1J5WA

Crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
276
Chain Sequence
MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha chain
total genus 95
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 1j5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1j5wA01
2DU5A 4J15A 3EFSA 4P71C 4XTVA 4P71A 2XTIA 3M4QA 3HXWA 2PMFA 4CH6A 4CS3A 1X2HA 3E9HA 1HTTA 3W3SA 2CGHA 3PCOA 3VQYA 1E22A 2DTHA 3IKMB 1NJ2A 2DXTA 3A31A 3A7UA 4HWRA 1EIYA 3HFZB 4YROA 4RDXA 2C8MA 2G4CA 1G51A 4WJ4A 2CJBA 1W66A 2ZXFA 3NEMA 3L1AA 2ZZFA 4HVCA 1H4SA 2J3MA 1J5WA 4OP0A 4ZIBA 2CJAA 1BBWA 4ZTUB 3RGLA 1HXDA 1NJ5A 4TVWA 2EAYA 4YRMA 5HGQA 1B70B 4YCVA 5C52B 3VBBA 4X5OA 1YFSA 1H4VB 3PCOB 2DZ9A 4TTVA 1E24A 2DVEA 3HFZA 4HWSA 2DTIA 1NYQA 1EIYB 4XEOA 3PZCA 4H2YA 3QO5A 3V8LA 4G85A 11ASA 2EJ9A 4KR3A 2ZZEA 3A5ZA 1SETA 1B7YA 3FJPA 1H4TA 4HA8A 2Q7GA 2AKWA 3LSQA 5C51B 3VQXA 4PG3A 2ZT5A 4TQDA 2IY5B 3HFVA 4YRKA 2ZT8A 4KQEA 3HXVA 4XU2A 4K86A 2ARUA 1HC7A 1YB3A 3TUPA 4BWAA 2I4NA 3VQWA 4HWPA 4CH4A 4H2XA 3RKYA 1G5IA 3NELA 4K87A 3A7RA 2DJZA 2ZTGA 4H2VA 1YGBA 1ADYA 3A5YA 1WU7A 2C7IA 4HWTA 3HRIA 4H2UA 3KFUA 2I4LA 4RMFA 3HTZA 4YRJA 4YRNA 1EVKA 1NJ1A 2DQ3A 5ELNA 3I7FA 3V7CA 4TVAA 1NYRA 3HXZA 2DXUA 1X2GA 1QE0A 2Q7EA 2Q5IA 4EO4A 1BIAA 2RHQB 4YRCA 1EOVA 4H2WA 1E1OA 4YDQA 2RHSA 3UH0A 2E1HA 3R07A 3DSQA 3V7SA 2E41A 2EJFA 3MF1A 4H2TA 5C53B 2E3CA 1WYDA 3QTCA 3RKXA 1JJCB 3RACA 3UFGA 2ZR3A 12ASA 2AMCA 4P74A 3M4PA 3REUA 3RL6A 2E5AA 3QO7A 4P72A 2ZT6A 4YRIA 4XU3A 1BIBA 3HXYA 4TVYA 2ODRD 1EFWA 4H2XB 2E65A 4XTYA 3QO8A 3HRKA 5K1XA 4YRQA 3P8VA 4YRTA 4WJ3M 2DKGA 2DQ0A 1X01A 4P74C 4L87A 3EFRA 2AKWB 3HY0A 3BFMA 2P0LA 3LSSA 1B7YB 3P8TA 2PMEA 4P75C 1WQWA 2DU7A 4P75A 1YFRA 4YCUA 2DZCA 2ZGWA 1NJ8A 4KR2A 4H02A 4WF2A 3TEHA 3V8KA 1YFTA 2CJ9A 3VQVA 3ERRA 4P73C 2EWNA 3LC0A 1EQRA 1ASYA 1ATIA 4E51A 3A32A 1SERA 2XGTA 3TEGA 2ZT7A 4XU1A 4UP8A 1B8AA 3E9IA 1USYC 4CH3A 1KMMA 1WQ7A 1B76A 1B70A 4YP0A 3QNEA 3IALA 2ZR2A 4NCXA 2QHTA 2ARTA 1RIQA 2ZZGA 4BW9A 1Z7MA 4LNSA 4Q15A 1KMNA 2E64A 3ICAA 4Q6GA 2EJGA 4K88A 2ZINA 4YRPA 3MF2A 3RUXA 1H4QA 4XU0A 2FYKA 2CIMA 4YRFA 2ARSA 4YPFA 1EVLA 3L2ZA 2ALYB 2DEQA 2I4OA 2AMCB 4XTZA 3TEHB 2Q5HA 3P8YA 4YYEA 1Z7NA 4CH5A 1QF6A 3HXUA 4EX5A 2ZNJA 1IL2A 4OLFA 4G84A 3L4GA 3RF1A 3OD1A 1BBUA 4CS4A 1WPYA 1KOGA 1LYLA 4YRLA 1SESA 3UGTA 1GGMA 2E10A 1PYSB 3NENA 2EL9A 2ZNIA 4TQFA 1X55A 4UPAA 4HWOA 3WQZA 4YRSA 3IG2A 3HXXA 4WI1A 1PYSA 2RHQA 3HY1A 1FYFA 1WLEA 5KNNA 2J3LA 4AH6A 2ZCEA 4ZTZB 1X54A 4XEMA 3CMQA 3IKLA 3V7RA 4P3PA 4UP9A 5ELOA 3A74A 4P73A 2RHSB 4P3NA 1NJ6A 1JJCA 4XTWA 4XTXA 2P5IA 2QHSA 4DPGA 4TWAA 4UP7A 1C0AA 2QHUA 2IY5A 2DDZA 4H2SA 3REXA 1L0WA 4TVAB 1X56A 2ALYA 2Q7HA 3RKWA 4YRRA 2QHVA 3BJUA 2ODRC 1USYA 4P72C 1ASZA 1SRYA 1VQZA 5F5WA 3A7AA 1WNLA 1G5HA 1NNHA 4DQ2A 2ZIMA 3V8JA 4CS2A 4RQEA 4RQFA 4P3OA 3G1ZA 1N9WA 5E3IA 3RIRA 2DTOA 4YCWA 4PHCA 4XTUA 1E1TA 2ZIOA 2HNIA 4YRGA 5K1PA 3MEYA 3UGQA 3NETA 1ADJA 3L4GB 4O2DA 2I4MA 4YREA
chains in the Genus database with same CATH superfamily
2YOEA 4J15A 3AE2A 2BZBA 1Z8UA 2XJ7A 1UGOA 3ZYLA 5ABFB 4CH6A 2LSJA 2Y48B 5DQVA 3MKDA 2Q9QB 4KP3C 3AE9A 3E9HA 3NRXA 1HTTA 4TZ4C 4IDZA 2JQQA 2DI4A 4IHJE 2JPFA 2NTXA 3TLVA 4TV8E 2DXTA 2UXCT 5AQFB 3CQGB 5EK4A 4YFSA 2YDQA 4DV6T 3E08A 1HG2A 3RRWA 2CJAA 1UX4A 1BBWA 3PUSA 4U2YA 5AQTB 4QXHB 2H3RA 3E0ZA 4YRMA 1B70B 4J2CA 5C52B 5LCYA 5IHYA 3VBBA 5JR9C 5HCJA 3LK3B 5KX5E 2IC6A 4YXDA 2CLYC 3R6NA 1N33T 3RYHE 1MIYA 4TTVA 1IJ5A 1NYQA 4EB6E 3IHRA 3UU5A 3SOLA 2KT9A 4LFAT 3PZCA 4DV3T 11ASA 3AE3A 3MJXA 4PJNA 2Q7GA 3LSQA 5C51B 2WWVA 3AAAB 4ZI3D 1SUMB 2ZT5A 3PUYF 4TQDA 2JQKA 2ZT8A 3HXVA 4XU2A 4PJMA 4KHZF 1KEYA 4WNKA 2X66A 4TWDA 1IAPA 5FMNA 2J62A 5C2TA 5JQGE 3NELA 2YKSA 4LF7T 1ADYA 3A5YA 2XQ9A 5EK3A 3EVYA 4HWTA 2XASB 3RIFA 3P8CD 4RMFA 4YRNA 2DQ3A 2IMLA 2YK0A 4ADZA 3KVBA 3IEEA 5AFUL 1O3XA 3RRCA 2NW9A 1X9BA 4TVAA 2D2SA 3EAMA 1KFYA 1NYRA 1UK5A 4EYUA 4A98A 4WZXA 1X2GA 2BKNA 4OYKA 3DP7A 1ZOYA 3TLUA 3ZMTB 3N9OA 2RHQB 1XDPA 1EOVA 2LT3A 4X5TA 5AQJB 1D0YA 2XQ3A 3UH0A 4QX8B 3UUXB 1W0BA 3C50A 2M6BA 3ZJ2A 4I55E 2E3CA 1Z0PA 3RACA 3RYIE 4DV1T 1LKXA 4ILCA 12ASA 2AMCA 1OEDE 3UQ4A 3M4PA 2LLYA 3FZFB 2K9AA 3RLFF 1OEDA 4YRIA 3Q9DA 4N78D 3N9PA 4P0BA 5AQSB 5DJQC 2Q9QD 2XQAA 4XTYA 4X65T 1HX1B 3FXEB 3P8VA 4YRTA 4WJ3M 4HFVA 2W2UA 1U5PA 2YN6A 1T98A 5ADXL 3KBTA 3EFRA 3BFMA 1KNRA 1UX5A 1D0ZA 2M6IA 2PMEA 3AEAA 4P75C 1WQWA 1YFRA 2DZCA 5E0OA 4Z90A 1NJ8A 3NBXX 5KDMC 4KR2A 4U31A 2YDSA 5HWYA 4WF2A 4UIGA 2VL0A 1LVFA 3U78A 4JLEA 5ETWA 3QUJA 2V6YB 4E51A 2X9WA 3A32A 1G8XA 4YTPA 2RA1A 3TEGA 3PJAA 4YLHA 1MMAA 3GA8A 4HT4A 3H37A 5BMVE 4ZXLA 2WDRA 1USYC 3TKLB 4CH3A 2N1GA 1KMMA 3GMIA 3KVAA 1WQ7A 2WDQA 4QWNB 4ZZCA 4PFOA 3QNEA 1U4QA 3V5UA 4JI8T 2CPTA 4NPPA 4GKKT 5FXZA 4EGWA 2BG9B 2V7JA 1R8IA 3ICAA 2EJGA 2I0MA 4LMKA 2FYKA 2Y6XA 1E2AA 3IA3A 3AA1B 1KNZA 3PUAA 2YDRA 4YPFA 1WYBA 2UXBT 2HPLA 2RP4A 2E2AA 3NKZA 2DEQA 4XTZA 3I0OA 1LVKA 3Q2MA 1IZNB 3I9WA 5HYAA 4YYEA 3EABA 4EYYR 3UQ7A 2OA5A 1IL2A 4OLFA 4LVJA 2NOXA 2CRBA 3ZCJA 4CS4A 3PUQA 4B3ST 2CXLA 3ZJ1A 3UUBA 4UF0B 5L3BB 4HWFA 3QNUA 3C4XA 3CK6A 1SHZC 1DU2A 3NENA 3ZT6A 4UPAA 4HWOA 3WQZA 2VB6A 4ZS3A 4C91A 1EZ3A 1XMOT 4CZZB 1YKEB 1WLEA 4HN9A 2J3LA 4AH6A 2ZCEA 4IL4A 2MPKA 2JIWA 1MMNA 4UF0A 1XZYA 3N2KE 3V7RA 4JBWF 1MIWA 4QH4A 4DR4T 3ZC1A 5AQGB 2X9HA 4P3NA 2CHOA 1V9DA 1JJCA 2V6XA 3RYFE 4X1KE 2QHSA 2QYWA 3H3MA 4LF5T 1FMWA 3PE0A 4ZZBA 5KMGP 4JV5T 4TN7B 2IAKA 3KV5A 3V5SA 3ETVA 4DUYT 2QHVA 3BJUA 3TLTA 2XQ6A 5L3EB 5HXEA 1SRYA 1VQZA 4ERRA 1YXRA 4PW8A 1US7B 1Y64B 4U2ZA 2L9QA 3ZC0A 3ZMZB 3SFDA 4RQEA 4JEUB 5FXVA 3AAEB 5HEOA 1N9WA 1CHUA 2WB5A 5E3IA 3GWHA 1CUNA 5JR9A 1MIVA 2XAQB 2CEAA 3NZQA 3OVUA 2FJAA 3LK2B 3FZKB 4YRGA 2K48A 2VQFT 2NS6A 2DHRA 2DU5A 4P1NA 3HR0A 2XTIA 4ISTA 3HKCE 4YY3T 4X1IE 3F2EA 3PUGA 2PMFA 3MACA 2V7LA 4P09A 2ES0A 4DBRA 3SRZA 2CWOA 3FZLB 3RC8A 3UU3A 1IBLT 3ANWB 3AXJA 4PJLA 3W3SA 2JQHA 2WMNA 4A97A 4HWRA 2CCQA 2H7OA 3HI2A 3B57A 1G51A 2CJBA 4GK0E 4WJ4A 2GK9A 3LBXB 2XM2A 2IDOB 4Z8XA 2J3MA 5ABEA 3K8PC 1W9RA 4UVCB 4YJ2E 3EDUA 3RGLA 1HXDA 1NJ5A 2NW7A 2W63A 5HGQA 4LF4T 4YSZA 4O2AE 3E22E 1X79A 2D0UA 4X20E 3KV6A 3IBPA 2W61A 2WM9A 2ZM2A 2DVEA 3Q5XA 2IHR1 4HWSA 1IBKT 2Z6EA 4XEOA 1VCTA 2I6HA 4CXXA 3V8LA 2XSAA 4H63V 2ZZEA 1SETA 3O9XA 1B7YA 3FJPA 4UVAB 2QGSA 3ANWA 3N9NA 1H4TA 3GN5A 2PG8A 2AKWA 4I50E 4JI2T 2A2FX 3VQXA 4ANJA 2ACZA 3KFWX 4QXBB 4A56A 4AKHA 2C5IT 3PU3A 3JAEA 5DQWA 4KQEA 4LF8T 3SWHA 4HFEA 2H88A 3OJAA 3ONLC 4KMCA 1HC7A 3MXZA 2I4NA 3T1HT 2ZLYA 2LRLA 4JI1T 3VQWA 4TNVA 3CX6B 4CN4A 1FJGT 4CH4A 2XAHB 4L5GA 2UUAT 4OYJA 5FKYA 3AA7B 4H2VA 2X9XA 3JC6D 2DLRA 3KFUA 4U72A 4YTMA 2I4LA 4IE6A 2V5CA 3V7CA 5FY7A 2CWYA 2X0LB 2IW5B 3HXZA 2BG9C 3FHNA 2LJLA 4DR3T 2QA7A 2KXPB 4EO4A 2JRKA 3L39A 1BIAA 5GONE 1E1OA 3X1DA 4CI2B 1UUSA 2E1HA 5FVLA 3AE5A 5HXCA 5L47A 2E41A 4MBQA 4DV4T 4CN6A 3JADA 4EOZB 1XNQT 1HF8A 3QTCA 4UV8B 4A5XA 2H7VC 1JJCB 3UFGA 2X68A 4H9QC 4CXYA 2C5JA 3RQUA 3QO7A 2BVMA 3VKGA 2ZT6A 4XU3A 1EFWA 5JDNA 3NVOA 4H2XB 4C90A 3A7MA 5FP3A 5LB7B 3HRKA 2DWKA 3RYCE 4YRQA 3ESLA 2YEVC 1WFDA 5HEJA 5JDQA 5L3DB 4EEBA 4IT4A 4NXMT 1UURA 1NAFA 4BJNA 3HKBE 2DQ0A 2D0TA 4PAGA 4WBNE 4QH5A 2WSSV 3CVRA 3SS1A 3LSSA 3P8TA 3RIUA 3A8YC 4O2BE 4YCUA 4HWDA 2WU5A 3VHLA 4TWHA 3V8KA 5LGTB 5H6RB 3FZMB 5IYZE 2V7MA 5A1LA 2EWNA 4P0AA 1JNRA 2JMKA 3HKEE 3ZSTA 1I6ZA 3H3AA 3ETUA 1ATIA 4G2AA 5DABA 4ZI2C 5JH7E 1FEWA 4L9IA 1SERA 2CMRA 2ZT7A 4XU1A 1HG5A 2X67A 5C3JA 3J9X1 4BAYB 4H63H 4ASKA 2UU9T 2LM9A 4FI5A 4FJOA 3N5LA 5EK2A 5JDFA 3ZN1B 3FBLA 4TNWA 3HKDE 3R84B 4LMJA 4YP0A 3IALA 4NCXA 1M7KA 3L8RA 2V7KA 5JDLA 3UTKA 2CXFA 4XBFB 4JI5T 2WDVA 2VKJA 3AB3B 3FBZA 1AJ3A 1Z7MA 2QVAA 2MYSA 2MBGA 4LNSA 4ZI7E 5LYJE 2E64A 1YQ3A 1VRBA 3PDYA 2ZM0A 1XWMA 5CA1E 3HA4A 2X0YA 3RUXA 3B5MA 2V6YA 1YD8G 2B76A 5JVDE 2I4OA 4U7IA 5JDGA 3MK7C 1HX8A 4DUZT 1YKHB 3O1IA 3P8YA 3P4QA 3HXUA 4EX5A 3MZKB 5AQLB 2VKHA 5L3FB 3P4RA 4G84A 2XY8B 3L4GA 3RH3A 3OD1A 4DMWA 4JI3T 1WPYA 1KOGA 4ZI2D 4M1PA 4HWCA 4HTEA 5AQNB 1SESA 1MNDA 4HWIB 3O1JA 2ZNIA 1OEDB 5HEUA 2XQ7A 2KMFA 2XPKA 2V8SV 2ZMAA 4DBQA 2CLYB 4DR7T 1FMVA 4WI1A 1PYSA 3HY1A 5FXWA 4MALA 1FYFA 3PU8A 3AVSA 2K5BB 1FIOA 3CMQA 2RPAA 4P3PA 3RX6A 5ELOA 4QHOA 4CQIA 4P73A 4TWFA 4UVBB 3VRBA 3AE8A 2P5IA 3K3QC 4TWAA 3OTOT 2A3DA 3Q5EA 2DDZA 3F31A 4HFHA 3RC3A 4LF6T 2D9DA 4X64T 4TVAB 2BKOA 1X56A 2ALYA 4DV2T 4HKAA 1KNPA 5FY0A 5AQKB 3KINB 1USYA 4U3CA 1QLBA 2LKGA 3A7AA 4DR6T 1JNZA 4EXTA 5JDHA 2E9XA 4B3MT 3F57A 5HWXA 3N9QA 3UU4A 3ONXA 4PK5A 3UUNA 4CS2A 3AAIA 3N2GE 4ILBA 4P3OA 3PUVF 3P4PA 3FXDB 4IREA 3CQCB 3UFEA 4EZHA 2CA5A 2VVNA 4XTUA 5HXSA 1E1TA 2ZIOA 2HN2A 3LG7A 2KLQA 4YSYA 5K1PA 4X1YE 3NWIA 5H6QB 2UXXB 3NETA 1ADJA 3L4GB 2JJ9A 4B3RT 4YREA 2K3WA 4AI6A 3EFSA 1VOMA 5TAOA 4P71A 4PJJA 4JUYA 4WYVA 5FL0A 3HXWA 3ABVA 2OV9A 4DMVA 3NZPA 3EUHA 4CS3A 5L3CB 4F8HA 2ODVA 4MHCA 1IJ6A 4CI1B 1X2HA 5LGNB 2XZEA 2J1DG 3FB2A 4WW0A 2CGHA 5LXTE 2MAWA 2DTHA 3BQLA 3DJBA 3JAFA 3AXJB 4NXNT 3IF8B 2C8MA 1W66A 2ZXFA 3NEMA 2QRXA 2KWHA 4HVCA 4L0RA 4Z91A 3AA6B 1J5WA 4ZIBA 3ZYMA 4ZTUB 4ZI3C 2XAJB 3DTOA 2PJQA 3CKDA 3EI0A 4PFPA 5LG3A 2UUBT 2XAGB 4YCVA 3O1HA 3KDSE 2MTQA 4QH1A 5KXJA 1H4VB 1YFSA 1WRDA 3P4WA 1ZKEA 5LG4A 3PUXF 4EZ4A 2WZIA 4E7ZA 2DZ9A 3CX7B 1T72A 3W15B 3AE6A 4H2YA 3T8OA 3QO5A 2BS2A 5M4YA 2PBIA 2BS3A 4HA8A 2XHEB 2NP9A 2Q9QA 3N9MA 4AQGA 4PG3A 3UU6A 2VKOA 3HFVA 4O4JE 5IUXA 3I9YA 3OPCA 4K86A 2ARUA 3TUPA 1MMGA 3QB5K 3RKYA 3VU7H 1G5IA 3P4SA 5LBMA 4BJMA 3WAJA 4EEDA 4GKJT 1OXZA 5HCMA 4HFIA 3K3NA 2C7IA 5LMUT 3RPUA 3HRIA 4H2UA 1XNRT 2LSIA 3HTZA 4YRJA 1EVKA 1NJ1A 5ELNA 3Q5WA 5F3JA 2CM0A 3C98B 2IIUA 4PK4A 4DR1T 1QE0A 2Q7EA 2Q5IA 3B13A 3AA0B 4UEMA 2AXDS 4YTNA 1KK7A 5LOVE 4YDQA 4KHPT 2WZHA 4O4LE 4DVDA 3QC9A 4B6XA 4H2TA 4ZOLE 2V7IA 5C53B 3AE4A 3RKXA 2N9DA 4B3TT 2ZR3A 3K1SA 3RL6A 2W4XA 4IE5A 2E5AA 2NWBA 3OYZA 4P72A 2AE9A 3M65A 1HNZT 4WBOA 3UU8A 1LRZA 4OK0A 4TVYA 2ODRD 4LFCT 2LSYA 5FY1A 3Q5DA 2YU2A 2BBHA 3ZT5A 3ZT7A 5C8YE 5HXHA 5JREA 2F4VT 4IE4A 4BA9A 3PJAJ 4TX5A 2I59A 3ZEFB 2XTLA 3AEEA 4UELA 1X01A 1D1CA 1I94T 1D0XA 3HY0A 4MLKA 2E8IA 3QB5A 4MFRA 3RIUC 5AQRB 2DU7A 1UCUA 3AEBA 4IE7A 3ZSSA 3PURA 2UUCT 3TEHA 4GYRA 2E5VA 2WAUA 1D1AA 1YFTA 4P73C 2VL8A 3GN5B 5F8PA 1Y01A 4PK6A 1ASYA 3VR9A 2YINA 3CQXC 4UP8A 1B8AA 3CMLA 4GIWA 2G0UA 2XM1A 4U33A 1YW0A 3I0QA 3UULA 3ZPOA 1B76A 2E9XC 3M3ZB 4X66T 3RKGA 2UXDT 5ABHA 2QHTA 2W62A 1RIQA 2CXDA 2J47A 2ZZGA 4BW9A 3D0TA 3VR8A 2JQ9A 3L09A 5AQUB 4Q6GA 2WQYA 5LHIB 4OFZA 4K88A 3U3IA 4XU0A 2H89A 4IL9A 4AKGA 3PUWF 4O4HE 4PNIA 3ZKRA 4JI6T 2IUBA 2ARSA 4V1Av 1EVLA 3L2ZA 4YJ3E 4QX7B 1GQEA 2AMCB 2EHOC 4CXWA 5CFBA 2Y8DA 3OKQA 3EHZA 4TUYE 4EV6A 3RIAA 2Q5HA 2LM2A 1QF6A 4IDQA 1E7PA 3CWZB 1NWMX 2VWAA 3RF1A 3AEDA 2XQ8A 2K24A 3UT5E 1LYLA 2E9XB 2VVSA 1G73A 4KX6A 2WWUA 3L3PA 4NIQA 2EL9A 5JR9B 4I4TE 4TQFA 2NR4A 3UUMA 1HS7A 3P50A 5LBQB 3NRYA 2C5KT 4K0UA 1HTJF 3HXXA 4O4IE 4YSXA 2HN1A 2RHQA 3AVRA 5KNNA 4ZTZB 3IKLA 3KBUA 4UP9A 2A72A 2RHSB 4H9PC 1NJ6A 2LHNA 4XTXA 5J0ZA 4KBMB 4UP7A 1C0AA 1XMQT 2Q9QC 5FVKA 2KSRA 2C0SA 1L0WA 3ZMSB 1ZV4X 4JI4T 2Q7HA 4YRRA 4F6RC 1NENA 4IIJE 1ASZA 5LMNT 1NEKA 1WNLA 3O4XE 4JI0T 1G5HA 3SFEA 4KUMB 5ABGA 2ZIMA 1W09A 5CGMA 3C4WA 3RIRA 5HEGA 1BR0A 4HFBA 2DTOA 3ZMVB 4YCWA 2KINB 3N2OA 4PHCA 4LVIA 2W67A 3C51A 2HNIA 2VKDA 3MEYA 2MOZA 2D5UA 3BQKA 4O2DA 2WU2A 4P71C 4XTVA 4HGAA 3M4QA 4DIDB 5HXRA 2PFVA 4DNDA 1E1HB 3PCOA 3VQYA 1E22A 3ZLIA 2CBJA 3IKMB 2BS4A 3AECA 1NJ2A 3HL6A 3CX8B 1XDOA 4YHJA 3A31A 5L4HA 3A7UA 1EIYA 2N2NA 3HFZB 4YROA 4RDXA 2LHRA 2G4CA 3C64A 5AQMB 4NUVA 3RHWA 4DR5T 3L1AA 2BG9A 2ZZFA 1H4SA 4I43B 2FJBA 5CA0E 5LJNA 4OP0A 2CHNA 5AQHB 2WY2A 4TVWA 5CB4E 5AQOB 4LVLA 2EAYA 4ILUA 3A5XA 4JEHB 5HAXA 5ABFA 2IC9A 4X5OA 4GYSA 2BVLA 3ZCIA 3PCOB 3LK42 1HNWT 4DV0T 2XAFB 1W0AA 4AISA 1E24A 3HFZA 1J1JA 2DTIA 1EIYB 2DNXA 1QUUA 2E9XD 3RKOA 2M67A 4UR9A 4G85A 4H9OC 2EJ9A 4KR3A 4H9RC 3A5ZA 5JTGA 4Q25A 4AKRB 4LFBT 3VKHA 5LHGB 1BR1A 5AQQB 3ZN0B 2XQ4A 1T7SA 1WR0A 1SE7A 2ZM6T 2L3LA 2IY5B 4QXCB 4YRKA 5LJMA 4K0KT 2X0HA 2LOSA 1WYCA 4JI7T 1YB3A 4BWAA 1HCIA 4IE0A 4HWPA 3CPZA 1MNEA 4H2XA 2WCAA 4GK5E 4K87A 3A7RA 2FUPA 2DJZA 4IGUA 2ZTGA 1YGBA 2P9BA 3T1YT 2BDEA 1WU7A 2BKPA 3LSVA 2ACXA 3AEFA 4LVKA 3I7FA 2XSBA 2BG9E 2EHOD 5LGUB 2DXUA 2HHHT 3AE7A 1QSDA 2CE7A 1T8BA 2W66A 4YRCA 2V26A 4IDNA 3WI3A 4H2WA 4COFA 2KWIB 2RHSA 3R07A 5L3GB 4ISSA 1MMDA 3DSQA 3V7SA 4HE8A 2EJFA 3MF1A 1WCRA 2JMHA 1N32T 1WYDA 2V1DB 4AQFA 4AIUA 5JRCB 4XZCA 1D1BA 2LOPA 3AEGA 2LKHA 4P74A 2EHOA 3REUA 4LVMA 3ZMUB 4IDPA 2CBIA 4XAXB 4H9NC 1BR4A 1BIBA 3HXYA 2BBJA 5LNKA 4HFCA 2ODUA 4HWHA 3JCFA 2WBLA 5CJ5A 2E65A 2J4GA 3QO8A 5K1XA 2B1EA 4I0UA 5AQPB 5AQVB 1WR6A 1L0VA 3LJCA 3WAKA 2VK9A 1N36T 2LE8A 2LRKA 1J5ET 2WS3A 2DKGA 3BQIA 5BR8T 2DL1A 4P74C 2SPCA 4L87A 2A8EA 3TLWA 2AKWB 5LHHB 2P0LA 2FJDA 1B7YB 4OX9T 2W00A 3PTRB 4DO0A 1WLXA 2XQYA 4P75A 4DR2T 2ZGWA 4H02A 2UXNB 2KNDA 4ZEYA 2DWGA 2CJ9A 4HFDA 3VQVA 3ERRA 2LSKA 3RI5A 5HEHA 3LFMA 3LC0A 3G06A 3PV0F 4ZHQE 4IDOA 4E7SA 1EQRA 2A9UA 3LBXA 4AKIA 1IBMT 2XGTA 2FJEA 1HR0T 4QKNA 3E9IA 1OEDC 1ZP0A 3LDQB 4KI0F 1KF6A 4AKLA 3K3OA 3FZHB 3QK6A 2NTYA 4G63A 4HEAA 2YU1A 1B70A 2ZR2A 2OLTA 2ARTA 3EDVA 3RQWA 5JDMA 5J2UE 2VURA 5FL1A 4AQYT 3P7IA 1N34T 4Q15A 1KMNA 2WP9A 1H7CA 3QOFA 4CI3B 2ZINA 4YRPA 3MF2A 1H4QA 1ZHCA 1S94A 2VASA 2CIMA 4YRFA 3KV9A 5IWAT 3AE1A 5J1GA 1VCSA 2EHOB 2ALYB 2LSGA 2XUEA 2KZ7B 3TEHB 1HFAA 5JRCA 3PUZF 5L2LA 1Z7NA 4CH5A 3JC6C 4H9SE 2ZNJA 3BK9A 4ILAA 3ONJA 1BBUA 2LEHA 5FNVE 5FYMA 4CN1A 1SA0E 4TV9E 4YRLA 2ZM8A 2NW8A 3UGTA 1GGMA 2E10A 1PYSB 3KV4A 4EIWA 4X62T 1X55A 3C4ZA 2HPJA 4YRSA 2PTFA 5FXXA 3IG2A 5J2TE 4LMLA 2HH7A 4UXNB 4ZS2A 4U74A 1X54A 4AXPA 4XEMA 3CIRA 5AQIB 5EZYE 2L8KA 3A74A 4XTWA 4NUUA 3ZYKA 1YQ4A 4DPGA 4DV7T 1ZEEA 4AQFC 3OBVE 2QHUA 2IY5A 2X51A 5LP6E 2DCFA 4H2SA 3REXA 1OWAA 3VRAA 4YT0A 3RKWA 2ODRC 3OYXA 1BR2A 4DV5T 4P72C 3S4UA 1S35A 5F5WA 2V5DA 2W0GA 1NNHA 4O8SA 1HNXT 4DQ2A 3V8JA 4JYAT 4RQFA 1B7TA 3G1ZA 4OHFA 4LF9T 3MQZA 3MA9A 4YHHT 2X9YA 1M62A 2XQ5A 4UV9B 5LA6E 2VQET 3TLSA 3I1AA 2FBWA 4EAHA 2E5LT 5L4EA 2WMOA 4GOUA 3UGQA 3J7Yq 2R6GF 2I4MA 3N9LA 4U7YA
chains in the Genus database with same CATH topology
2DU5A 4J15A 3EFSA 4P71C 4XTVA 4P71A 2XTIA 3M4QA 3HXWA 2PMFA 4CH6A 4CS3A 1X2HA 3E9HA 1HTTA 3W3SA 2CGHA 3PCOA 3VQYA 1E22A 2DTHA 3IKMB 1NJ2A 2DXTA 3A31A 3A7UA 4HWRA 1EIYA 3HFZB 4YROA 4RDXA 2C8MA 2G4CA 1G51A 4WJ4A 2CJBA 1W66A 2ZXFA 3NEMA 3L1AA 2ZZFA 4HVCA 1H4SA 2J3MA 1J5WA 4OP0A 4ZIBA 2CJAA 1BBWA 4ZTUB 3RGLA 1HXDA 1NJ5A 4TVWA 4LVLA 2EAYA 4YRMA 5HGQA 1B70B 4YCVA 5C52B 3VBBA 4X5OA 1YFSA 1H4VB 3PCOB 2DZ9A 4TTVA 1E24A 2DVEA 3HFZA 4HWSA 2DTIA 1NYQA 1EIYB 4XEOA 3PZCA 4H2YA 3QO5A 3V8LA 4G85A 11ASA 2EJ9A 4KR3A 2ZZEA 3A5ZA 1SETA 1B7YA 3FJPA 1H4TA 4HA8A 2Q7GA 2AKWA 3LSQA 5C51B 3VQXA 4PG3A 2ZT5A 4TQDA 2IY5B 3HFVA 4YRKA 2ZT8A 4KQEA 3HXVA 4XU2A 4K86A 2ARUA 1HC7A 1YB3A 3TUPA 4BWAA 2I4NA 3VQWA 4HWPA 4CH4A 4H2XA 3RKYA 1G5IA 3NELA 4K87A 3A7RA 2DJZA 2ZTGA 4H2VA 1YGBA 1ADYA 3A5YA 1WU7A 2C7IA 4HWTA 3HRIA 4H2UA 3KFUA 2I4LA 4RMFA 3HTZA 4YRJA 4YRNA 1EVKA 4LVKA 1NJ1A 2DQ3A 5ELNA 3I7FA 3V7CA 4TVAA 1NYRA 3HXZA 2DXUA 1X2GA 1QE0A 2Q7EA 2Q5IA 4EO4A 1BIAA 2RHQB 4YRCA 1EOVA 4H2WA 1E1OA 4YDQA 2RHSA 3UH0A 2E1HA 3R07A 3DSQA 3V7SA 2E41A 2EJFA 3MF1A 4H2TA 5C53B 2E3CA 1WYDA 3QTCA 3RKXA 1JJCB 3RACA 3UFGA 2ZR3A 12ASA 2AMCA 4P74A 3M4PA 3REUA 3RL6A 4LVMA 2E5AA 3QO7A 4P72A 2ZT6A 4YRIA 4XU3A 1BIBA 3HXYA 4TVYA 2ODRD 1EFWA 4H2XB 2E65A 4XTYA 3QO8A 3HRKA 5K1XA 4YRQA 3P8VA 4YRTA 4WJ3M 2DKGA 2DQ0A 1X01A 4P74C 4L87A 2A8EA 3EFRA 2AKWB 3HY0A 3BFMA 2P0LA 3LSSA 1B7YB 3P8TA 2PMEA 4P75C 1WQWA 2DU7A 4P75A 1YFRA 4YCUA 2DZCA 2ZGWA 1NJ8A 4KR2A 4H02A 4WF2A 3TEHA 3V8KA 1YFTA 2CJ9A 3VQVA 3ERRA 4P73C 2EWNA 3LC0A 1EQRA 1ASYA 1ATIA 4E51A 3A32A 1SERA 2XGTA 3TEGA 2ZT7A 4XU1A 4UP8A 4HT4A 1B8AA 3E9IA 1USYC 4CH3A 1KMMA 1WQ7A 1B76A 1B70A 4YP0A 3QNEA 3IALA 2ZR2A 4NCXA 2QHTA 2ARTA 1RIQA 2ZZGA 4BW9A 1Z7MA 4LNSA 4Q15A 1KMNA 2E64A 3ICAA 4Q6GA 2EJGA 4K88A 2ZINA 4YRPA 3MF2A 3RUXA 1H4QA 4XU0A 2FYKA 2CIMA 4YRFA 2ARSA 4YPFA 1EVLA 3L2ZA 2ALYB 2DEQA 2I4OA 2AMCB 4XTZA 3TEHB 2Q5HA 3P8YA 4YYEA 1Z7NA 4CH5A 1QF6A 3HXUA 4EX5A 2ZNJA 1IL2A 4OLFA 4G84A 4LVJA 3L4GA 3RF1A 3OD1A 1BBUA 4CS4A 1WPYA 1KOGA 1LYLA 4YRLA 1SESA 3UGTA 1GGMA 2E10A 1PYSB 3NENA 2EL9A 2ZNIA 4TQFA 1X55A 4UPAA 4HWOA 3WQZA 4YRSA 3IG2A 3HXXA 4WI1A 1PYSA 2RHQA 3HY1A 1FYFA 1WLEA 5KNNA 2J3LA 4AH6A 2ZCEA 4ZTZB 1X54A 4XEMA 3CMQA 3IKLA 3V7RA 4P3PA 4UP9A 5ELOA 3A74A 4P73A 2RHSB 4P3NA 1NJ6A 1JJCA 4XTWA 4XTXA 2P5IA 2QHSA 4DPGA 4TWAA 4UP7A 1C0AA 2QHUA 2IY5A 2DDZA 4H2SA 3REXA 1L0WA 4TVAB 1X56A 2ALYA 2Q7HA 3RKWA 4YRRA 2QHVA 3BJUA 2ODRC 1USYA 4P72C 1ASZA 1SRYA 1VQZA 5F5WA 3A7AA 1WNLA 1G5HA 1NNHA 4DQ2A 2ZIMA 3V8JA 4CS2A 4RQEA 4RQFA 4P3OA 3G1ZA 1N9WA 5E3IA 3RIRA 2DTOA 4YCWA 3MQZA 4PHCA 4XTUA 4LVIA 1E1TA 2ZIOA 2HNIA 4YRGA 5K1PA 3MEYA 3UGQA 2NS6A 1ADJA 3NETA 3L4GB 4O2DA 2I4MA 4YREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DU5 A;  4J15 A;  3EFS A;  4P71 C;  4XTV A;  4P71 A;  2XTI A;  3M4Q A;  3HXW A;  2PMF A;  4CH6 A;  4CS3 A;  1X2H A;  3E9H A;  1HTT A;  3W3S A;  2CGH A;  3PCO A;  3VQY A;  1E22 A;  2DTH A;  3IKM B;  1NJ2 A;  2DXT A;  3A31 A;  3A7U A;  4HWR A;  1EIY A;  3HFZ B;  4YRO A;  4RDX A;  2C8M A;  2G4C A;  1G51 A;  4WJ4 A;  2CJB A;  1W66 A;  2ZXF A;  3NEM A;  3L1A A;  2ZZF A;  4HVC A;  1H4S A;  2J3M A;  1J5W A;  4OP0 A;  4ZIB A;  2CJA A;  1BBW A;  4ZTU B;  3RGL A;  1HXD A;  1NJ5 A;  4TVW A;  2EAY A;  4YRM A;  5HGQ A;  1B70 B;  4YCV A;  5C52 B;  3VBB A;  4X5O A;  1YFS A;  1H4V B;  3PCO B;  2DZ9 A;  4TTV A;  1E24 A;  2DVE A;  3HFZ A;  4HWS A;  2DTI A;  1NYQ A;  1EIY B;  4XEO A;  3PZC A;  4H2Y A;  3QO5 A;  3V8L A;  4G85 A;  11AS A;  2EJ9 A;  4KR3 A;  2ZZE A;  3A5Z A;  1SET A;  1B7Y A;  3FJP A;  1H4T A;  4HA8 A;  2Q7G A;  2AKW A;  3LSQ A;  5C51 B;  3VQX A;  4PG3 A;  2ZT5 A;  4TQD A;  2IY5 B;  3HFV A;  4YRK A;  2ZT8 A;  4KQE A;  3HXV A;  4XU2 A;  4K86 A;  2ARU A;  1HC7 A;  1YB3 A;  3TUP A;  4BWA A;  2I4N A;  3VQW A;  4HWP A;  4CH4 A;  4H2X A;  3RKY A;  1G5I A;  3NEL A;  4K87 A;  3A7R A;  2DJZ A;  2ZTG A;  4H2V A;  1YGB A;  1ADY A;  3A5Y A;  1WU7 A;  2C7I A;  4HWT A;  3HRI A;  4H2U A;  3KFU A;  2I4L A;  4RMF A;  3HTZ A;  4YRJ A;  4YRN A;  1EVK A;  1NJ1 A;  2DQ3 A;  5ELN A;  3I7F A;  3V7C A;  4TVA A;  1NYR A;  3HXZ A;  2DXU A;  1X2G A;  1QE0 A;  2Q7E A;  2Q5I A;  4EO4 A;  1BIA A;  2RHQ B;  4YRC A;  1EOV A;  4H2W A;  1E1O A;  4YDQ A;  2RHS A;  3UH0 A;  2E1H A;  3R07 A;  3DSQ A;  3V7S A;  2E41 A;  2EJF A;  3MF1 A;  4H2T A;  5C53 B;  2E3C A;  1WYD A;  3QTC A;  3RKX A;  1JJC B;  3RAC A;  3UFG A;  2ZR3 A;  12AS A;  2AMC A;  4P74 A;  3M4P A;  3REU A;  3RL6 A;  2E5A A;  3QO7 A;  4P72 A;  2ZT6 A;  4YRI A;  4XU3 A;  1BIB A;  3HXY A;  4TVY A;  2ODR D;  1EFW A;  4H2X B;  2E65 A;  4XTY A;  3QO8 A;  3HRK A;  5K1X A;  4YRQ A;  3P8V A;  4YRT A;  4WJ3 M;  2DKG A;  2DQ0 A;  1X01 A;  4P74 C;  4L87 A;  3EFR A;  2AKW B;  3HY0 A;  3BFM A;  2P0L A;  3LSS A;  1B7Y B;  3P8T A;  2PME A;  4P75 C;  1WQW A;  2DU7 A;  4P75 A;  1YFR A;  4YCU A;  2DZC A;  2ZGW A;  1NJ8 A;  4KR2 A;  4H02 A;  4WF2 A;  3TEH A;  3V8K A;  1YFT A;  2CJ9 A;  3VQV A;  3ERR A;  4P73 C;  2EWN A;  3LC0 A;  1EQR A;  1ASY A;  1ATI A;  4E51 A;  3A32 A;  1SER A;  2XGT A;  3TEG A;  2ZT7 A;  4XU1 A;  4UP8 A;  1B8A A;  3E9I A;  1USY C;  4CH3 A;  1KMM A;  1WQ7 A;  1B76 A;  1B70 A;  4YP0 A;  3QNE A;  3IAL A;  2ZR2 A;  4NCX A;  2QHT A;  2ART A;  1RIQ A;  2ZZG A;  4BW9 A;  1Z7M A;  4LNS A;  4Q15 A;  1KMN A;  2E64 A;  3ICA A;  4Q6G A;  2EJG A;  4K88 A;  2ZIN A;  4YRP A;  3MF2 A;  3RUX A;  1H4Q A;  4XU0 A;  2FYK A;  2CIM A;  4YRF A;  2ARS A;  4YPF A;  1EVL A;  3L2Z A;  2ALY B;  2DEQ A;  2I4O A;  2AMC B;  4XTZ A;  3TEH B;  2Q5H A;  3P8Y A;  4YYE A;  1Z7N A;  4CH5 A;  1QF6 A;  3HXU A;  4EX5 A;  2ZNJ A;  1IL2 A;  4OLF A;  4G84 A;  3L4G A;  3RF1 A;  3OD1 A;  1BBU A;  4CS4 A;  1WPY A;  1KOG A;  1LYL A;  4YRL A;  1SES A;  3UGT A;  1GGM A;  2E10 A;  1PYS B;  3NEN A;  2EL9 A;  2ZNI A;  4TQF A;  1X55 A;  4UPA A;  4HWO A;  3WQZ A;  4YRS A;  3IG2 A;  3HXX A;  4WI1 A;  1PYS A;  2RHQ A;  3HY1 A;  1FYF A;  1WLE A;  5KNN A;  2J3L A;  4AH6 A;  2ZCE A;  4ZTZ B;  1X54 A;  4XEM A;  3CMQ A;  3IKL A;  3V7R A;  4P3P A;  4UP9 A;  5ELO A;  3A74 A;  4P73 A;  2RHS B;  4P3N A;  1NJ6 A;  1JJC A;  4XTW A;  4XTX A;  2P5I A;  2QHS A;  4DPG A;  4TWA A;  4UP7 A;  1C0A A;  2QHU A;  2IY5 A;  2DDZ A;  4H2S A;  3REX A;  1L0W A;  4TVA B;  1X56 A;  2ALY A;  2Q7H A;  3RKW A;  4YRR A;  2QHV A;  3BJU A;  2ODR C;  1USY A;  4P72 C;  1ASZ A;  1SRY A;  1VQZ A;  5F5W A;  3A7A A;  1WNL A;  1G5H A;  1NNH A;  4DQ2 A;  2ZIM A;  3V8J A;  4CS2 A;  4RQE A;  4RQF A;  4P3O A;  3G1Z A;  1N9W A;  5E3I A;  3RIR A;  2DTO A;  4YCW A;  4PHC A;  4XTU A;  1E1T A;  2ZIO A;  2HNI A;  4YRG A;  5K1P A;  3MEY A;  3UGQ A;  3NET A;  1ADJ A;  3L4G B;  4O2D A;  2I4M A;  4YRE A; 
#chains in the Genus database with same CATH topology
 2YOE A;  4J15 A;  3AE2 A;  2BZB A;  1Z8U A;  2XJ7 A;  1UGO A;  3ZYL A;  5ABF B;  4CH6 A;  2LSJ A;  2Y48 B;  5DQV A;  3MKD A;  2Q9Q B;  4KP3 C;  3AE9 A;  3E9H A;  3NRX A;  1HTT A;  4TZ4 C;  4IDZ A;  2JQQ A;  2DI4 A;  4IHJ E;  2JPF A;  2NTX A;  3TLV A;  4TV8 E;  2DXT A;  2UXC T;  5AQF B;  3CQG B;  5EK4 A;  4YFS A;  2YDQ A;  4DV6 T;  3E08 A;  1HG2 A;  3RRW A;  2CJA A;  1UX4 A;  1BBW A;  3PUS A;  4U2Y A;  5AQT B;  4QXH B;  2H3R A;  3E0Z A;  4YRM A;  1B70 B;  4J2C A;  5C52 B;  5LCY A;  5IHY A;  3VBB A;  5JR9 C;  5HCJ A;  3LK3 B;  5KX5 E;  2IC6 A;  4YXD A;  2CLY C;  3R6N A;  1N33 T;  3RYH E;  1MIY A;  4TTV A;  1IJ5 A;  1NYQ A;  4EB6 E;  3IHR A;  3UU5 A;  3SOL A;  2KT9 A;  4LFA T;  3PZC A;  4DV3 T;  11AS A;  3AE3 A;  3MJX A;  4PJN A;  2Q7G A;  3LSQ A;  5C51 B;  2WWV A;  3AAA B;  4ZI3 D;  1SUM B;  2ZT5 A;  3PUY F;  4TQD A;  2JQK A;  2ZT8 A;  3HXV A;  4XU2 A;  4PJM A;  4KHZ F;  1KEY A;  4WNK A;  2X66 A;  4TWD A;  1IAP A;  5FMN A;  2J62 A;  5C2T A;  5JQG E;  3NEL A;  2YKS A;  4LF7 T;  1ADY A;  3A5Y A;  2XQ9 A;  5EK3 A;  3EVY A;  4HWT A;  2XAS B;  3RIF A;  3P8C D;  4RMF A;  4YRN A;  2DQ3 A;  2IML A;  2YK0 A;  4ADZ A;  3KVB A;  3IEE A;  5AFU L;  1O3X A;  3RRC A;  2NW9 A;  1X9B A;  4TVA A;  2D2S A;  3EAM A;  1KFY A;  1NYR A;  1UK5 A;  4EYU A;  4A98 A;  4WZX A;  1X2G A;  2BKN A;  4OYK A;  3DP7 A;  1ZOY A;  3TLU A;  3ZMT B;  3N9O A;  2RHQ B;  1XDP A;  1EOV A;  2LT3 A;  4X5T A;  5AQJ B;  1D0Y A;  2XQ3 A;  3UH0 A;  4QX8 B;  3UUX B;  1W0B A;  3C50 A;  2M6B A;  3ZJ2 A;  4I55 E;  2E3C A;  1Z0P A;  3RAC A;  3RYI E;  4DV1 T;  1LKX A;  4ILC A;  12AS A;  2AMC A;  1OED E;  3UQ4 A;  3M4P A;  2LLY A;  3FZF B;  2K9A A;  3RLF F;  1OED A;  4YRI A;  3Q9D A;  4N78 D;  3N9P A;  4P0B A;  5AQS B;  5DJQ C;  2Q9Q D;  2XQA A;  4XTY A;  4X65 T;  1HX1 B;  3FXE B;  3P8V A;  4YRT A;  4WJ3 M;  4HFV A;  2W2U A;  1U5P A;  2YN6 A;  1T98 A;  5ADX L;  3KBT A;  3EFR A;  3BFM A;  1KNR A;  1UX5 A;  1D0Z A;  2M6I A;  2PME A;  3AEA A;  4P75 C;  1WQW A;  1YFR A;  2DZC A;  5E0O A;  4Z90 A;  1NJ8 A;  3NBX X;  5KDM C;  4KR2 A;  4U31 A;  2YDS A;  5HWY A;  4WF2 A;  4UIG A;  2VL0 A;  1LVF A;  3U78 A;  4JLE A;  5ETW A;  3QUJ A;  2V6Y B;  4E51 A;  2X9W A;  3A32 A;  1G8X A;  4YTP A;  2RA1 A;  3TEG A;  3PJA A;  4YLH A;  1MMA A;  3GA8 A;  4HT4 A;  3H37 A;  5BMV E;  4ZXL A;  2WDR A;  1USY C;  3TKL B;  4CH3 A;  2N1G A;  1KMM A;  3GMI A;  3KVA A;  1WQ7 A;  2WDQ A;  4QWN B;  4ZZC A;  4PFO A;  3QNE A;  1U4Q A;  3V5U A;  4JI8 T;  2CPT A;  4NPP A;  4GKK T;  5FXZ A;  4EGW A;  2BG9 B;  2V7J A;  1R8I A;  3ICA A;  2EJG A;  2I0M A;  4LMK A;  2FYK A;  2Y6X A;  1E2A A;  3IA3 A;  3AA1 B;  1KNZ A;  3PUA A;  2YDR A;  4YPF A;  1WYB A;  2UXB T;  2HPL A;  2RP4 A;  2E2A A;  3NKZ A;  2DEQ A;  4XTZ A;  3I0O A;  1LVK A;  3Q2M A;  1IZN B;  3I9W A;  5HYA A;  4YYE A;  3EAB A;  4EYY R;  3UQ7 A;  2OA5 A;  1IL2 A;  4OLF A;  4LVJ A;  2NOX A;  2CRB A;  3ZCJ A;  4CS4 A;  3PUQ A;  4B3S T;  2CXL A;  3ZJ1 A;  3UUB A;  4UF0 B;  5L3B B;  4HWF A;  3QNU A;  3C4X A;  3CK6 A;  1SHZ C;  1DU2 A;  3NEN A;  3ZT6 A;  4UPA A;  4HWO A;  3WQZ A;  2VB6 A;  4ZS3 A;  4C91 A;  1EZ3 A;  1XMO T;  4CZZ B;  1YKE B;  1WLE A;  4HN9 A;  2J3L A;  4AH6 A;  2ZCE A;  4IL4 A;  2MPK A;  2JIW A;  1MMN A;  4UF0 A;  1XZY A;  3N2K E;  3V7R A;  4JBW F;  1MIW A;  4QH4 A;  4DR4 T;  3ZC1 A;  5AQG B;  2X9H A;  4P3N A;  2CHO A;  1V9D A;  1JJC A;  2V6X A;  3RYF E;  4X1K E;  2QHS A;  2QYW A;  3H3M A;  4LF5 T;  1FMW A;  3PE0 A;  4ZZB A;  5KMG P;  4JV5 T;  4TN7 B;  2IAK A;  3KV5 A;  3V5S A;  3ETV A;  4DUY T;  2QHV A;  3BJU A;  3TLT A;  2XQ6 A;  5L3E B;  5HXE A;  1SRY A;  1VQZ A;  4ERR A;  1YXR A;  4PW8 A;  1US7 B;  1Y64 B;  4U2Z A;  2L9Q A;  3ZC0 A;  3ZMZ B;  3SFD A;  4RQE A;  4JEU B;  5FXV A;  3AAE B;  5HEO A;  1N9W A;  1CHU A;  2WB5 A;  5E3I A;  3GWH A;  1CUN A;  5JR9 A;  1MIV A;  2XAQ B;  2CEA A;  3NZQ A;  3OVU A;  2FJA A;  3LK2 B;  3FZK B;  4YRG A;  2K48 A;  2VQF T;  2NS6 A;  2DHR A;  2DU5 A;  4P1N A;  3HR0 A;  2XTI A;  4IST A;  3HKC E;  4YY3 T;  4X1I E;  3F2E A;  3PUG A;  2PMF A;  3MAC A;  2V7L A;  4P09 A;  2ES0 A;  4DBR A;  3SRZ A;  2CWO A;  3FZL B;  3RC8 A;  3UU3 A;  1IBL T;  3ANW B;  3AXJ A;  4PJL A;  3W3S A;  2JQH A;  2WMN A;  4A97 A;  4HWR A;  2CCQ A;  2H7O A;  3HI2 A;  3B57 A;  1G51 A;  2CJB A;  4GK0 E;  4WJ4 A;  2GK9 A;  3LBX B;  2XM2 A;  2IDO B;  4Z8X A;  2J3M A;  5ABE A;  3K8P C;  1W9R A;  4UVC B;  4YJ2 E;  3EDU A;  3RGL A;  1HXD A;  1NJ5 A;  2NW7 A;  2W63 A;  5HGQ A;  4LF4 T;  4YSZ A;  4O2A E;  3E22 E;  1X79 A;  2D0U A;  4X20 E;  3KV6 A;  3IBP A;  2W61 A;  2WM9 A;  2ZM2 A;  2DVE A;  3Q5X A;  2IHR 1;  4HWS A;  1IBK T;  2Z6E A;  4XEO A;  1VCT A;  2I6H A;  4CXX A;  3V8L A;  2XSA A;  4H63 V;  2ZZE A;  1SET A;  3O9X A;  1B7Y A;  3FJP A;  4UVA B;  2QGS A;  3ANW A;  3N9N A;  1H4T A;  3GN5 A;  2PG8 A;  2AKW A;  4I50 E;  4JI2 T;  2A2F X;  3VQX A;  4ANJ A;  2ACZ A;  3KFW X;  4QXB B;  4A56 A;  4AKH A;  2C5I T;  3PU3 A;  3JAE A;  5DQW A;  4KQE A;  4LF8 T;  3SWH A;  4HFE A;  2H88 A;  3OJA A;  3ONL C;  4KMC A;  1HC7 A;  3MXZ A;  2I4N A;  3T1H T;  2ZLY A;  2LRL A;  4JI1 T;  3VQW A;  4TNV A;  3CX6 B;  4CN4 A;  1FJG T;  4CH4 A;  2XAH B;  4L5G A;  2UUA T;  4OYJ A;  5FKY A;  3AA7 B;  4H2V A;  2X9X A;  3JC6 D;  2DLR A;  3KFU A;  4U72 A;  4YTM A;  2I4L A;  4IE6 A;  2V5C A;  3V7C A;  5FY7 A;  2CWY A;  2X0L B;  2IW5 B;  3HXZ A;  2BG9 C;  3FHN A;  2LJL A;  4DR3 T;  2QA7 A;  2KXP B;  4EO4 A;  2JRK A;  3L39 A;  1BIA A;  5GON E;  1E1O A;  3X1D A;  4CI2 B;  1UUS A;  2E1H A;  5FVL A;  3AE5 A;  5HXC A;  5L47 A;  2E41 A;  4MBQ A;  4DV4 T;  4CN6 A;  3JAD A;  4EOZ B;  1XNQ T;  1HF8 A;  3QTC A;  4UV8 B;  4A5X A;  2H7V C;  1JJC B;  3UFG A;  2X68 A;  4H9Q C;  4CXY A;  2C5J A;  3RQU A;  3QO7 A;  2BVM A;  3VKG A;  2ZT6 A;  4XU3 A;  1EFW A;  5JDN A;  3NVO A;  4H2X B;  4C90 A;  3A7M A;  5FP3 A;  5LB7 B;  3HRK A;  2DWK A;  3RYC E;  4YRQ A;  3ESL A;  2YEV C;  1WFD A;  5HEJ A;  5JDQ A;  5L3D B;  4EEB A;  4IT4 A;  4NXM T;  1UUR A;  1NAF A;  4BJN A;  3HKB E;  2DQ0 A;  2D0T A;  4PAG A;  4WBN E;  4QH5 A;  2WSS V;  3CVR A;  3SS1 A;  3LSS A;  3P8T A;  3RIU A;  3A8Y C;  4O2B E;  4YCU A;  4HWD A;  2WU5 A;  3VHL A;  4TWH A;  3V8K A;  5LGT B;  5H6R B;  3FZM B;  5IYZ E;  2V7M A;  5A1L A;  2EWN A;  4P0A A;  1JNR A;  2JMK A;  3HKE E;  3ZST A;  1I6Z A;  3H3A A;  3ETU A;  1ATI A;  4G2A A;  5DAB A;  4ZI2 C;  5JH7 E;  1FEW A;  4L9I A;  1SER A;  2CMR A;  2ZT7 A;  4XU1 A;  1HG5 A;  2X67 A;  5C3J A;  3J9X 1;  4BAY B;  4H63 H;  4ASK A;  2UU9 T;  2LM9 A;  4FI5 A;  4FJO A;  3N5L A;  5EK2 A;  5JDF A;  3ZN1 B;  3FBL A;  4TNW A;  3HKD E;  3R84 B;  4LMJ A;  4YP0 A;  3IAL A;  4NCX A;  1M7K A;  3L8R A;  2V7K A;  5JDL A;  3UTK A;  2CXF A;  4XBF B;  4JI5 T;  2WDV A;  2VKJ A;  3AB3 B;  3FBZ A;  1AJ3 A;  1Z7M A;  2QVA A;  2MYS A;  2MBG A;  4LNS A;  4ZI7 E;  5LYJ E;  2E64 A;  1YQ3 A;  1VRB A;  3PDY A;  2ZM0 A;  1XWM A;  5CA1 E;  3HA4 A;  2X0Y A;  3RUX A;  3B5M A;  2V6Y A;  1YD8 G;  2B76 A;  5JVD E;  2I4O A;  4U7I A;  5JDG A;  3MK7 C;  1HX8 A;  4DUZ T;  1YKH B;  3O1I A;  3P8Y A;  3P4Q A;  3HXU A;  4EX5 A;  3MZK B;  5AQL B;  2VKH A;  5L3F B;  3P4R A;  4G84 A;  2XY8 B;  3L4G A;  3RH3 A;  3OD1 A;  4DMW A;  4JI3 T;  1WPY A;  1KOG A;  4ZI2 D;  4M1P A;  4HWC A;  4HTE A;  5AQN B;  1SES A;  1MND A;  4HWI B;  3O1J A;  2ZNI A;  1OED B;  5HEU A;  2XQ7 A;  2KMF A;  2XPK A;  2V8S V;  2ZMA A;  4DBQ A;  2CLY B;  4DR7 T;  1FMV A;  4WI1 A;  1PYS A;  3HY1 A;  5FXW A;  4MAL A;  1FYF A;  3PU8 A;  3AVS A;  2K5B B;  1FIO A;  3CMQ A;  2RPA A;  4P3P A;  3RX6 A;  5ELO A;  4QHO A;  4CQI A;  4P73 A;  4TWF A;  4UVB B;  3VRB A;  3AE8 A;  2P5I A;  3K3Q C;  4TWA A;  3OTO T;  2A3D A;  3Q5E A;  2DDZ A;  3F31 A;  4HFH A;  3RC3 A;  4LF6 T;  2D9D A;  4X64 T;  4TVA B;  2BKO A;  1X56 A;  2ALY A;  4DV2 T;  4HKA A;  1KNP A;  5FY0 A;  5AQK B;  3KIN B;  1USY A;  4U3C A;  1QLB A;  2LKG A;  3A7A A;  4DR6 T;  1JNZ A;  4EXT A;  5JDH A;  2E9X A;  4B3M T;  3F57 A;  5HWX A;  3N9Q A;  3UU4 A;  3ONX A;  4PK5 A;  3UUN A;  4CS2 A;  3AAI A;  3N2G E;  4ILB A;  4P3O A;  3PUV F;  3P4P A;  3FXD B;  4IRE A;  3CQC B;  3UFE A;  4EZH A;  2CA5 A;  2VVN A;  4XTU A;  5HXS A;  1E1T A;  2ZIO A;  2HN2 A;  3LG7 A;  2KLQ A;  4YSY A;  5K1P A;  4X1Y E;  3NWI A;  5H6Q B;  2UXX B;  3NET A;  1ADJ A;  3L4G B;  2JJ9 A;  4B3R T;  4YRE A;  2K3W A;  4AI6 A;  3EFS A;  1VOM A;  5TAO A;  4P71 A;  4PJJ A;  4JUY A;  4WYV A;  5FL0 A;  3HXW A;  3ABV A;  2OV9 A;  4DMV A;  3NZP A;  3EUH A;  4CS3 A;  5L3C B;  4F8H A;  2ODV A;  4MHC A;  1IJ6 A;  4CI1 B;  1X2H A;  5LGN B;  2XZE A;  2J1D G;  3FB2 A;  4WW0 A;  2CGH A;  5LXT E;  2MAW A;  2DTH A;  3BQL A;  3DJB A;  3JAF A;  3AXJ B;  4NXN T;  3IF8 B;  2C8M A;  1W66 A;  2ZXF A;  3NEM A;  2QRX A;  2KWH A;  4HVC A;  4L0R A;  4Z91 A;  3AA6 B;  1J5W A;  4ZIB A;  3ZYM A;  4ZTU B;  4ZI3 C;  2XAJ B;  3DTO A;  2PJQ A;  3CKD A;  3EI0 A;  4PFP A;  5LG3 A;  2UUB T;  2XAG B;  4YCV A;  3O1H A;  3KDS E;  2MTQ A;  4QH1 A;  5KXJ A;  1H4V B;  1YFS A;  1WRD A;  3P4W A;  1ZKE A;  5LG4 A;  3PUX F;  4EZ4 A;  2WZI A;  4E7Z A;  2DZ9 A;  3CX7 B;  1T72 A;  3W15 B;  3AE6 A;  4H2Y A;  3T8O A;  3QO5 A;  2BS2 A;  5M4Y A;  2PBI A;  2BS3 A;  4HA8 A;  2XHE B;  2NP9 A;  2Q9Q A;  3N9M A;  4AQG A;  4PG3 A;  3UU6 A;  2VKO A;  3HFV A;  4O4J E;  5IUX A;  3I9Y A;  3OPC A;  4K86 A;  2ARU A;  3TUP A;  1MMG A;  3QB5 K;  3RKY A;  3VU7 H;  1G5I A;  3P4S A;  5LBM A;  4BJM A;  3WAJ A;  4EED A;  4GKJ T;  1OXZ A;  5HCM A;  4HFI A;  3K3N A;  2C7I A;  5LMU T;  3RPU A;  3HRI A;  4H2U A;  1XNR T;  2LSI A;  3HTZ A;  4YRJ A;  1EVK A;  1NJ1 A;  5ELN A;  3Q5W A;  5F3J A;  2CM0 A;  3C98 B;  2IIU A;  4PK4 A;  4DR1 T;  1QE0 A;  2Q7E A;  2Q5I A;  3B13 A;  3AA0 B;  4UEM A;  2AXD S;  4YTN A;  1KK7 A;  5LOV E;  4YDQ A;  4KHP T;  2WZH A;  4O4L E;  4DVD A;  3QC9 A;  4B6X A;  4H2T A;  4ZOL E;  2V7I A;  5C53 B;  3AE4 A;  3RKX A;  2N9D A;  4B3T T;  2ZR3 A;  3K1S A;  3RL6 A;  2W4X A;  4IE5 A;  2E5A A;  2NWB A;  3OYZ A;  4P72 A;  2AE9 A;  3M65 A;  1HNZ T;  4WBO A;  3UU8 A;  1LRZ A;  4OK0 A;  4TVY A;  2ODR D;  4LFC T;  2LSY A;  5FY1 A;  3Q5D A;  2YU2 A;  2BBH A;  3ZT5 A;  3ZT7 A;  5C8Y E;  5HXH A;  5JRE A;  2F4V T;  4IE4 A;  4BA9 A;  3PJA J;  4TX5 A;  2I59 A;  3ZEF B;  2XTL A;  3AEE A;  4UEL A;  1X01 A;  1D1C A;  1I94 T;  1D0X A;  3HY0 A;  4MLK A;  2E8I A;  3QB5 A;  4MFR A;  3RIU C;  5AQR B;  2DU7 A;  1UCU A;  3AEB A;  4IE7 A;  3ZSS A;  3PUR A;  2UUC T;  3TEH A;  4GYR A;  2E5V A;  2WAU A;  1D1A A;  1YFT A;  4P73 C;  2VL8 A;  3GN5 B;  5F8P A;  1Y01 A;  4PK6 A;  1ASY A;  3VR9 A;  2YIN A;  3CQX C;  4UP8 A;  1B8A A;  3CML A;  4GIW A;  2G0U A;  2XM1 A;  4U33 A;  1YW0 A;  3I0Q A;  3UUL A;  3ZPO A;  1B76 A;  2E9X C;  3M3Z B;  4X66 T;  3RKG A;  2UXD T;  5ABH A;  2QHT A;  2W62 A;  1RIQ A;  2CXD A;  2J47 A;  2ZZG A;  4BW9 A;  3D0T A;  3VR8 A;  2JQ9 A;  3L09 A;  5AQU B;  4Q6G A;  2WQY A;  5LHI B;  4OFZ A;  4K88 A;  3U3I A;  4XU0 A;  2H89 A;  4IL9 A;  4AKG A;  3PUW F;  4O4H E;  4PNI A;  3ZKR A;  4JI6 T;  2IUB A;  2ARS A;  4V1A v;  1EVL A;  3L2Z A;  4YJ3 E;  4QX7 B;  1GQE A;  2AMC B;  2EHO C;  4CXW A;  5CFB A;  2Y8D A;  3OKQ A;  3EHZ A;  4TUY E;  4EV6 A;  3RIA A;  2Q5H A;  2LM2 A;  1QF6 A;  4IDQ A;  1E7P A;  3CWZ B;  1NWM X;  2VWA A;  3RF1 A;  3AED A;  2XQ8 A;  2K24 A;  3UT5 E;  1LYL A;  2E9X B;  2VVS A;  1G73 A;  4KX6 A;  2WWU A;  3L3P A;  4NIQ A;  2EL9 A;  5JR9 B;  4I4T E;  4TQF A;  2NR4 A;  3UUM A;  1HS7 A;  3P50 A;  5LBQ B;  3NRY A;  2C5K T;  4K0U A;  1HTJ F;  3HXX A;  4O4I E;  4YSX A;  2HN1 A;  2RHQ A;  3AVR A;  5KNN A;  4ZTZ B;  3IKL A;  3KBU A;  4UP9 A;  2A72 A;  2RHS B;  4H9P C;  1NJ6 A;  2LHN A;  4XTX A;  5J0Z A;  4KBM B;  4UP7 A;  1C0A A;  1XMQ T;  2Q9Q C;  5FVK A;  2KSR A;  2C0S A;  1L0W A;  3ZMS B;  1ZV4 X;  4JI4 T;  2Q7H A;  4YRR A;  4F6R C;  1NEN A;  4IIJ E;  1ASZ A;  5LMN T;  1NEK A;  1WNL A;  3O4X E;  4JI0 T;  1G5H A;  3SFE A;  4KUM B;  5ABG A;  2ZIM A;  1W09 A;  5CGM A;  3C4W A;  3RIR A;  5HEG A;  1BR0 A;  4HFB A;  2DTO A;  3ZMV B;  4YCW A;  2KIN B;  3N2O A;  4PHC A;  4LVI A;  2W67 A;  3C51 A;  2HNI A;  2VKD A;  3MEY A;  2MOZ A;  2D5U A;  3BQK A;  4O2D A;  2WU2 A;  4P71 C;  4XTV A;  4HGA A;  3M4Q A;  4DID B;  5HXR A;  2PFV A;  4DND A;  1E1H B;  3PCO A;  3VQY A;  1E22 A;  3ZLI A;  2CBJ A;  3IKM B;  2BS4 A;  3AEC A;  1NJ2 A;  3HL6 A;  3CX8 B;  1XDO A;  4YHJ A;  3A31 A;  5L4H A;  3A7U A;  1EIY A;  2N2N A;  3HFZ B;  4YRO A;  4RDX A;  2LHR A;  2G4C A;  3C64 A;  5AQM B;  4NUV A;  3RHW A;  4DR5 T;  3L1A A;  2BG9 A;  2ZZF A;  1H4S A;  4I43 B;  2FJB A;  5CA0 E;  5LJN A;  4OP0 A;  2CHN A;  5AQH B;  2WY2 A;  4TVW A;  5CB4 E;  5AQO B;  4LVL A;  2EAY A;  4ILU A;  3A5X A;  4JEH B;  5HAX A;  5ABF A;  2IC9 A;  4X5O A;  4GYS A;  2BVL A;  3ZCI A;  3PCO B;  3LK4 2;  1HNW T;  4DV0 T;  2XAF B;  1W0A A;  4AIS A;  1E24 A;  3HFZ A;  1J1J A;  2DTI A;  1EIY B;  2DNX A;  1QUU A;  2E9X D;  3RKO A;  2M67 A;  4UR9 A;  4G85 A;  4H9O C;  2EJ9 A;  4KR3 A;  4H9R C;  3A5Z A;  5JTG A;  4Q25 A;  4AKR B;  4LFB T;  3VKH A;  5LHG B;  1BR1 A;  5AQQ B;  3ZN0 B;  2XQ4 A;  1T7S A;  1WR0 A;  1SE7 A;  2ZM6 T;  2L3L A;  2IY5 B;  4QXC B;  4YRK A;  5LJM A;  4K0K T;  2X0H A;  2LOS A;  1WYC A;  4JI7 T;  1YB3 A;  4BWA A;  1HCI A;  4IE0 A;  4HWP A;  3CPZ A;  1MNE A;  4H2X A;  2WCA A;  4GK5 E;  4K87 A;  3A7R A;  2FUP A;  2DJZ A;  4IGU A;  2ZTG A;  1YGB A;  2P9B A;  3T1Y T;  2BDE A;  1WU7 A;  2BKP A;  3LSV A;  2ACX A;  3AEF A;  4LVK A;  3I7F A;  2XSB A;  2BG9 E;  2EHO D;  5LGU B;  2DXU A;  2HHH T;  3AE7 A;  1QSD A;  2CE7 A;  1T8B A;  2W66 A;  4YRC A;  2V26 A;  4IDN A;  3WI3 A;  4H2W A;  4COF A;  2KWI B;  2RHS A;  3R07 A;  5L3G B;  4ISS A;  1MMD A;  3DSQ A;  3V7S A;  4HE8 A;  2EJF A;  3MF1 A;  1WCR A;  2JMH A;  1N32 T;  1WYD A;  2V1D B;  4AQF A;  4AIU A;  5JRC B;  4XZC A;  1D1B A;  2LOP A;  3AEG A;  2LKH A;  4P74 A;  2EHO A;  3REU A;  4LVM A;  3ZMU B;  4IDP A;  2CBI A;  4XAX B;  4H9N C;  1BR4 A;  1BIB A;  3HXY A;  2BBJ A;  5LNK A;  4HFC A;  2ODU A;  4HWH A;  3JCF A;  2WBL A;  5CJ5 A;  2E65 A;  2J4G A;  3QO8 A;  5K1X A;  2B1E A;  4I0U A;  5AQP B;  5AQV B;  1WR6 A;  1L0V A;  3LJC A;  3WAK A;  2VK9 A;  1N36 T;  2LE8 A;  2LRK A;  1J5E T;  2WS3 A;  2DKG A;  3BQI A;  5BR8 T;  2DL1 A;  4P74 C;  2SPC A;  4L87 A;  2A8E A;  3TLW A;  2AKW B;  5LHH B;  2P0L A;  2FJD A;  1B7Y B;  4OX9 T;  2W00 A;  3PTR B;  4DO0 A;  1WLX A;  2XQY A;  4P75 A;  4DR2 T;  2ZGW A;  4H02 A;  2UXN B;  2KND A;  4ZEY A;  2DWG A;  2CJ9 A;  4HFD A;  3VQV A;  3ERR A;  2LSK A;  3RI5 A;  5HEH A;  3LFM A;  3LC0 A;  3G06 A;  3PV0 F;  4ZHQ E;  4IDO A;  4E7S A;  1EQR A;  2A9U A;  3LBX A;  4AKI A;  1IBM T;  2XGT A;  2FJE A;  1HR0 T;  4QKN A;  3E9I A;  1OED C;  1ZP0 A;  3LDQ B;  4KI0 F;  1KF6 A;  4AKL A;  3K3O A;  3FZH B;  3QK6 A;  2NTY A;  4G63 A;  4HEA A;  2YU1 A;  1B70 A;  2ZR2 A;  2OLT A;  2ART A;  3EDV A;  3RQW A;  5JDM A;  5J2U E;  2VUR A;  5FL1 A;  4AQY T;  3P7I A;  1N34 T;  4Q15 A;  1KMN A;  2WP9 A;  1H7C A;  3QOF A;  4CI3 B;  2ZIN A;  4YRP A;  3MF2 A;  1H4Q A;  1ZHC A;  1S94 A;  2VAS A;  2CIM A;  4YRF A;  3KV9 A;  5IWA T;  3AE1 A;  5J1G A;  1VCS A;  2EHO B;  2ALY B;  2LSG A;  2XUE A;  2KZ7 B;  3TEH B;  1HFA A;  5JRC A;  3PUZ F;  5L2L A;  1Z7N A;  4CH5 A;  3JC6 C;  4H9S E;  2ZNJ A;  3BK9 A;  4ILA A;  3ONJ A;  1BBU A;  2LEH A;  5FNV E;  5FYM A;  4CN1 A;  1SA0 E;  4TV9 E;  4YRL A;  2ZM8 A;  2NW8 A;  3UGT A;  1GGM A;  2E10 A;  1PYS B;  3KV4 A;  4EIW A;  4X62 T;  1X55 A;  3C4Z A;  2HPJ A;  4YRS A;  2PTF A;  5FXX A;  3IG2 A;  5J2T E;  4LML A;  2HH7 A;  4UXN B;  4ZS2 A;  4U74 A;  1X54 A;  4AXP A;  4XEM A;  3CIR A;  5AQI B;  5EZY E;  2L8K A;  3A74 A;  4XTW A;  4NUU A;  3ZYK A;  1YQ4 A;  4DPG A;  4DV7 T;  1ZEE A;  4AQF C;  3OBV E;  2QHU A;  2IY5 A;  2X51 A;  5LP6 E;  2DCF A;  4H2S A;  3REX A;  1OWA A;  3VRA A;  4YT0 A;  3RKW A;  2ODR C;  3OYX A;  1BR2 A;  4DV5 T;  4P72 C;  3S4U A;  1S35 A;  5F5W A;  2V5D A;  2W0G A;  1NNH A;  4O8S A;  1HNX T;  4DQ2 A;  3V8J A;  4JYA T;  4RQF A;  1B7T A;  3G1Z A;  4OHF A;  4LF9 T;  3MQZ A;  3MA9 A;  4YHH T;  2X9Y A;  1M62 A;  2XQ5 A;  4UV9 B;  5LA6 E;  2VQE T;  3TLS A;  3I1A A;  2FBW A;  4EAH A;  2E5L T;  5L4E A;  2WMO A;  4GOU A;  3UGQ A;  3J7Y q;  2R6G F;  2I4M A;  3N9L A;  4U7Y A; 
#chains in the Genus database with same CATH homology
 2DU5 A;  4J15 A;  3EFS A;  4P71 C;  4XTV A;  4P71 A;  2XTI A;  3M4Q A;  3HXW A;  2PMF A;  4CH6 A;  4CS3 A;  1X2H A;  3E9H A;  1HTT A;  3W3S A;  2CGH A;  3PCO A;  3VQY A;  1E22 A;  2DTH A;  3IKM B;  1NJ2 A;  2DXT A;  3A31 A;  3A7U A;  4HWR A;  1EIY A;  3HFZ B;  4YRO A;  4RDX A;  2C8M A;  2G4C A;  1G51 A;  4WJ4 A;  2CJB A;  1W66 A;  2ZXF A;  3NEM A;  3L1A A;  2ZZF A;  4HVC A;  1H4S A;  2J3M A;  1J5W A;  4OP0 A;  4ZIB A;  2CJA A;  1BBW A;  4ZTU B;  3RGL A;  1HXD A;  1NJ5 A;  4TVW A;  4LVL A;  2EAY A;  4YRM A;  5HGQ A;  1B70 B;  4YCV A;  5C52 B;  3VBB A;  4X5O A;  1YFS A;  1H4V B;  3PCO B;  2DZ9 A;  4TTV A;  1E24 A;  2DVE A;  3HFZ A;  4HWS A;  2DTI A;  1NYQ A;  1EIY B;  4XEO A;  3PZC A;  4H2Y A;  3QO5 A;  3V8L A;  4G85 A;  11AS A;  2EJ9 A;  4KR3 A;  2ZZE A;  3A5Z A;  1SET A;  1B7Y A;  3FJP A;  1H4T A;  4HA8 A;  2Q7G A;  2AKW A;  3LSQ A;  5C51 B;  3VQX A;  4PG3 A;  2ZT5 A;  4TQD A;  2IY5 B;  3HFV A;  4YRK A;  2ZT8 A;  4KQE A;  3HXV A;  4XU2 A;  4K86 A;  2ARU A;  1HC7 A;  1YB3 A;  3TUP A;  4BWA A;  2I4N A;  3VQW A;  4HWP A;  4CH4 A;  4H2X A;  3RKY A;  1G5I A;  3NEL A;  4K87 A;  3A7R A;  2DJZ A;  2ZTG A;  4H2V A;  1YGB A;  1ADY A;  3A5Y A;  1WU7 A;  2C7I A;  4HWT A;  3HRI A;  4H2U A;  3KFU A;  2I4L A;  4RMF A;  3HTZ A;  4YRJ A;  4YRN A;  1EVK A;  4LVK A;  1NJ1 A;  2DQ3 A;  5ELN A;  3I7F A;  3V7C A;  4TVA A;  1NYR A;  3HXZ A;  2DXU A;  1X2G A;  1QE0 A;  2Q7E A;  2Q5I A;  4EO4 A;  1BIA A;  2RHQ B;  4YRC A;  1EOV A;  4H2W A;  1E1O A;  4YDQ A;  2RHS A;  3UH0 A;  2E1H A;  3R07 A;  3DSQ A;  3V7S A;  2E41 A;  2EJF A;  3MF1 A;  4H2T A;  5C53 B;  2E3C A;  1WYD A;  3QTC A;  3RKX A;  1JJC B;  3RAC A;  3UFG A;  2ZR3 A;  12AS A;  2AMC A;  4P74 A;  3M4P A;  3REU A;  3RL6 A;  4LVM A;  2E5A A;  3QO7 A;  4P72 A;  2ZT6 A;  4YRI A;  4XU3 A;  1BIB A;  3HXY A;  4TVY A;  2ODR D;  1EFW A;  4H2X B;  2E65 A;  4XTY A;  3QO8 A;  3HRK A;  5K1X A;  4YRQ A;  3P8V A;  4YRT A;  4WJ3 M;  2DKG A;  2DQ0 A;  1X01 A;  4P74 C;  4L87 A;  2A8E A;  3EFR A;  2AKW B;  3HY0 A;  3BFM A;  2P0L A;  3LSS A;  1B7Y B;  3P8T A;  2PME A;  4P75 C;  1WQW A;  2DU7 A;  4P75 A;  1YFR A;  4YCU A;  2DZC A;  2ZGW A;  1NJ8 A;  4KR2 A;  4H02 A;  4WF2 A;  3TEH A;  3V8K A;  1YFT A;  2CJ9 A;  3VQV A;  3ERR A;  4P73 C;  2EWN A;  3LC0 A;  1EQR A;  1ASY A;  1ATI A;  4E51 A;  3A32 A;  1SER A;  2XGT A;  3TEG A;  2ZT7 A;  4XU1 A;  4UP8 A;  4HT4 A;  1B8A A;  3E9I A;  1USY C;  4CH3 A;  1KMM A;  1WQ7 A;  1B76 A;  1B70 A;  4YP0 A;  3QNE A;  3IAL A;  2ZR2 A;  4NCX A;  2QHT A;  2ART A;  1RIQ A;  2ZZG A;  4BW9 A;  1Z7M A;  4LNS A;  4Q15 A;  1KMN A;  2E64 A;  3ICA A;  4Q6G A;  2EJG A;  4K88 A;  2ZIN A;  4YRP A;  3MF2 A;  3RUX A;  1H4Q A;  4XU0 A;  2FYK A;  2CIM A;  4YRF A;  2ARS A;  4YPF A;  1EVL A;  3L2Z A;  2ALY B;  2DEQ A;  2I4O A;  2AMC B;  4XTZ A;  3TEH B;  2Q5H A;  3P8Y A;  4YYE A;  1Z7N A;  4CH5 A;  1QF6 A;  3HXU A;  4EX5 A;  2ZNJ A;  1IL2 A;  4OLF A;  4G84 A;  4LVJ A;  3L4G A;  3RF1 A;  3OD1 A;  1BBU A;  4CS4 A;  1WPY A;  1KOG A;  1LYL A;  4YRL A;  1SES A;  3UGT A;  1GGM A;  2E10 A;  1PYS B;  3NEN A;  2EL9 A;  2ZNI A;  4TQF A;  1X55 A;  4UPA A;  4HWO A;  3WQZ A;  4YRS A;  3IG2 A;  3HXX A;  4WI1 A;  1PYS A;  2RHQ A;  3HY1 A;  1FYF A;  1WLE A;  5KNN A;  2J3L A;  4AH6 A;  2ZCE A;  4ZTZ B;  1X54 A;  4XEM A;  3CMQ A;  3IKL A;  3V7R A;  4P3P A;  4UP9 A;  5ELO A;  3A74 A;  4P73 A;  2RHS B;  4P3N A;  1NJ6 A;  1JJC A;  4XTW A;  4XTX A;  2P5I A;  2QHS A;  4DPG A;  4TWA A;  4UP7 A;  1C0A A;  2QHU A;  2IY5 A;  2DDZ A;  4H2S A;  3REX A;  1L0W A;  4TVA B;  1X56 A;  2ALY A;  2Q7H A;  3RKW A;  4YRR A;  2QHV A;  3BJU A;  2ODR C;  1USY A;  4P72 C;  1ASZ A;  1SRY A;  1VQZ A;  5F5W A;  3A7A A;  1WNL A;  1G5H A;  1NNH A;  4DQ2 A;  2ZIM A;  3V8J A;  4CS2 A;  4RQE A;  4RQF A;  4P3O A;  3G1Z A;  1N9W A;  5E3I A;  3RIR A;  2DTO A;  4YCW A;  3MQZ A;  4PHC A;  4XTU A;  4LVI A;  1E1T A;  2ZIO A;  2HNI A;  4YRG A;  5K1P A;  3MEY A;  3UGQ A;  2NS6 A;  1ADJ A;  3NET A;  3L4G B;  4O2D A;  2I4M A;  4YRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...