1ASYA 1NJ8A 3HY0A 3NENA 4P72C 4P74C 2QHVA 5C52B 4XTYA 1B7YA 3DSQA 2ZCEA 4XU3A 2ZNIA 2DKGA 4HT4A 2ZIOA 1G5HA 3EFRA 1E22A 3HRIA 4P3NA 1NYQA 1B76A 1WNLA 3UFGA 3LSSA 2CGHA 4H2UA 3W3SA 3PCOA 4H2XA 2ALYA 2AMCA 2DU7A 3HTZA 5C51B 1SESA 2ZR3A 4KR2A 4H2VA 3V7RA 4TVWA 3QNEA 1BBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNN A;  1B7Y B;  3RF1 A;  2DTI A;  3V8L A;  4PG3 A;  1NJ2 A;  4HWP A;  3A7A A;  2ZGW A;  4EX5 A;  1ATI A;  2XGT A;  2E41 A;  1SET A;  4O2D A;  2AKW A;  3HXY A;  4RMF A;  3PCO B;  1EFW A;  1EIY B;  1H4V B;  3VBB A;  2EJ9 A;  5K1X A;  3PZC A;  1C0A A;  1YB3 A;  1WU7 A;  3A31 A;  2CJ9 A;  2PME A;  4YRI A;  3V8J A;  1KMM A;  4HA8 A;  3A5Y A;  2EAY A;  3E9H A;  3RAC A;  4ZIB A;  2ZT6 A;  4WI1 A;  1PYS B;  1SER A;  4TWA A;  5E3I A;  2ZZF A;  4J15 A;  4P72 A;  2ZZE A;  4P74 A;  1QF6 A;  4RQE A;  1W66 A;  4YRJ A;  3ERR A;  3IAL A;  2Q7E A;  2AKW B;  3TEG A;  3I7F A;  3QO7 A;  2ZT5 A;  4TVA A;  4DPG A;  3V7S A;  11AS A;  1B70 B;  1NJ1 A;  4K88 A;  4YRP A;  2RHS A;  3NET A;  1WYD A;  1NYR A;  2CJA A;  2I4L A;  4TTV A;  1Z7M A;  1LYL A;  1BBU A;  4UPA A;  3RIR A;  2ZXF A;  3ICA A;  3CMQ A;  3HY1 A;  2ARS A;  4CS2 A;  2DXU A;  4UP8 A;  3TUP A;  3P8T A;  4ZTZ B;  4TQF A;  1HC7 A;  1Z7N A;  4YRS A;  1USY C;  3NEL A;  2DQ3 A;  4G85 A;  4YRR A;  1H4Q A;  2Q5I A;  1J5W A;  4Q6G A;  4WJ4 A;  4CH5 A;  5ELO A;  5HGQ A;  4G84 A;  1ADY A;  3RL6 A;  2ZIM A;  1X56 A;  4XTZ A;  2XTI A;  3M4P A;  4YRM A;  4H2W A;  4CS4 A;  3EFS A;  1WQW A;  4CH6 A;  4XTW A;  4XTV A;  2EJF A;  3VQY A;  3TEH A;  1EQR A;  1QE0 A;  4EO4 A;  2RHQ A;  3BJU A;  4AH6 A;  3HXX A;  2DTH A;  2CIM A;  4YRL A;  4XEM A;  4ZTU B;  2QHT A;  4YRQ A;  4HWR A;  1VQZ A;  1NNH A;  4H2X B;  2ALY B;  2E10 A;  2AMC B;  1EVL A;  3HFZ A;  2G4C A;  1HTT A;  1ASZ A;  1YFS A;  4YRF A;  4P75 C;  1H4S A;  2FYK A;  3UGT A;  5ELN A;  4YRN A;  12AS A;  4CH4 A;  2ZR2 A;  1YFT A;  3REX A;  1HXD A;  2QHU A;  1SRY A;  1G5I A;  4PHC A;  4XU2 A;  2E3C A;  4CH3 A;  3UGQ A;  4H02 A;  4X5O A;  2E1H A;  1E1O A;  2IY5 A;  4YYE A;  3R07 A;  4XTU A;  4TVY A;  3IG2 A;  1NJ5 A;  4YRO A;  1E24 A;  3A74 A;  3LC0 A;  1WPY A;  3L2Z A;  3WQZ A;  4E51 A;  1KMN A;  2DZ9 A;  1USY A;  1YFR A;  3LSQ A;  1L0W A;  4P71 C;  1FYF A;  4K87 A;  2ZZG A;  3M4Q A;  2ZIN A;  4UP7 A;  2EWN A;  1WLE A;  2E5A A;  3L4G A;  1H4T A;  4P73 C;  3VQW A;  2C7I A;  1EVK A;  2E65 A;  1EOV A;  4UP9 A;  4XEO A;  3VQV A;  4KQE A;  4BW9 A;  3IKL A;  1BIB A;  2I4N A;  2P0L A;  4YRC A;  4OLF A;  3HRK A;  4WJ3 M;  3RGL A;  3L1A A;  2ODR D;  4P3P A;  5K1P A;  4TVA B;  4YCV A;  4CS3 A;  4RDX A;  3BFM A;  4XU1 A;  2RHS B;  3RUX A;  4DQ2 A;  2DDZ A;  2J3M A;  1NJ6 A;  2CJB A;  4HWT A;  3MEY A;  3HXU A;  4XU0 A;  4L87 A;  3V7C A;  3L4G B;  3G1Z A;  3P8V A;  4YRK A;  4YCU A;  4P75 A;  2Q5H A;  4OP0 A;  3A32 A;  3HFV A;  2ZT7 A;  1IL2 A;  4H2T A;  2EL9 A;  2ART A;  3HXZ A;  4H2S A;  4YP0 A;  2DTO A;  2DU5 A;  3A7R A;  4HVC A;  3FJP A;  4KR3 A;  1EIY A;  1B8A A;  3HXW A;  3UH0 A;  4TQD A;  3P8Y A;  3OD1 A;  4RQF A;  4XTX A;  4K86 A;  3RKY A;  1PYS A;  3QO8 A;  4P71 A;  3RKW A;  3V8K A;  2ODR C;  2ZTG A;  3MF2 A;  3NEM A;  4YPF A;  4YRG A;  3IKM B;  1X01 A;  2QHS A;  2DXT A;  4P73 A;  3A5Z A;  2DZC A;  2DVE A;  1BIA A;  3TEH B;  1B70 A;  2ZNJ A;  1G51 A;  2RHQ B;  1GGM A;  1JJC A;  4HWO A;  1X55 A;  2P5I A;  2PMF A;  2C8M A;  1RIQ A;  4YDQ A;  4YCW A;  4LNS A;  4WF2 A;  2HNI A;  2I4O A;  3MF1 A;  3REU A;  3HFZ B;  2E64 A;  2Q7G A;  2DEQ A;  3QTC A;  4HWS A;  1E1T A;  3A7U A;  5C53 B;  1YGB A;  4H2Y A;  1X2G A;  2I4M A;  3KFU A;  1X2H A;  1WQ7 A;  3VQX A;  2Q7H A;  2DJZ A;  2EJG A;  4P3O A;  2DQ0 A;  1X54 A;  4Q15 A;  4YRE A;  2IY5 B;  1JJC B;  4BWA A;  2J3L A;  3QO5 A;  1ADJ A;  4YRT A;  1N9W A;  2ARU A;  3E9I A;  5F5W A;  1KOG A;  2ZT8 A;  4NCX A;  3HXV A;  3RKX A;  1ASY A;  1NJ8 A;  3HY0 A;  3NEN A;  4P72 C;  4P74 C;  2QHV A;  5C52 B;  4XTY A;  1B7Y A;  3DSQ A;  2ZCE A;  4XU3 A;  2ZNI A;  2DKG A;  2ZIO A;  1G5H A;  3EFR A;  1E22 A;  3HRI A;  4P3N A;  1NYQ A;  1B76 A;  1WNL A;  3UFG A;  3LSS A;  2CGH A;  4H2U A;  3W3S A;  3PCO A;  4H2X A;  2ALY A;  2AMC A;  2DU7 A;  3HTZ A;  5C51 B;  1SES A;  2ZR3 A;  4KR2 A;  4H2V A;  3V7R A;  4TVW A;  3QNE A;  1BBW A; 
#chains in the Genus database with same CATH topology
 2WWV A;  1B7Y B;  2WSS V;  2DTI A;  4XBF B;  2X0H A;  4B3R T;  4IST A;  3V8L A;  2A72 A;  5LMU T;  1NEK A;  3KBT A;  5FXX A;  3A5X A;  3EHZ A;  5J1G A;  3VKG A;  4X65 T;  4X20 E;  4U7Y A;  2XGT A;  2E41 A;  2V1D B;  3C4X A;  1SET A;  4ZXL A;  5DJQ C;  5FL0 A;  3ZCJ A;  1I94 T;  3C4Z A;  4LF5 T;  1IJ5 A;  2CPT A;  4IDN A;  3AA7 B;  3AAE B;  1EFW A;  5HEJ A;  5AQV B;  2CEA A;  2K3W A;  5K1X A;  2BBH A;  3B5M A;  4HWH A;  2BG9 B;  4TWD A;  1MMD A;  4AKH A;  2PME A;  1MIW A;  1ZOY A;  3ZLI A;  4JYA T;  3ZYM A;  5IHY A;  3E9H A;  4ZIB A;  4KBM B;  1GQE A;  4O4J E;  3LDQ B;  5L3B B;  4IT4 A;  4ZI7 E;  2ZZE A;  1FMV A;  4N78 D;  2N2N A;  4JI5 T;  3JAF A;  3PUS A;  3RQW A;  1D0X A;  4HWD A;  3QO7 A;  2ZT5 A;  4K88 A;  1YW0 A;  2EHO D;  2JRK A;  3GA8 A;  3L09 A;  3QB5 K;  4PJM A;  1NYR A;  2NWB A;  2I4L A;  4GYS A;  5LB7 B;  2V7M A;  5LGT B;  4UPA A;  3HY1 A;  3MAC A;  3ZJ1 A;  1ZKE A;  3WAK A;  4AQF A;  1S35 A;  4JI8 T;  2BDE A;  4UP8 A;  3C51 A;  1HS7 A;  4A5X A;  3KBU A;  5L4E A;  2LSK A;  4WW0 A;  4G85 A;  4CI2 B;  3I1A A;  4U2Y A;  2ODU A;  3CQX C;  4HTE A;  4YRR A;  4F8H A;  4WJ4 A;  4CH5 A;  1L0V A;  4PJJ A;  5JR9 B;  1ADY A;  1HG5 A;  2JIW A;  2R6G F;  5LG3 A;  4ILC A;  4YSX A;  4XTZ A;  1HG2 A;  2I0M A;  3PUY F;  1SE7 A;  4X64 T;  3M4P A;  3UU8 A;  4YRM A;  4H2W A;  5AQH B;  4A97 A;  5AQP B;  3OYZ A;  2XQ6 A;  4TZ4 C;  3U78 A;  4JEU B;  5LOV E;  2BKO A;  2NW9 A;  3BQI A;  3HXX A;  2DTH A;  4H9N C;  4ERR A;  1XDP A;  1XNQ T;  4DV4 T;  1UX4 A;  4ILU A;  4CN4 A;  5FVL A;  2H3R A;  4YRQ A;  2XAF B;  4UEL A;  3RPU A;  3KVB A;  3MKD A;  3HFZ A;  1CHU A;  3O1I A;  4IL9 A;  3VKH A;  4HFE A;  2WZH A;  4TWF A;  2WCA A;  3UGT A;  4HE8 A;  2CRB A;  4X1Y E;  2Y8D A;  5J2T E;  2UUB T;  5ELN A;  4JV5 T;  5L3D B;  4CH4 A;  2NTY A;  2WZI A;  4X5T A;  1YFT A;  5KDM C;  1SRY A;  1G5I A;  3UGQ A;  5ADX L;  2E1H A;  3JAD A;  2IY5 A;  4YYE A;  5BR8 T;  3NRX A;  4O8S A;  2J4G A;  1E24 A;  1DU2 A;  4DR6 T;  4YTM A;  2J47 A;  4E51 A;  2IDO B;  3HI2 A;  1USY A;  4H9Q C;  2LOP A;  3N9M A;  2DNX A;  2V7J A;  4OYJ A;  1WYC A;  3RIF A;  2ZIN A;  4LF8 T;  4ISS A;  2A9U A;  1BR4 A;  2W61 A;  3L4G A;  3TLW A;  5AQU B;  3VQW A;  2M6I A;  4I55 E;  4MHC A;  4IRE A;  1EOV A;  3VQV A;  4AIU A;  1E2A A;  2KIN B;  2I4N A;  2WP9 A;  3PE0 A;  3L1A A;  2D0T A;  4Z8X A;  3RYC E;  2YDS A;  2WY2 A;  5K1P A;  3VR9 A;  4CS3 A;  1OED A;  3K8P C;  1W9R A;  3RUX A;  4IDP A;  1CUN A;  2PBI A;  2J3M A;  1NJ6 A;  4HWT A;  3ZJ2 A;  3OYX A;  5HXS A;  3V7C A;  2Q9Q C;  4HWI B;  3UQ4 A;  4OX9 T;  2IUB A;  2L9Q A;  4CXW A;  4YCU A;  4P75 A;  5HEG A;  1YQ4 A;  4LFB T;  4YY3 T;  4LML A;  4O4L E;  3K1S A;  2V6Y B;  1KK7 A;  1HFA A;  2ART A;  4YP0 A;  3ZMS B;  2DTO A;  2K9A A;  2DU5 A;  2FUP A;  2LE8 A;  4UV8 B;  3HXW A;  5AQS B;  2BG9 E;  2UXC T;  3M3Z B;  1VCS A;  5AQQ B;  4JBW F;  4RQF A;  3C50 A;  1XWM A;  1V9D A;  2FBW A;  2KLQ A;  3EDU A;  4QXB B;  5LGU B;  4MBQ A;  3RKW A;  3GMI A;  4EGW A;  3NEM A;  4YPF A;  3AVR A;  4EYU A;  3EVY A;  2QHS A;  4LF4 T;  1NWM X;  1H7C A;  4P73 A;  1D0Z A;  3AEE A;  2DZC A;  2DVE A;  3TEH B;  2ZNJ A;  4UXN B;  2RHQ B;  4GIW A;  4HFV A;  4L5G A;  4CXY A;  3L3P A;  3AEF A;  1X55 A;  2BG9 C;  3E08 A;  5L3E B;  2IAK A;  1RIQ A;  2VVS A;  2HNI A;  3AVS A;  5JQG E;  4HKA A;  1QSD A;  3QTC A;  1BR2 A;  4HWS A;  3B57 A;  4YHH T;  2VQE T;  1YGB A;  2E9X A;  4PK6 A;  4H2Y A;  3MQZ A;  5EK4 A;  1JNZ A;  4X66 T;  4GKJ T;  1MND A;  3UU6 A;  4Q15 A;  2MYS A;  2XQ7 A;  4CXX A;  4BAY B;  3CQC B;  2Z6E A;  3EI0 A;  1N9W A;  3TLU A;  2ARU A;  5F5W A;  2ZT8 A;  4NCX A;  2NW7 A;  2BVL A;  3RKX A;  1Y01 A;  2LSI A;  2Y48 B;  2VWA A;  2IC6 A;  5GON E;  4A98 A;  4H63 V;  3DSQ A;  5DAB A;  3LFM A;  2ZIO A;  4HT4 A;  4DV0 T;  2DL1 A;  4P3N A;  3N9P A;  5JR9 C;  3AA0 B;  2YDQ A;  2CGH A;  3W3S A;  5KX5 E;  3ZEF B;  5JRE A;  3HTZ A;  5C51 B;  3C64 A;  2V5C A;  3MK7 C;  2JQ9 A;  4U2Z A;  3NZP A;  4JI1 T;  4H9S E;  4TVW A;  3ZMT B;  1G73 A;  4TNW A;  1YQ3 A;  3ZN0 B;  4LF7 T;  2MPK A;  2HPL A;  1Z0P A;  5LXT E;  4LVK A;  4EEB A;  4PW8 A;  1B7T A;  4I43 B;  1XMO T;  5FXZ A;  4PG3 A;  4IGU A;  3R84 B;  4DV2 T;  1NJ2 A;  3RKO A;  1MNE A;  4IE4 A;  3AE8 A;  3RIA A;  5LG4 A;  2NS6 A;  4O2D A;  3ZKR A;  4KHZ F;  3HXY A;  5LA6 E;  2E8I A;  5IYZ E;  4C90 A;  3VBB A;  4B3M T;  5AQG B;  3VU7 H;  2X67 A;  2YK0 A;  3VHL A;  1M7K A;  2CHN A;  2LM2 A;  3RRW A;  1YB3 A;  2UUC T;  4ZZC A;  2CJ9 A;  2LKH A;  1WYB A;  5JDH A;  3RAC A;  2LT3 A;  5FVK A;  1PYS B;  2LHN A;  4TWA A;  1SUM B;  2W00 A;  2ZZF A;  4OFZ A;  4G63 A;  4NIQ A;  4P72 A;  1T8B A;  2A8E A;  5LJN A;  1YKH B;  4RQE A;  4WYV A;  3ANW B;  3H3M A;  3J7Y q;  4YRJ A;  3ERR A;  5CB4 E;  4UVC B;  11AS A;  4JI6 T;  4AKL A;  2VKO A;  3ZT5 A;  1KEY A;  4O2B E;  3NKZ A;  3UUX B;  3PUV F;  1Z7M A;  2WDQ A;  3UTK A;  3RIR A;  4DND A;  2OA5 A;  3ICA A;  4AI6 A;  4AQY T;  2Y6X A;  2ARS A;  2X68 A;  4WBN E;  4ZTZ B;  4DBR A;  5ABE A;  2X9W A;  3UFE A;  4I0U A;  2VB6 A;  1Z7N A;  2Q9Q B;  2ACX A;  2WWU A;  2D5U A;  1H4Q A;  3RC3 A;  3Q5E A;  5KXJ A;  3QNU A;  4QH4 A;  4G84 A;  5H6R B;  2JJ9 A;  3KV9 A;  4HN9 A;  2B1E A;  3RL6 A;  2ZIM A;  4H63 H;  1X56 A;  2LSJ A;  3ZST A;  5AQN B;  2XTI A;  2LLY A;  5JTG A;  1D1C A;  3EFS A;  4CH6 A;  3VQY A;  5CJ5 A;  3WAJ A;  2XAG B;  4DV1 T;  3M65 A;  1ZHC A;  3Q5D A;  1HTJ F;  3BJU A;  2VK9 A;  3EDV A;  2CIM A;  4XEM A;  1MIV A;  1BBW A;  4ZTU B;  1MMG A;  2B76 A;  2QHT A;  2P9B A;  3LK2 B;  4HWR A;  1Y64 B;  1VQZ A;  3N9L A;  4AKI A;  4H2X B;  3U3I A;  2AMC B;  4Z90 A;  1H4S A;  3GN5 B;  3KDS E;  4YRN A;  2X66 A;  4JI2 T;  5LGN B;  4DV5 T;  5FNV E;  3LBX A;  3ETV A;  5LJM A;  3C4W A;  1BR1 A;  5FY7 A;  3UT5 E;  1HXD A;  4DV3 T;  3D0T A;  4JEH B;  4CH3 A;  2JMH A;  3RKG A;  3RLF F;  1E1O A;  3AE7 A;  2Q9Q D;  2QGS A;  4YTP A;  2DHR A;  5AQI B;  4IDZ A;  4LFA T;  2NW8 A;  4TVY A;  3IG2 A;  4YRO A;  4JLE A;  1WPY A;  1M62 A;  2N9D A;  3AE5 A;  1KMN A;  2DZ9 A;  3P7I A;  4WZX A;  1T98 A;  3A7M A;  1FYF A;  2MAW A;  2VQF T;  1VRB A;  3CKD A;  3M4Q A;  5LHH B;  2FJE A;  2E5A A;  1NAF A;  3TLT A;  2C0S A;  1H4T A;  5ABF A;  4PJL A;  2C7I A;  2KT9 A;  1EVK A;  4TWH A;  3OTO T;  3QC9 A;  4IDQ A;  3HKC E;  5AQR B;  4KQE A;  2XQ5 A;  1FMW A;  1WFD A;  4YRC A;  3ZC0 A;  2EHO A;  3ZT7 A;  3RGL A;  3P8C D;  5TAO A;  3ZCI A;  4I4T E;  2NP9 A;  1MMA A;  2WDR A;  5AQO B;  4TVA B;  4PNI A;  3AEB A;  2HN2 A;  4UF0 B;  5JRC B;  2RHS B;  4NXN T;  3FBZ A;  2CJB A;  3MEY A;  5LYJ E;  2C5I T;  5FKY A;  4LVI A;  4EV6 A;  4L87 A;  4B3S T;  4U74 A;  3L4G B;  3P8V A;  3ZN1 B;  3A32 A;  3HFV A;  2V7L A;  4P09 A;  5LP6 E;  3AE4 A;  4EZH A;  4DV7 T;  2EL9 A;  3ONL C;  3CPZ A;  4H2S A;  3MA9 A;  4YSZ A;  2X9Y A;  2JQH A;  3OVU A;  3A7R A;  4HVC A;  4KR3 A;  1B8A A;  4LF6 T;  4GOU A;  2K48 A;  3UUB A;  2JQQ A;  5AQM B;  3T1Y T;  2YIN A;  3OD1 A;  4CN6 A;  2XAS B;  5LCY A;  4XTX A;  2CHO A;  2V5D A;  4HFD A;  1KNR A;  4XAX B;  4K86 A;  3CK6 A;  3NBX X;  2KWI B;  2KZ7 B;  4HFC A;  4GK0 E;  4P71 A;  3OKQ A;  4AKG A;  5A1L A;  1UK5 A;  3HKB E;  1YKE B;  1X01 A;  3PJA J;  4DMV A;  2WBL A;  3UQ7 A;  2W2U A;  1BR0 A;  2L8K A;  3P4S A;  2WS3 A;  4ZOL E;  2N1G A;  5M4Y A;  2DXT A;  2SPC A;  5HYA A;  2V7I A;  4IHJ E;  3N9N A;  4EOZ B;  1BIA A;  1VOM A;  3E22 E;  1J1J A;  2XZE A;  5HWX A;  1LVK A;  2PMF A;  3ZC1 A;  1X9B A;  4CN1 A;  3PUA A;  4YDQ A;  4LNS A;  3KV6 A;  4QHO A;  5FY1 A;  3MF1 A;  3REU A;  2IW5 B;  2E64 A;  2WDV A;  3E0Z A;  4U3C A;  3NRY A;  4U31 A;  4DR2 T;  3A7U A;  4ILB A;  3ONJ A;  4H9O C;  4GYR A;  2XY8 B;  2VAS A;  2F4V T;  5JDG A;  2W0G A;  1X2G A;  2L3L A;  1IJ6 A;  1WQ7 A;  2K24 A;  1HNW T;  4YT0 A;  4P3O A;  3ZSS A;  2PTF A;  2XHE B;  1LVF A;  4YRE A;  2JMK A;  4BWA A;  2I59 A;  2K5B B;  1HR0 T;  4KI0 F;  1ADJ A;  2V7K A;  4M1P A;  4EED A;  3KV4 A;  4DR1 T;  4WNK A;  1XMQ T;  1NJ8 A;  2QHV A;  2DI4 A;  2XUE A;  3T8O A;  1FIO A;  2X9H A;  5L3G B;  5IUX A;  4TN7 B;  2H88 A;  3CX7 B;  4COF A;  1G5H A;  4ZI2 C;  1B76 A;  1WNL A;  4G2A A;  3UFG A;  5C2T A;  2LKG A;  3PCO A;  4YJ3 E;  4ZS2 A;  4KR2 A;  5H6Q B;  3N9Q A;  2VL8 A;  3QNE A;  5KNN A;  4AQF C;  4PFO A;  2D2S A;  3RF1 A;  4JI0 T;  5HWY A;  3A7A A;  3O4X E;  2YDR A;  5HXE A;  4EX5 A;  1ATI A;  3RIU A;  2XM2 A;  4EIW A;  2AKW A;  2YEV C;  4RMF A;  2CA5 A;  5ABG A;  3ONX A;  4U7I A;  3N2K E;  1N33 T;  4O4I E;  1EIY B;  3I0Q A;  3F57 A;  5FY0 A;  3ZYL A;  4MAL A;  3A31 A;  2YU2 A;  3V8J A;  3PUX F;  4HA8 A;  2VVN A;  4JI4 T;  5ETW A;  4WI1 A;  4P74 A;  1QF6 A;  2G0U A;  3RYF E;  3IAL A;  2Q7E A;  1VCT A;  4IE0 A;  5JH7 E;  1WR0 A;  2C5K T;  4U33 A;  1B70 B;  2IML A;  4QWN B;  1FEW A;  3C98 B;  4EZ4 A;  2XAQ B;  3AA1 B;  2CJA A;  4TTV A;  1BBU A;  2LM9 A;  4X1K E;  2LHR A;  4HFI A;  5J0Z A;  5FYM A;  3OPC A;  3RHW A;  3CIR A;  4CI1 B;  3CMQ A;  1U4Q A;  3UU3 A;  4ANJ A;  1LRZ A;  3BQL A;  3FZH B;  4YJ2 E;  4CS2 A;  2DXU A;  4F6R C;  1HC7 A;  5HXC A;  3AA6 B;  4I50 E;  2LSY A;  1USY C;  2DQ3 A;  3CWZ B;  4UVA B;  4DID B;  4Q6G A;  4ZHQ E;  4TV8 E;  5HCJ A;  4LF9 T;  5ELO A;  4DUY T;  5HGQ A;  3ZMV B;  3V5S A;  4PJN A;  3V5U A;  4KMC A;  4ILA A;  2XJ7 A;  4CQI A;  4IE5 A;  2UXB T;  2XQY A;  4UV9 B;  1WQW A;  4XTV A;  2YKS A;  2EJF A;  3QOF A;  2NR4 A;  1T7S A;  3TEH A;  2CM0 A;  2V26 A;  3QB5 A;  3B13 A;  1D0Y A;  4EO4 A;  4E7Z A;  3G06 A;  2RHQ A;  4AH6 A;  4QX7 B;  4YRL A;  4X62 T;  3FXD B;  4K0U A;  4DBQ A;  1QLB A;  3SRZ A;  2LRL A;  5JDL A;  3NVO A;  2DLR A;  1NNH A;  3EUH A;  3VRB A;  2ALY B;  4O4H E;  2CWY A;  1EVL A;  3PUR A;  2LOS A;  4P75 C;  4HGA A;  1XDO A;  3N5L A;  4OHF A;  2LEH A;  2C5J A;  5FP3 A;  1KNZ A;  2LRK A;  2PFV A;  12AS A;  2ZR2 A;  5AQJ B;  4ZZB A;  2QHU A;  3SOL A;  3KV5 A;  2E3C A;  3FB2 A;  3O1J A;  4H02 A;  3AAI A;  4Q25 A;  3ESL A;  4EXT A;  3R07 A;  1FJG T;  3AE1 A;  4PK4 A;  5HEU A;  4OK0 A;  4AQG A;  3A74 A;  4LVM A;  3WQZ A;  3TKL B;  1KF6 A;  2MBG A;  1L0W A;  2NOX A;  2BBJ A;  4K87 A;  3AE2 A;  1HF8 A;  3KIN B;  3MZK B;  4DR3 T;  4P73 C;  2E65 A;  3ZT6 A;  4O2A E;  3HA4 A;  3MXZ A;  5HXR A;  2VKJ A;  3P4R A;  2H7V C;  4LMK A;  5HEH A;  4BW9 A;  2UXN B;  2DCF A;  2P0L A;  3N2G E;  2QVA A;  3PUZ F;  3LK4 2;  3AEG A;  3RH3 A;  3PJA A;  2OV9 A;  5FXW A;  3UUM A;  4RDX A;  3BFM A;  3P4W A;  5CGM A;  4XU1 A;  3L8R A;  1WCR A;  3H37 A;  2BKP A;  2DDZ A;  2CXD A;  3TLV A;  2JQK A;  2E9X C;  1J5E T;  3G1Z A;  4QKN A;  1KFY A;  2CXL A;  2X0Y A;  3AXJ A;  3UU5 A;  3RI5 A;  4GKK T;  2XQ8 A;  5FL1 A;  4H2T A;  1HX1 B;  5EK3 A;  3ZMZ B;  2RA1 A;  2XAJ B;  4H9R C;  1ZV4 X;  3AE3 A;  1IBK T;  2QRX A;  4JI7 T;  3RKY A;  1D1B A;  2QA7 A;  2XTL A;  1PYS A;  2XQ3 A;  2KND A;  4Z91 A;  3V8K A;  2ODR C;  3KFW X;  2ZTG A;  3MF2 A;  4YRG A;  2VUR A;  2WB5 A;  3IKM B;  4NUU A;  3ANW A;  2XAH B;  2XM1 A;  4BJM A;  3SFE A;  3A5Z A;  1LKX A;  4UIG A;  1G51 A;  4X1I E;  2LJL A;  2PG8 A;  2BS4 A;  3TLS A;  1JJC A;  4HWO A;  2P5I A;  4LMJ A;  3A8Y C;  3IA3 A;  2CCQ A;  3LK3 B;  3CX8 B;  4YFS A;  1IAP A;  3FZL B;  4ZI2 D;  2I4O A;  4WF2 A;  2UUA T;  5EZY E;  3HFZ B;  3O9X A;  2DEQ A;  4FI5 A;  1U5P A;  4KUM B;  2X51 A;  1E1T A;  1IBM T;  3JAE A;  4AIS A;  5C53 B;  5FXV A;  4DUZ T;  3N2O A;  1OXZ A;  2Q9Q A;  3X1D A;  3J9X 1;  2I4M A;  1X2H A;  2DJZ A;  4IIJ E;  2EJG A;  1NEN A;  4HWC A;  4QXH B;  1X54 A;  5HCM A;  1UX5 A;  2IY5 B;  3AED A;  2BS2 A;  2J3L A;  2CBJ A;  4YRT A;  4YTN A;  2E5V A;  3E9I A;  2M6B A;  2GK9 A;  4J2C A;  3IBP A;  2ODV A;  1YXR A;  3HY0 A;  4P72 C;  2AE9 A;  5JDQ A;  5C52 B;  4XTY A;  1B7Y A;  5AQK B;  5LNK A;  1MMN A;  3IEE A;  3FBL A;  3RC8 A;  1N34 T;  5J2U E;  2ZNI A;  3IHR A;  3AB3 B;  3LJC A;  1T72 A;  1E22 A;  5HAX A;  2XSB A;  5BMV E;  4U72 A;  4DMW A;  1Z8U A;  5C8Y E;  2UXD T;  2H89 A;  2YN6 A;  4ZI3 D;  5AFU L;  3EAB A;  3K3N A;  4HWF A;  1MIY A;  3LSS A;  3AEC A;  4H2X A;  2AMC A;  2V8S V;  3MJX A;  1SES A;  3IF8 B;  2ZR3 A;  1IBL T;  1OED B;  3GN5 A;  2WM9 A;  4H9P C;  1HNZ T;  4H2V A;  3AEA A;  2BG9 A;  1EZ3 A;  1W0B A;  2VKH A;  1JNR A;  2IIU A;  2ZM6 T;  5DQV A;  1UCU A;  4LVL A;  4TV9 E;  2J1D G;  4HWP A;  1WLX A;  2KSR A;  5JDN A;  3WI3 A;  2CLY C;  3PUG A;  2ZGW A;  3I9Y A;  2BS3 A;  3N9O A;  2LSG A;  1R8I A;  1HCI A;  5L3F B;  3PCO B;  5AQT B;  1ZEE A;  4EAH A;  2A2F X;  4V1A v;  3Q2M A;  1H4V B;  2HH7 A;  4QH5 A;  2EJ9 A;  4IE7 A;  2W66 A;  3PZC A;  4ZS3 A;  1C0A A;  2DWK A;  3VR8 A;  3F2E A;  4YHJ A;  1WU7 A;  1QUU A;  4YRI A;  1KMM A;  5CA0 E;  3A5Y A;  3DP7 A;  2EAY A;  3F31 A;  3Q9D A;  2ZT6 A;  1O3X A;  4B6X A;  1SER A;  3K3Q C;  5E3I A;  2CXF A;  1HNX T;  3H3A A;  4J15 A;  2PJQ A;  3HR0 A;  1US7 B;  2W63 A;  5LMN T;  4YLH A;  4ADZ A;  1W66 A;  3PTR B;  2X0L B;  4NPP A;  5EK2 A;  2AKW B;  2A3D A;  3TEG A;  3I7F A;  2IHR 1;  4TVA A;  4DPG A;  3V7S A;  5CA1 E;  1UUS A;  1NJ1 A;  4UF0 A;  5JRC A;  1OWA A;  4YRP A;  2RHS A;  5LBM A;  3NET A;  1WYD A;  5JR9 A;  1ZP0 A;  3OJA A;  3I9W A;  1LYL A;  2XQ4 A;  2ZXF A;  4QXC B;  2WQY A;  2UXX B;  4DV6 T;  3CX6 B;  2E2A A;  4MFR A;  3TUP A;  3P8T A;  4L0R A;  3Q5W A;  4TQF A;  3UU4 A;  2E9X B;  4YRS A;  3NWI A;  3ETU A;  3NEL A;  5KMG P;  4EYY R;  2Q5I A;  1J5W A;  4PAG A;  2AXD S;  3P4P A;  4DR4 T;  4HFH A;  1SHZ C;  3RX6 A;  5CFB A;  2CBI A;  3ZMU B;  2ZM8 A;  2DWG A;  5ABH A;  2W62 A;  2W4X A;  2YU1 A;  3FZM B;  4CS4 A;  2M67 A;  2EHO C;  4XTW A;  4PFP A;  1EQR A;  5JVD E;  4AKR B;  1QE0 A;  2V6X A;  1XZY A;  2CWO A;  5LBQ B;  1IZN B;  3PU8 A;  2XSA A;  3RYH E;  3FXE B;  3I0O A;  2IC9 A;  2NTX A;  3RRC A;  2E10 A;  3ZPO A;  2G4C A;  1HTT A;  1ASZ A;  1YFS A;  4YRF A;  2FYK A;  3JC6 D;  2ZLY A;  2FJA A;  5F3J A;  4XZC A;  5F8P A;  3P50 A;  3LSV A;  4KP3 C;  3OBV E;  5HEO A;  4ZI3 C;  2HPJ A;  3FHN A;  3REX A;  4DVD A;  1YD8 G;  4DO0 A;  4PHC A;  4XU2 A;  3GWH A;  1D1A A;  4X5O A;  3DTO A;  2E9X D;  4EB6 E;  4JI3 T;  4QH1 A;  5JDM A;  4XTU A;  1S94 A;  1N36 T;  1NJ5 A;  3LC0 A;  1KNP A;  3L2Z A;  4P0A A;  2ZMA A;  4MLK A;  2D9D A;  4GK5 E;  2BVM A;  2RPA A;  1YFR A;  3LSQ A;  4E7S A;  4P71 C;  1E1H B;  2XQA A;  2ACZ A;  2HHH T;  4AXP A;  4YXD A;  1N32 T;  4HEA A;  4L9I A;  2ZZG A;  4UR9 A;  4CI3 B;  4UP7 A;  2EWN A;  1WLE A;  3K3O A;  2QYW A;  3R6N A;  4B3T T;  3BK9 A;  3NZQ A;  3ZYK A;  4UP9 A;  4XEO A;  3AAA B;  3IKL A;  4LFC T;  1BIB A;  2V6Y A;  3P4Q A;  5AQF B;  4OLF A;  1AJ3 A;  4BA9 A;  3HRK A;  4WJ3 M;  2ODR D;  3S4U A;  1OED E;  2WMO A;  4P3P A;  4YCV A;  3CML A;  5DQW A;  2XPK A;  4KX6 A;  4TUY E;  4ZEY A;  4DQ2 A;  4QX8 B;  2ZM0 A;  1W0A A;  3HXU A;  4XU0 A;  3AE9 A;  4FJO A;  2OLT A;  3PDY A;  1WR6 A;  4DR7 T;  2KWH A;  4YRK A;  2UU9 T;  3SFD A;  3HL6 A;  2Q5H A;  4OP0 A;  3JCF A;  2ZM2 A;  4DR5 T;  2WAU A;  5IWA T;  4P0B A;  2ZT7 A;  5LHI B;  3ABV A;  1IL2 A;  4UEM A;  3HXZ A;  5E0O A;  3FJP A;  1EIY A;  3KVA A;  1OED C;  3UH0 A;  2D0U A;  5LHG B;  4TQD A;  3P8Y A;  2CLY B;  2VL0 A;  3RQU A;  3O1H A;  4YSY A;  4IE6 A;  3QO8 A;  3AXJ B;  4IDO A;  5HXH A;  4K0K T;  2I6H A;  1E7P A;  2H7O A;  2WU2 A;  4PK5 A;  2CMR A;  3UUN A;  1B70 A;  2BZB A;  5JDF A;  1W09 A;  4C91 A;  1GGM A;  2VKD A;  1HX8 A;  4KHP T;  1X79 A;  2KMF A;  3EAM A;  5FMN A;  5L47 A;  3SS1 A;  3FZF B;  2C8M A;  1UGO A;  4YCW A;  2FJD A;  4BJN A;  1G8X A;  3FZK B;  4IL4 A;  2BKN A;  2RP4 A;  2E5L T;  4TX5 A;  2Q7G A;  4UVB B;  3L39 A;  3PUW F;  3PV0 F;  4OYK A;  2WMN A;  5AQL B;  3RIU C;  4HFB A;  2J62 A;  2MTQ A;  2X9X A;  3VRA A;  3QK6 A;  3LBX B;  3KFU A;  3DJB A;  1SA0 E;  3VQX A;  2Q7H A;  3BQK A;  4TNV A;  2DQ0 A;  3PU3 A;  1JJC B;  4WBO A;  3QO5 A;  3JC6 C;  2HN1 A;  5L3C B;  2FJB A;  3PUQ A;  4JUY A;  1KOG A;  4CZZ B;  3HXV A;  4LVJ A;  2ES0 A;  4A56 A;  1ASY A;  3NEN A;  4P74 C;  2WU5 A;  3SWH A;  4NXM T;  5L4H A;  1I6Z A;  2ZCE A;  4XU3 A;  2DKG A;  1WRD A;  3CQG B;  2YOE A;  5ABF B;  3HKE E;  2KXP B;  5C3J A;  3UUL A;  3EFR A;  1UUR A;  3HRI A;  2XQ9 A;  3HKD E;  1NYQ A;  2JPF A;  2CE7 A;  4ASK A;  3QUJ A;  2W67 A;  1XNR T;  2EHO B;  4H2U A;  3AE6 A;  3Q5X A;  3CVR A;  4NUV A;  2ALY A;  2DU7 A;  4P1N A;  3RYI E;  3W15 B;  2MOZ A;  3V7R A;  3LG7 A;  3T1H T;  5L2L A; 
#chains in the Genus database with same CATH homology
 5KNN A;  1B7Y B;  3RF1 A;  2DTI A;  4LVK A;  4LVL A;  3V8L A;  4PG3 A;  1NJ2 A;  4HWP A;  3A7A A;  2ZGW A;  4EX5 A;  1ATI A;  2XGT A;  2E41 A;  2NS6 A;  1SET A;  4O2D A;  2AKW A;  3HXY A;  4RMF A;  3PCO B;  1EFW A;  1EIY B;  1H4V B;  3VBB A;  2EJ9 A;  5K1X A;  3PZC A;  1C0A A;  1YB3 A;  1WU7 A;  3A31 A;  2CJ9 A;  2PME A;  4YRI A;  3V8J A;  1KMM A;  4HA8 A;  3A5Y A;  2EAY A;  3E9H A;  3RAC A;  4ZIB A;  2ZT6 A;  4WI1 A;  1PYS B;  1SER A;  4TWA A;  5E3I A;  2ZZF A;  4J15 A;  4P72 A;  2ZZE A;  4P74 A;  2A8E A;  1QF6 A;  4RQE A;  1W66 A;  4YRJ A;  3ERR A;  3IAL A;  2Q7E A;  2AKW B;  3TEG A;  3I7F A;  3QO7 A;  2ZT5 A;  4TVA A;  4DPG A;  3V7S A;  11AS A;  1B70 B;  1NJ1 A;  4K88 A;  4YRP A;  2RHS A;  3NET A;  1WYD A;  1NYR A;  2CJA A;  2I4L A;  4TTV A;  1Z7M A;  1LYL A;  1BBU A;  4UPA A;  3RIR A;  2ZXF A;  3ICA A;  3CMQ A;  3HY1 A;  2ARS A;  4CS2 A;  2DXU A;  4UP8 A;  3TUP A;  3P8T A;  4ZTZ B;  4TQF A;  1HC7 A;  1Z7N A;  4YRS A;  1USY C;  3NEL A;  2DQ3 A;  4G85 A;  4YRR A;  1H4Q A;  2Q5I A;  1J5W A;  4Q6G A;  4WJ4 A;  4CH5 A;  5ELO A;  5HGQ A;  4G84 A;  1ADY A;  3RL6 A;  2ZIM A;  1X56 A;  4XTZ A;  2XTI A;  3M4P A;  4YRM A;  4H2W A;  4CS4 A;  3EFS A;  1WQW A;  4CH6 A;  4XTW A;  4XTV A;  2EJF A;  3VQY A;  3TEH A;  1EQR A;  1QE0 A;  4EO4 A;  2RHQ A;  3BJU A;  4AH6 A;  3HXX A;  2DTH A;  2CIM A;  4YRL A;  4XEM A;  4ZTU B;  2QHT A;  4YRQ A;  4HWR A;  1VQZ A;  1NNH A;  4H2X B;  2ALY B;  2E10 A;  2AMC B;  1EVL A;  3HFZ A;  2G4C A;  1HTT A;  1ASZ A;  1YFS A;  4YRF A;  4P75 C;  1H4S A;  2FYK A;  3UGT A;  5ELN A;  4YRN A;  12AS A;  4CH4 A;  2ZR2 A;  1YFT A;  3REX A;  1HXD A;  2QHU A;  1SRY A;  1G5I A;  4PHC A;  4XU2 A;  2E3C A;  4CH3 A;  3UGQ A;  4H02 A;  4X5O A;  2E1H A;  1E1O A;  2IY5 A;  4YYE A;  3R07 A;  4XTU A;  4TVY A;  3IG2 A;  1NJ5 A;  4YRO A;  1E24 A;  3A74 A;  3LC0 A;  4LVM A;  1WPY A;  3L2Z A;  3WQZ A;  4E51 A;  1KMN A;  2DZ9 A;  1USY A;  1YFR A;  3LSQ A;  1L0W A;  4P71 C;  1FYF A;  4K87 A;  2ZZG A;  3M4Q A;  2ZIN A;  4UP7 A;  2EWN A;  1WLE A;  2E5A A;  3L4G A;  1H4T A;  4P73 C;  3VQW A;  2C7I A;  1EVK A;  2E65 A;  1EOV A;  4UP9 A;  4XEO A;  3VQV A;  4KQE A;  4BW9 A;  3IKL A;  1BIB A;  2I4N A;  2P0L A;  4YRC A;  4OLF A;  3HRK A;  4WJ3 M;  3RGL A;  3L1A A;  2ODR D;  4P3P A;  5K1P A;  4TVA B;  4YCV A;  4CS3 A;  4RDX A;  3BFM A;  4XU1 A;  2RHS B;  3RUX A;  4DQ2 A;  2DDZ A;  2J3M A;  1NJ6 A;  2CJB A;  4HWT A;  3MEY A;  4LVI A;  3HXU A;  4XU0 A;  4L87 A;  3V7C A;  3L4G B;  3G1Z A;  3P8V A;  4YRK A;  4YCU A;  4P75 A;  2Q5H A;  4OP0 A;  3A32 A;  3HFV A;  2ZT7 A;  1IL2 A;  4H2T A;  2EL9 A;  2ART A;  3HXZ A;  4H2S A;  4YP0 A;  2DTO A;  2DU5 A;  3A7R A;  4HVC A;  3FJP A;  4KR3 A;  1EIY A;  1B8A A;  3HXW A;  3UH0 A;  4TQD A;  3P8Y A;  3OD1 A;  4RQF A;  4XTX A;  4K86 A;  3RKY A;  1PYS A;  3QO8 A;  4P71 A;  3RKW A;  3V8K A;  2ODR C;  2ZTG A;  3MF2 A;  3NEM A;  4YPF A;  4YRG A;  3IKM B;  1X01 A;  2QHS A;  2DXT A;  4P73 A;  3A5Z A;  2DZC A;  2DVE A;  1BIA A;  3TEH B;  1B70 A;  2ZNJ A;  1G51 A;  2RHQ B;  1GGM A;  1JJC A;  4HWO A;  1X55 A;  2P5I A;  2PMF A;  2C8M A;  1RIQ A;  4YDQ A;  4YCW A;  4LNS A;  4WF2 A;  2HNI A;  2I4O A;  3MF1 A;  3REU A;  3HFZ B;  2E64 A;  2Q7G A;  2DEQ A;  3QTC A;  4HWS A;  1E1T A;  3A7U A;  5C53 B;  1YGB A;  4H2Y A;  3MQZ A;  1X2G A;  2I4M A;  3KFU A;  1X2H A;  1WQ7 A;  3VQX A;  2Q7H A;  2DJZ A;  2EJG A;  4P3O A;  2DQ0 A;  1X54 A;  4Q15 A;  4YRE A;  2IY5 B;  1JJC B;  4BWA A;  2J3L A;  3QO5 A;  1ADJ A;  4YRT A;  1N9W A;  2ARU A;  3E9I A;  5F5W A;  1KOG A;  2ZT8 A;  4NCX A;  3HXV A;  4LVJ A;  3RKX A;  1ASY A;  1NJ8 A;  3HY0 A;  3NEN A;  4P72 C;  4P74 C;  2QHV A;  5C52 B;  4XTY A;  1B7Y A;  3DSQ A;  2ZCE A;  4XU3 A;  2ZNI A;  2DKG A;  4HT4 A;  2ZIO A;  1G5H A;  3EFR A;  1E22 A;  3HRI A;  4P3N A;  1NYQ A;  1B76 A;  1WNL A;  3UFG A;  3LSS A;  2CGH A;  4H2U A;  3W3S A;  3PCO A;  4H2X A;  2ALY A;  2AMC A;  2DU7 A;  3HTZ A;  5C51 B;  1SES A;  2ZR3 A;  4KR2 A;  4H2V A;  3V7R A;  4TVW A;  3QNE A;  1BBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...