1J5WA

Crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
276
Chain Sequence
MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Ligase
molecule keywords Glycyl-tRNA synthetase alpha chain
total genus 95
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 1j5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1j5wA01
1WNLA 1EQRA 3IG2A 4RQEA 2ALYA 3BJUA 2E64A 4HWOA 4CH5A 4HWPA 4YPFA 2I4MA 2DTIA 4BW9A 3A5YA 2CJBA 4TVYA 5HGQA 3VQWA 4P73A 3FJPA 4LNSA 4H2YA 4WJ3M 4TWAA 4XU2A 3HFVA 2ZTGA 3MF2A 4YP0A 2AKWA 4Q15A 2Q7EA 2ZCEA 3EFRA 4XEMA 2DU5A 1EVKA 3M4PA 1W66A 11ASA 1LYLA 2ZR3A 3PZCA 3V8KA 1PYSB 4J15A 1ASYA 3LSQA 4ZTUB 3L4GA 3V7CA 1YFRA 4KQEA 4TVAA 1B70B 3TUPA 4HVCA 4L87A 1IL2A 3L1AA 3HXXA 1YB3A 2J3LA 4H2WA 3A7UA 1WLEA 3BFMA 2DDZA 1E1OA 2EJGA 4P3PA 1SRYA 2DEQA 1BBWA 4O2DA 3UH0A 4UP8A 2ZT8A 1WQ7A 1J5WA 1SETA 3HRKA 4RMFA 4XTYA 4XEOA 1B76A 1E22A 5E3IA 12ASA 1BBUA 4YYEA 1G51A 1YFTA 4H2VA 3A7AA 2G4CA 4P73C 2AMCA 3W3SA 2EAYA 1X55A 4RQFA 4YRKA 2QHUA 3P8TA 2IY5B 3RUXA 3NETA 4TQFA 1NJ1A 4XTWA 3RKWA 1EIYB 1X54A 2QHSA 4XTZA 1WQWA 3HY1A 4H2TA 2P5IA 4ZIBA 2DTHA 4XTVA 2I4LA 3RF1A 5C53B 3LSSA 1NJ5A 3KFUA 2DZ9A 1NJ6A 4H02A 1B7YB 3L2ZA 1BIAA 1EVLA 2PMEA 4YRTA 1ADJA 3REUA 3VQVA 2CJAA 3V8LA 2DQ0A 4YRQA 4YRNA 1QE0A 1N9WA 1H4VB 4P72C 3EFSA 2ZNJA 2I4NA 4YROA 1ASZA 3TEHB 5C52B 2Q7HA 5K1XA 1HXDA 4CS3A 2RHQA 3A5ZA 1X01A 2ZT7A 2P0LA 3UGQA 3VQXA 2ZT6A 4TQDA 4YRFA 2DZCA 2ARUA 2ZINA 1JJCA 2E65A 3V7RA 4Q6GA 4YRMA 5F5WA 4YRRA 2ZR2A 2E10A 4HWSA 4P74A 3A7RA 1EIYA 4OLFA 3RKYA 2ZZFA 1B7YA 4WJ4A 2RHSB 3I7FA 1Z7NA 4P75A 3A32A 3RACA 2C7IA 2DTOA 4PG3A 3V7SA 1JJCB 1KMNA 2EWNA 4P74C 3R07A 4TVWA 4UP7A 2Q7GA 4P71C 3IKMB 4YRIA 4RDXA 1ADYA 2CIMA 3M4QA 3NELA 4H2SA 3A31A 4K87A 4WI1A 4HA8A 3HFZB 1NJ2A 4YRCA 4CS2A 3P8YA 4HWTA 2J3MA 4EO4A 2ZZGA 2QHTA 3RL6A 5KNNA 3P8VA 3PCOB 1KMMA 1PYSA 2DJZA 2CGHA 2ARSA 4YRJA 2C8MA 4G84A 4E51A 1NYQA 1FYFA 5C51B 4HWRA 4OP0A 4UP9A 3IKLA 2EJFA 2DXUA 1BIBA 3HXYA 3MF1A 3RIRA 4YREA 1E24A 2ZT5A 4BWAA 1X56A 2E41A 3A74A 4XU0A 4CH4A 3IALA 4CS4A 4YCUA 3HXUA 1HC7A 2DU7A 3HTZA 4AH6A 2E1HA 4P71A 3VQYA 3WQZA 4WF2A 3LC0A 3ICAA 3UGTA 4XU3A 2DXTA 3PCOA 4YRLA 4X5OA 4NCXA 3HXWA 2ZNIA 3HRIA 3RKXA 1WU7A 4YDQA 4XTXA 3L4GB 3VBBA 4K88A 3RGLA 2HNIA 1QF6A 3E9IA 3HXZA 3QTCA 3HFZA 2E5AA 1NYRA 3HY0A 2DVEA 1X2GA 2ODRC 2ZIMA 1EOVA 2Q5HA 4K86A 2EL9A 4YCVA 4G85A 4P72A 3TEGA 3UFGA 3DSQA 2CJ9A 1VQZA 4YRGA 2RHSA 2DQ3A 1USYA 1B70A 1G5IA 2AMCB 2ZIOA 3MEYA 1RIQA 4DQ2A 1ATIA 3G1ZA 3CMQA 4XTUA 5K1PA 4H2UA 4P3OA 1YFSA 1Z7MA 3OD1A 1C0AA 2Q5IA 3QO5A 3HXVA 2ARTA 2ZGWA 4TVAB 1G5HA 4H2XA 2FYKA 3QO8A 1E1TA 1H4QA 1KOGA 1NNHA 1HTTA 1H4SA 1NJ8A 4P75C 2EJ9A 1X2HA 1H4TA 2I4OA 1WPYA 2XGTA 3NENA 4TTVA 1USYC 4YRSA 2ZXFA 1SESA 4PHCA 4CH3A 4P3NA 4ZTZB 2ODRD 2RHQB 3QO7A 2PMFA 1GGMA 4KR3A 3TEHA 2E3CA 4H2XB 4CH6A 3QNEA 1L0WA 3ERRA 5ELOA 1EFWA 4XU1A 1WYDA 2DKGA 4DPGA 2XTIA 3V8JA 3REXA 4EX5A 1SERA 1B8AA 2ZZEA 4UPAA 4YRPA 2ALYB 1YGBA 4KR2A 2IY5A 4YCWA 3NEMA 2AKWB 5ELNA 2QHVA 3E9HA
chains in the Genus database with same CATH superfamily
3IG2A 2ALYA 3MACA 3BJUA 2WCAA 4U72A 4JV5T 4MALA 3AE6A 4JI6T 2XQ9A 1LKXA 2KZ7B 1VCSA 2CJBA 4TVYA 5HGQA 4PJLA 4WJ3M 1D0XA 3FJPA 2WZHA 2VKDA 4XU2A 3HFVA 3W15B 3Q5EA 4ZI7E 3AB3B 1OEDB 2AKWA 2KXPB 2BKNA 2ZCEA 3EFRA 5LXTE 1EVKA 3NWIA 4GKKT 2BZBA 2UXCT 2ZR3A 2DL1A 3UU4A 1SUMB 2VKOA 1YFRA 3SRZA 4O4LE 2X0LB 4KQEA 5HCMA 3CPZA 4L87A 3ABVA 3C4ZA 3L1AA 1W0AA 3HXXA 3O4XE 3Q9DA 4JI0T 5AQOB 4B3TT 1ZP0A 3LG7A 1FMVA 2KWHA 1SRYA 3AEEA 1CHUA 2UUBT 3D0TA 3HL6A 5L3CB 1WQ7A 2VKHA 1SETA 2ZM6T 4RMFA 4XTYA 4ISTA 3F57A 3I0OA 5C2TA 2FUPA 4LMLA 4N78D 4UF0A 4LF9T 12ASA 4LF6T 1BBUA 4YYEA 2ODVA 2G0UA 5EZYE 4BA9A 1YFTA 4EYUA 3ZSTA 2L9QA 4U3CA 4NUUA 2WAUA 4CN6A 4MHCA 2EAYA 1LRZA 3O1HA 4YRKA 3RUXA 4OHFA 3OYXA 4EZ4A 3N9PA 1NJ1A 2Z6EA 3PUVF 2JQHA 2KINB 4IIJE 2QHSA 2E9XA 4CXWA 5LGTB 4PFOA 3RLFF 3ZMTB 3HY1A 2C5KT 4ZIBA 1NJ5A 1X79A 3FBLA 4DBQA 3O1JA 4H02A 3ZMUB 1B7YB 3L2ZA 3AE8A 4YRTA 4DUZT 2YDRA 2WWUA 2V8SV 1WRDA 3N9NA 5BMVE 3VKHA 2R6GF 4YRNA 1QE0A 1H4VB 5HEOA 4YROA 5ABEA 4H63H 5K1XA 2CXFA 3BK9A 1HX1B 4COFA 2LOSA 3ZCIA 5CJ5A 2IUBA 2A72A 2PBIA 5H6RB 2RHQA 1X01A 2CE7A 2CEAA 4YJ2E 3UGQA 1T72A 3ZYKA 3R6NA 5L3DB 1VOMA 4TQDA 4YRFA 4X64T 2DZCA 5CFBA 5L47A 1SHZC 1JJCA 3VRAA 1I6ZA 4YRMA 3AEFA 5AQSB 2ZR2A 3SS1A 2NS6A 4HWSA 4P74A 4OLFA 2YN6A 5LG3A 2YOEA 2CCQA 2NP9A 2LT3A 2BG9B 3RHWA 4EV6A 3A32A 3ZC0A 1GQEA 4P0AA 2RA1A 1JJCB 1LVKA 5ABFA 3UU8A 3PV0F 3LFMA 1MNEA 3LSVA 1T8BA 4YRIA 4YHJA 2ACXA 5AFUL 3RPUA 2YDSA 2CHOA 1Z0PA 1ADYA 5GONE 1MMGA 4K87A 1Y64B 2V7MA 4U2ZA 3HFZB 4NXNT 4OX9T 1NJ2A 4CS2A 2J3MA 4JI5T 2LM2A 4EO4A 2QHTA 2NW8A 3FHNA 3RQUA 4X65T 2NR4A 2IC6A 4PJMA 2UU9T 4A5XA 2DJZA 3FB2A 3N9OA 1IAPA 2XQ5A 2AE9A 5LGNB 3O1IA 2VWAA 4YRJA 3OTOT 4LVMA 3EDUA 2C8MA 4E51A 3ESLA 3Q2MA 3CX6B 4OP0A 2X9YA 4UP9A 4AKRB 2DXUA 3HXYA 2UUCT 3CQXC 5AQGB 4YREA 2LEHA 2CWYA 5JR9A 4KHPT 1X56A 5FXWA 3C98B 5HXEA 3UTKA 4XU0A 3IBPA 1BR2A 1HC7A 1D0ZA 3E0ZA 3RH3A 4F6RC 4DIDB 3IHRA 5FY1A 4PK5A 3VQYA 3PUYF 2M6BA 1BR0A 3MXZA 3P4SA 3LC0A 1E1HB 3ICAA 4Z8XA 3RIUA 2DXTA 4YRLA 1MMNA 2E9XC 3CIRA 2NW7A 3RKXA 2B76A 4P09A 1WU7A 3N2KE 4YDQA 2PG8A 3L4GB 3VBBA 3PUWF 3RGLA 1O3XA 4HFVA 2J62A 3HXZA 3I0QA 1YD8G 3HFZA 1US7B 3NVOA 1WYBA 2E5AA 3KV9A 4H9QC 4IGUA 2XPKA 3AA0B 5HYAA 4XAXB 5LOVE 3PU8A 4X1IE 2CWOA 3ZYMA 1XNQT 3T1YT 4K86A 5LHHB 4I55E 2V6XA 4G85A 3TEGA 4YXDA 3UFGA 1DU2A 4U33A 4YRGA 4IREA 3UU3A 2LJLA 2QA7A 4IT4A 2DQ3A 1XDPA 4AKGA 1B70A 2AMCB 4AI6A 2ZIOA 4OK0A 1ATIA 5JDGA 2LLYA 5J2UE 4P3OA 1YFSA 5HXRA 5IYZE 2MBGA 5FY7A 3NZPA 4TWDA 1HNXT 2K5BB 5JDMA 2V7IA 2ZGWA 1HNZT 2FYKA 1E1TA 2ZM0A 4UV8B 4DR1T 3PUGA 1MIYA 3QNUA 4TTVA 5JR9C 2W00A 4ZI3C 1FMWA 4B3MT 2HHHT 5FL0A 2ODRD 2L8KA 2RHQB 1U4QA 3P4PA 3EDVA 4KR3A 3QUJA 1KNRA 2LKHA 2J4GA 2YEVC 3L09A 3AECA 3GA8A 4HFDA 2UXXB 1HX8A 4LFBT 3HKBE 5L3EB 2LHRA 4ILBA 3S4UA 2DKGA 3ZPOA 5JDFA 3DJBA 5FVKA 2IW5B 1SERA 4HKAA 2M6IA 2X9XA 1YGBA 2YU2A 3H3MA 4GYSA 4YCWA 3NEMA 5HCJA 2VQET 1WNLA 1EQRA 3MKDA 4YTPA 1NAFA 3AAIA 3AE4A 2E64A 2WS3A 2ZLYA 4QKNA 2NW9A 4YPFA 4WBNE 2DTIA 3HA4A 4LF7T 2BKOA 5J2TE 4Q25A 4AKHA 2JJ9A 2Y6XA 2E8IA 1MMDA 3VQWA 5LGUB 4P73A 4H2YA 4ADZA 4TWAA 2WB5A 1UCUA 1XDOA 1UURA 2ACZA 3ZT5A 1HNWT 4JEHB 4Q15A 2Q7EA 1W0BA 2DU5A 3F2EA 3M4PA 4LVJA 1KF6A 4AXPA 3EI0A 4JI1T 2FJEA 1W66A 4J2CA 3ZYLA 4C90A 2VQFT 2XAQB 11ASA 3OVUA 1LYLA 2XY8B 3PZCA 3LSQA 4ZTUB 2DWGA 4PK4A 5JVDE 3L4GA 3V7CA 5EK3A 2V5CA 2LSYA 5CB4E 4HWFA 4HVCA 4DR2T 2YU1A 4AQFA 2J3LA 4H2WA 2YK0A 5FKYA 2IC9A 1WLEA 2A3DA 3JAFA 2BS3A 2EJGA 3KV6A 3P8CD 5AQJB 4BJMA 2RPAA 3ZMVB 5CGMA 1J5ET 2ZT8A 5LG4A 3HRKA 4A56A 3AVRA 2B1EA 5FP3A 4DR6T 4H9NC 4PFPA 4DVDA 1E22A 1NEKA 2DHRA 5LMNT 3RC3A 5E3IA 5FY0A 4JYAT 1G51A 5LNKA 3HR0A 2K3WA 4WYVA 5FYMA 2G4CA 4P73C 2BKPA 2AMCA 4RQFA 1KK7A 4X62T 1IZNB 2QHUA 3P8TA 2WMOA 3K1SA 5AQUB 4TQFA 1UX4A 4DV4T 2V7LA 3PUQA 3RKWA 1EIYB 4JI3T 1XMOT 3V5UA 1IBKT 4YFSA 4IL4A 4H9SE 2DNXA 4QX8B 5LCYA 5HXSA 5AQTB 4WZXA 2N9DA 4XTVA 3UQ4A 4BAYB 1NWMX 4LMKA 3T8OA 2XQAA 1EVLA 2PMEA 3DTOA 4YTNA 2CHNA 3REUA 4E7SA 2CJAA 3V8LA 2DQ0A 4P72C 1HCIA 4WNKA 3NZQA 1ASZA 1B7TA 3IA3A 3CK6A 5ABHA 2UXDT 1H7CA 1T98A 2FJDA 4HWHA 4B3RT 3A5ZA 2BVMA 2LHNA 3SOLA 3VQXA 5HEJA 3AEDA 2ARUA 5IWAT 5F5WA 1YKEB 4H9PC 2QRXA 4H63V 2EHOC 2E10A 4V1Av 3PUAA 3A7RA 3OYZA 3QB5A 3RKYA 4ERRA 3QK6A 4ZS3A 1Z7NA 1HFAA 1UX5A 3RACA 2FJBA 4PJJA 4PG3A 2KT9A 2XASB 4UR9A 1VCTA 1KMNA 5HEGA 2EWNA 4P74C 2D0TA 1IJ6A 3G06A 4TVWA 1FIOA 2A9UA 3N9MA 3IKMB 3P4QA 4IE0A 3QB5K 4O4IE 2CA5A 5BR8T 2CIMA 4HTEA 5JH7E 2VURA 2I0MA 3A31A 4JBWF 4HWTA 2ZZGA 1G73A 5DABA 3OBVE 5AQFB 4O2AE 1KMMA 3UUMA 5FXXA 1NYQA 1FYFA 4UV9B 5C51B 1BIBA 1KFYA 2XZEA 5IUXA 2D5UA 5CA1E 4CI1B 3JC6C 3GN5B 4HWDA 4YJ3E 3KDSE 3HTZA 2LRKA 4AH6A 3RIUC 4G63A 3TLUA 4P71A 2J47A 4WF2A 1U5PA 3FBZA 4EZHA 2Y48B 3LK3B 2WWVA 4DV2T 4DV6T 3RKGA 4XU3A 4DV0T 3AE5A 5LBQB 4X5OA 5AQPB 4NCXA 3HXWA 3RYIE 4XTXA 4TNVA 4YLHA 2N1GA 2XQ7A 3BQKA 3N9LA 5ADXL 3QTCA 3Q5XA 4TWHA 4ZXLA 1OXZA 1KNPA 1MMAA 3HY0A 4ZS2A 2V5DA 3C50A 5KXJA 2AXDS 2DVEA 2DCFA 3ZCJA 4HGAA 2W61A 4WBOA 2ODRC 4O8SA 4HEAA 4L0RA 2EL9A 4TX5A 3VHLA 3HKCE 3LDQB 4IDOA 2C0SA 2PFVA 4YCVA 2YINA 2NTYA 1Y01A 4UEMA 3EUHA 4I4TE 1MNDA 2CJ9A 4UIGA 3ETVA 3WAJA 2JMKA 3AE9A 3I1AA 2H7OA 1HG2A 4IDPA 4DO0A 4MFRA 5AQQB 1QLBA 4DQ2A 3G1ZA 4MLKA 4YY3T 4XTUA 5K1PA 2H7VC 1Z7MA 2XHEB 1WFDA 1BR1A 3B13A 4TV8E 2V6YA 3B57A 2MPKA 4IL9A 1XMQT 3KVAA 3HXVA 4LMJA 3QO5A 5JQGE 2LSKA 3L39A 2XSBA 2ARTA 1R8IA 2VKJA 2QYWA 2X68A 3QO8A 2V6YB 2EHOD 1KOGA 1HTTA 1WR0A 1NJ8A 1OEDE 1H4SA 3GWHA 2EJ9A 2I4OA 4XBFB 4JI4T 4YRSA 2JRKA 3X1DA 2ZXFA 4PHCA 4ISSA 5LJNA 2BBHA 3J7Yq 1NENA 2CMRA 2VB6A 4PNIA 2JQ9A 2PMFA 2BG9A 4AIUA 3KFWX 1ZKEA 2MAWA 4CH6A 3QNEA 1L0WA 4K0KT 1Z8UA 5ELOA 3M3ZB 1EFWA 1WYDA 2XTIA 4OYKA 4X1KE 4EX5A 3CMLA 2W66A 4EOZB 2ALYB 1EZ3A 4A97A 5ELNA 1LVFA 2QHVA 2XUEA 2XM1A 4RQEA 3ZC1A 4GIWA 1WLXA 4Z90A 5IHYA 4HWOA 1XNRT 4HWPA 3MZKB 4U2YA 4TZ4C 4IDNA 4QX7B 1QUUA 3FZKB 2D0UA 4ILUA 3VR9A 3TLTA 4LNSA 3PU3A 2ZTGA 3MF2A 5CA0E 1HR0T 2OLTA 3P4RA 5DQWA 2IHR1 1VRBA 1D1AA 5M4YA 1SE7A 2UXNB 2E5VA 2VVSA 2MTQA 1PYSB 4J15A 4LFAT 4H9RC 4KUMB 3N5LA 4O2BE 1B70B 3TUPA 4GYRA 3ONJA 3A7UA 2C5JA 3MA9A 4AKIA 3BFMA 4K0UA 3UUBA 4HN9A 5JDHA 4LF4T 2KLQA 1WR6A 3UH0A 2IAKA 4UP8A 3CX8B 2XQ8A 5AQKB 4TV9E 1J5WA 4DV7T 4ANJA 1UK5A 4HE8A 3AXJA 3OKQA 2W2UA 4U74A 5LYJE 4XEOA 1B76A 2CLYC 4TN7B 3VU7H 2L3LA 5HEUA 3ZN0B 3A7AA 4UF0B 3QC9A 5J1GA 4ZOLE 2IY5B 2PJQA 2XQ3A 5LA6E 3NETA 3RC8A 4PAGA 3AE2A 2W4XA 4YHHT 4XTWA 1D1BA 4XTZA 3FZMB 2E2AA 1JNRA 5FVLA 2DTHA 3I9YA 3RF1A 3LSSA 4I43B 4IDQA 3L3PA 2DZ9A 4YSXA 2WSSV 1BIAA 1W09A 2X67A 3AXJB 4ILCA 2WY2A 5DQVA 4JI7T 2YKSA 2Q9QB 3VKGA 3JADA 3VQVA 2X0YA 1WYCA 2XQ6A 3ZEFB 3TEHB 2Q7HA 3BQIA 1HXDA 5C3JA 4CS3A 4NUVA 2LSGA 2ZT7A 2P0LA 2W0GA 3AAAB 3UU6A 5ETWA 2ZT6A 3F31A 2BS4A 3K3OA 4UXNB 2ZINA 2E65A 3B5MA 1ZV4X 4X20E 4YRRA 2XSAA 1BR4A 4HT4A 3KV5A 1EIYA 5LP6E 3N9QA 2ZZFA 4JI8T 2V26A 3RX6A 3FXEB 2RHSB 1FJGT 3I7FA 4P75A 3J9X1 2N2NA 2C7IA 3ZSSA 3KBUA 2EHOB 3FZFB 2KWIB 4QH5A 3ETUA 4UVCB 3R07A 3WAKA 4KHZF 4A98A 3EHZA 5LBMA 4H2SA 4WI1A 3M65A 4HA8A 3ZJ1A 1YQ4A 3RIFA 4DMWA 3CVRA 4LF5T 3R84B 3KINB 5JDNA 3P8VA 4L5GA 3PCOB 3OPCA 3RQWA 5LMUT 4GOUA 4GK0E 2HN1A 4HFIA 4CI2B 4GK5E 4G84A 2I59A 1S35A 2Q9QC 2JQKA 4KX6A 2WM9A 4LFCT 3CX7B 2CM0A 1V9DA 2W63A 4BWAA 2E41A 2H88A 3A74A 5ABGA 3IALA 3LBXB 4X66T 4QWNB 4EB6E 1IBLT 3HXUA 3HI2A 2ODUA 3IEEA 3ZT7A 3MK7C 2HPLA 5LHGB 2E1HA 2K9AA 5J0ZA 4I50E 2XJ7A 1D1CA 2CPTA 5HWYA 3TLWA 5JDQA 3PCOA 4DR3T 3SWHA 3U78A 3HRIA 2IIUA 1KEYA 2DI4A 2HNIA 3AEAA 2CLYB 1QF6A 3E9IA 1UGOA 2NTXA 3P7IA 2WZIA 1NYRA 3ONXA 4F8HA 1N33T 3QOFA 1X2GA 4IE6A 2ZIMA 2X9HA 1EOVA 1JNZA 2Q5HA 4X5TA 1IBMT 1HF8A 2X9WA 4ZZBA 4OFZA 3RRWA 3DSQA 2ZM8A 1VQZA 2LM9A 1CUNA 4BJNA 3N2OA 3LBXA 2RHSA 2HN2A 2VASA 2Y8DA 3BQLA 5L3GB 1USYA 3OJAA 4QXBB 3PUSA 5HXHA 2V7JA 3PE0A 1C0AA 3ZLIA 4UVBB 4ZEYA 1M62A 2Q5IA 3GN5A 4WW0A 4LVKA 2ZMAA 1ZEEA 3T1HT 4AKLA 2WQYA 4EGWA 4TVAB 1G5HA 4H2XA 1T7SA 4YSZA 1NNHA 2HPJA 4NIQA 3EABA 1X2HA 3NENA 3NKZA 2BVLA 3PUXF 5JREA 4P3NA 1I94T 2Q9QA 4ZTZB 4M1PA 2WU2A 5LJMA 2XAGB 2XTLA 1L0VA 4B6XA 4B3ST 2NOXA 3C64A 4NXMT 5C8YE 2BS2A 2E3CA 5HEHA 4H2XB 3TEHA 3C4XA 1SA0E 3ERRA 2LSJA 2X0HA 4QHOA 4DPGA 2JMHA 3UULA 4DNDA 1B8AA 2EHOA 4CZZB 1QSDA 2ZZEA 4UPAA 3JCFA 5JRCA 4KR2A 3RI5A 2IY5A 4DV5T 4G2AA 4EXTA 2A2FX 5AQIB 5AQHB 3GMIA 2LRLA 2K48A 3AA7B 5HXCA 3MQZA 1OEDC 4CH5A 2BDEA 4U31A 5FXVA 2X66A 2I4MA 1OWAA 1YQ3A 2BG9C 4BW9A 3A5YA 3IF8B 2WMNA 5JRCB 3A7MA 3K3QC 5FNVE 1ZOYA 3NBXX 4HWCA 3AE3A 4YP0A 2KMFA 3SFEA 3CWZB 1AJ3A 3E08A 5A1LA 4XEMA 3AA6B 1YXRA 5E0OA 1XZYA 2W62A 3LJCA 3CKDA 3PJAA 5HAXA 1WCRA 4CXXA 3V8KA 1ASYA 2VK9A 4IDZA 1HTJF 3PDYA 3NRXA 3I9WA 4KBMB 4JEUB 4TVAA 1IL2A 1YB3A 4FI5A 3LK2B 2DDZA 1E1OA 4P3PA 1X9BA 2NWBA 2DEQA 1BBWA 2C5IT 3LK42 4AQYT 4ZI2D 2XQ4A 4O2DA 3DP7A 3H37A 1G8XA 3U3IA 4CI3B 5L3BB 4H9OC 2SPCA 2V7KA 1N36T 2MOZA 1J1JA 3UU5A 5KMGP 1KNZA 4DV1T 4IE4A 4L9IA 4O4JE 3KBTA 3TKLB 2I6HA 4H2VA 2XAJB 4X1YE 3JC6D 2FBWA 4TUYE 3W3SA 2D2SA 4AQFC 4KMCA 5KDMC 1X55A 4CN1A 4E7ZA 3UQ7A 3HKEE 4EEBA 3JAEA 3ZKRA 4DUYT 4MBQA 5JDLA 5H6QB 2H89A 3EVYA 5FXZA 5TAOA 4DBRA 1X54A 5LHIB 3P50A 1WQWA 3WI3A 4H2TA 2P5IA 3O9XA 2CXDA 4P1NA 4ZZCA 2I4LA 2WDQA 5C53B 3PUZF 3KFUA 1NJ6A 4EAHA 2LOPA 5AQNB 4TNWA 3FXDB 1ADJA 3ZMZB 4JUYA 2DLRA 3ANWB 4YRQA 2KSRA 1N9WA 3UUXB 2XAFB 3EFSA 2ZNJA 4LVLA 2CBJA 2WU5A 2I4NA 3E22E 5C52B 4PJNA 4CQIA 4NPPA 4IE5A 3PURA 5L4EA 1MIWA 3K3NA 1MIVA 1YW0A 2IDOB 3V7RA 4Q6GA 2K24A 3SFDA 2GK9A 2WDVA 2XQYA 4UELA 2F4VT 2BG9E 2M67A 4ASKA 3AEGA 4YT0A 5HWXA 3TLVA 1B7YA 3ZN1B 1XWMA 4WJ4A 4U7IA 2D9DA 3VRBA 2UUAT 4GKJT 1ZHCA 3PJAJ 2DTOA 3V5SA 3KV4A 2CRBA 3V7SA 1YKHB 4UP7A 2Q7GA 3AEBA 2J1DG 3Q5DA 4P71C 4JI2T 5FL1A 2CXLA 5JR9B 4KI0F 2Q9QD 3N2GE 2WDRA 2ES0A 2YDQA 4YSYA 4RDXA 1D0YA 3M4QA 3NELA 2DWKA 3ZT6A 4U7YA 4YRCA 3P8YA 4YTMA 3Q5WA 2OV9A 3RL6A 4PW8A 3KVBA 4EIWA 5KNNA 3L8RA 4Z91A 1E2AA 1PYSA 2WBLA 2CGHA 1N34T 4AISA 2E5LT 2ARSA 2HH7A 3RIAA 2LSIA 4AQGA 2JPFA 3RRCA 3C51A 1FEWA 4HWRA 3IKLA 4LVIA 2EJFA 5F8PA 3PTRB 2A8EA 3MF1A 3RIRA 1E24A 5AQVB 5F3JA 2ZT5A 3ZMSB 4CH4A 2QGSA 2MYSA 5ABFB 4CS4A 1HG5A 5KX5E 4YCUA 5L4HA 3ANWA 2DU7A 3A5XA 3WQZA 5JTGA 4IHJE 4ILAA 1W9RA 2H3RA 2E9XD 2PTFA 3UGTA 2QVAA 3H3AA 4DR7T 1N32T 2ZNIA 4FJOA 4DMVA 1E7PA 4K88A 3P4WA 4HWIB 2X51A 4P0BA 1S94A 4EEDA 4DR4T 4I0UA 3AA1B 4HFBA 4OYJA 3RYHE 3NRYA 4QH4A 4XZCA 4QXHB 2CBIA 2WP9A 1IJ5A 3HKDE 2BBJA 4ZHQE 2UXBT 1M7KA 3AE7A 4KP3C 4P72A 3RYFE 3EAMA 2P9BA 2E9XB 3AAEB 5EK2A 4EYYR 3TLSA 4ZI2C 4HFEA 3C4WA 2V1DB 1G5IA 5FMNA 3MEYA 3AVSA 1RIQA 4HFHA 3CMQA 4UVAB 4H2UA 3CQGB 2LE8A 4IE7A 2VL8A 4CXYA 3OD1A 2ZM2A 4TWFA 4PK6A 2XAHB 2VVNA 2XM2A 2KNDA 2JIWA 3UT5E 4JLEA 2RP4A 3RYCE 3A8YC 2W67A 1H4QA 4P75C 2OA5A 1H4TA 2XGTA 4DR5T 1WPYA 3ONLC 4ZI3D 4DV3T 4HFCA 5L2LA 1USYC 2FJAA 3ZJ2A 4QH1A 5AQLB 1SESA 2JQQA 4CH3A 3UUNA 2LKGA 4LF8T 3QO7A 5EK4A 2VL0A 1GGMA 5L3FB 1UUSA 4QXCB 3K8PC 4C91A 1HS7A 2IMLA 4XU1A 3RKOA 4CN4A 3V8JA 3REXA 5LB7B 3VR8A 4YRPA 3FZLB 5AQMB 3CQCB 5DJQC 5AQRB 3UFEA 3MJXA 1OEDA 2AKWB 3FZHB 3AE1A 4O4HE 3E9HA
chains in the Genus database with same CATH topology
1WNLA 1EQRA 3IG2A 4RQEA 2ALYA 3BJUA 2E64A 4HWOA 3MQZA 4CH5A 4HWPA 4YPFA 2I4MA 2DTIA 4BW9A 3A5YA 2CJBA 4TVYA 5HGQA 3VQWA 4P73A 3FJPA 4LNSA 4H2YA 4WJ3M 4TWAA 4XU2A 3HFVA 2ZTGA 3MF2A 4YP0A 2AKWA 4Q15A 2Q7EA 2ZCEA 3EFRA 4XEMA 2DU5A 1EVKA 3M4PA 4LVJA 1W66A 11ASA 1LYLA 2ZR3A 3PZCA 3V8KA 1PYSB 4J15A 1ASYA 3LSQA 4ZTUB 3L4GA 3V7CA 1YFRA 4KQEA 4TVAA 1B70B 3TUPA 4HVCA 4L87A 1IL2A 3L1AA 3HXXA 1YB3A 2J3LA 4H2WA 3A7UA 1WLEA 3BFMA 2DDZA 1E1OA 2EJGA 4P3PA 1SRYA 2DEQA 1BBWA 4O2DA 3UH0A 4UP8A 2ZT8A 1WQ7A 1J5WA 1SETA 3HRKA 4RMFA 4XTYA 4XEOA 1B76A 1E22A 5E3IA 12ASA 1BBUA 4YYEA 1G51A 1YFTA 4H2VA 3A7AA 2G4CA 4P73C 2AMCA 3W3SA 2EAYA 1X55A 4RQFA 4YRKA 2QHUA 3P8TA 2IY5B 3RUXA 3NETA 4TQFA 1NJ1A 4XTWA 3RKWA 1EIYB 1X54A 2QHSA 4XTZA 1WQWA 3HY1A 4H2TA 2P5IA 4ZIBA 2DTHA 4XTVA 2I4LA 3RF1A 5C53B 3LSSA 1NJ5A 3KFUA 2DZ9A 1NJ6A 4H02A 1B7YB 3L2ZA 1BIAA 1EVLA 2PMEA 4YRTA 1ADJA 3REUA 3VQVA 2CJAA 3V8LA 2DQ0A 4YRQA 4YRNA 1QE0A 1N9WA 1H4VB 4P72C 3EFSA 2ZNJA 4LVLA 2I4NA 4YROA 1ASZA 3TEHB 5C52B 2Q7HA 5K1XA 1HXDA 4CS3A 2RHQA 3A5ZA 1X01A 2ZT7A 2P0LA 3UGQA 3VQXA 2ZT6A 4TQDA 4YRFA 2DZCA 2ARUA 2ZINA 1JJCA 2E65A 3V7RA 4Q6GA 4YRMA 5F5WA 4YRRA 2ZR2A 2E10A 4HT4A 2NS6A 4HWSA 4P74A 3A7RA 1EIYA 4OLFA 3RKYA 2ZZFA 1B7YA 4WJ4A 2RHSB 3I7FA 1Z7NA 4P75A 3A32A 3RACA 2C7IA 2DTOA 4PG3A 3V7SA 1JJCB 1KMNA 2EWNA 4P74C 3R07A 4TVWA 4UP7A 2Q7GA 4P71C 3IKMB 4YRIA 4RDXA 1ADYA 2CIMA 3M4QA 3NELA 4H2SA 3A31A 4K87A 4WI1A 4HA8A 3HFZB 1NJ2A 4YRCA 4CS2A 3P8YA 4HWTA 2J3MA 4EO4A 2ZZGA 2QHTA 3RL6A 5KNNA 3P8VA 3PCOB 1KMMA 1PYSA 2DJZA 2CGHA 2ARSA 4YRJA 4LVMA 2C8MA 4G84A 4E51A 1NYQA 1FYFA 5C51B 4HWRA 4OP0A 4UP9A 3IKLA 4LVIA 2EJFA 2DXUA 1BIBA 3HXYA 2A8EA 3MF1A 3RIRA 4YREA 1E24A 2ZT5A 4BWAA 1X56A 2E41A 3A74A 4XU0A 4CH4A 3IALA 4CS4A 4YCUA 3HXUA 1HC7A 2DU7A 3HTZA 4AH6A 2E1HA 4P71A 3VQYA 3WQZA 4WF2A 3LC0A 3ICAA 3UGTA 4XU3A 2DXTA 3PCOA 4YRLA 4X5OA 4NCXA 3HXWA 2ZNIA 3HRIA 3RKXA 1WU7A 4YDQA 4XTXA 3L4GB 3VBBA 4K88A 3RGLA 2HNIA 1QF6A 3E9IA 3HXZA 3QTCA 3HFZA 2E5AA 1NYRA 3HY0A 2DVEA 1X2GA 2ODRC 2ZIMA 1EOVA 2Q5HA 4K86A 2EL9A 4YCVA 4G85A 4P72A 3TEGA 3UFGA 3DSQA 2CJ9A 1VQZA 4YRGA 2RHSA 2DQ3A 1USYA 1B70A 1G5IA 2AMCB 2ZIOA 3MEYA 1RIQA 4DQ2A 1ATIA 3G1ZA 3CMQA 4XTUA 5K1PA 4H2UA 4P3OA 1YFSA 1Z7MA 3OD1A 1C0AA 2Q5IA 3QO5A 3HXVA 4LVKA 2ARTA 2ZGWA 4TVAB 1G5HA 4H2XA 2FYKA 3QO8A 1E1TA 1H4QA 1KOGA 1NNHA 1HTTA 1H4SA 1NJ8A 4P75C 2EJ9A 1X2HA 1H4TA 2I4OA 1WPYA 2XGTA 3NENA 4TTVA 1USYC 4YRSA 2ZXFA 1SESA 4PHCA 4CH3A 4P3NA 4ZTZB 2ODRD 2RHQB 3QO7A 2PMFA 1GGMA 4KR3A 3TEHA 2E3CA 4H2XB 4CH6A 3QNEA 1L0WA 3ERRA 5ELOA 1EFWA 4XU1A 1WYDA 2DKGA 4DPGA 2XTIA 3V8JA 3REXA 4EX5A 1SERA 1B8AA 2ZZEA 4UPAA 4YRPA 2ALYB 1YGBA 4KR2A 2IY5A 4YCWA 3NEMA 2AKWB 5ELNA 2QHVA 3E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNL A;  1EQR A;  3IG2 A;  4RQE A;  2ALY A;  3BJU A;  2E64 A;  4HWO A;  4CH5 A;  4HWP A;  4YPF A;  2I4M A;  2DTI A;  4BW9 A;  3A5Y A;  2CJB A;  4TVY A;  5HGQ A;  3VQW A;  4P73 A;  3FJP A;  4LNS A;  4H2Y A;  4WJ3 M;  4TWA A;  4XU2 A;  3HFV A;  2ZTG A;  3MF2 A;  4YP0 A;  2AKW A;  4Q15 A;  2Q7E A;  2ZCE A;  3EFR A;  4XEM A;  2DU5 A;  1EVK A;  3M4P A;  1W66 A;  11AS A;  1LYL A;  2ZR3 A;  3PZC A;  3V8K A;  1PYS B;  4J15 A;  1ASY A;  3LSQ A;  4ZTU B;  3L4G A;  3V7C A;  1YFR A;  4KQE A;  4TVA A;  1B70 B;  3TUP A;  4HVC A;  4L87 A;  1IL2 A;  3L1A A;  3HXX A;  1YB3 A;  2J3L A;  4H2W A;  3A7U A;  1WLE A;  3BFM A;  2DDZ A;  1E1O A;  2EJG A;  4P3P A;  1SRY A;  2DEQ A;  1BBW A;  4O2D A;  3UH0 A;  4UP8 A;  2ZT8 A;  1WQ7 A;  1J5W A;  1SET A;  3HRK A;  4RMF A;  4XTY A;  4XEO A;  1B76 A;  1E22 A;  5E3I A;  12AS A;  1BBU A;  4YYE A;  1G51 A;  1YFT A;  4H2V A;  3A7A A;  2G4C A;  4P73 C;  2AMC A;  3W3S A;  2EAY A;  1X55 A;  4RQF A;  4YRK A;  2QHU A;  3P8T A;  2IY5 B;  3RUX A;  3NET A;  4TQF A;  1NJ1 A;  4XTW A;  3RKW A;  1EIY B;  1X54 A;  2QHS A;  4XTZ A;  1WQW A;  3HY1 A;  4H2T A;  2P5I A;  4ZIB A;  2DTH A;  4XTV A;  2I4L A;  3RF1 A;  5C53 B;  3LSS A;  1NJ5 A;  3KFU A;  2DZ9 A;  1NJ6 A;  4H02 A;  1B7Y B;  3L2Z A;  1BIA A;  1EVL A;  2PME A;  4YRT A;  1ADJ A;  3REU A;  3VQV A;  2CJA A;  3V8L A;  2DQ0 A;  4YRQ A;  4YRN A;  1QE0 A;  1N9W A;  1H4V B;  4P72 C;  3EFS A;  2ZNJ A;  2I4N A;  4YRO A;  1ASZ A;  3TEH B;  5C52 B;  2Q7H A;  5K1X A;  1HXD A;  4CS3 A;  2RHQ A;  3A5Z A;  1X01 A;  2ZT7 A;  2P0L A;  3UGQ A;  3VQX A;  2ZT6 A;  4TQD A;  4YRF A;  2DZC A;  2ARU A;  2ZIN A;  1JJC A;  2E65 A;  3V7R A;  4Q6G A;  4YRM A;  5F5W A;  4YRR A;  2ZR2 A;  2E10 A;  4HWS A;  4P74 A;  3A7R A;  1EIY A;  4OLF A;  3RKY A;  2ZZF A;  1B7Y A;  4WJ4 A;  2RHS B;  3I7F A;  1Z7N A;  4P75 A;  3A32 A;  3RAC A;  2C7I A;  2DTO A;  4PG3 A;  3V7S A;  1JJC B;  1KMN A;  2EWN A;  4P74 C;  3R07 A;  4TVW A;  4UP7 A;  2Q7G A;  4P71 C;  3IKM B;  4YRI A;  4RDX A;  1ADY A;  2CIM A;  3M4Q A;  3NEL A;  4H2S A;  3A31 A;  4K87 A;  4WI1 A;  4HA8 A;  3HFZ B;  1NJ2 A;  4YRC A;  4CS2 A;  3P8Y A;  4HWT A;  2J3M A;  4EO4 A;  2ZZG A;  2QHT A;  3RL6 A;  5KNN A;  3P8V A;  3PCO B;  1KMM A;  1PYS A;  2DJZ A;  2CGH A;  2ARS A;  4YRJ A;  2C8M A;  4G84 A;  4E51 A;  1NYQ A;  1FYF A;  5C51 B;  4HWR A;  4OP0 A;  4UP9 A;  3IKL A;  2EJF A;  2DXU A;  1BIB A;  3HXY A;  3MF1 A;  3RIR A;  4YRE A;  1E24 A;  2ZT5 A;  4BWA A;  1X56 A;  2E41 A;  3A74 A;  4XU0 A;  4CH4 A;  3IAL A;  4CS4 A;  4YCU A;  3HXU A;  1HC7 A;  2DU7 A;  3HTZ A;  4AH6 A;  2E1H A;  4P71 A;  3VQY A;  3WQZ A;  4WF2 A;  3LC0 A;  3ICA A;  3UGT A;  4XU3 A;  2DXT A;  3PCO A;  4YRL A;  4X5O A;  4NCX A;  3HXW A;  2ZNI A;  3HRI A;  3RKX A;  1WU7 A;  4YDQ A;  4XTX A;  3L4G B;  3VBB A;  4K88 A;  3RGL A;  2HNI A;  1QF6 A;  3E9I A;  3HXZ A;  3QTC A;  3HFZ A;  2E5A A;  1NYR A;  3HY0 A;  2DVE A;  1X2G A;  2ODR C;  2ZIM A;  1EOV A;  2Q5H A;  4K86 A;  2EL9 A;  4YCV A;  4G85 A;  4P72 A;  3TEG A;  3UFG A;  3DSQ A;  2CJ9 A;  1VQZ A;  4YRG A;  2RHS A;  2DQ3 A;  1USY A;  1B70 A;  1G5I A;  2AMC B;  2ZIO A;  3MEY A;  1RIQ A;  4DQ2 A;  1ATI A;  3G1Z A;  3CMQ A;  4XTU A;  5K1P A;  4H2U A;  4P3O A;  1YFS A;  1Z7M A;  3OD1 A;  1C0A A;  2Q5I A;  3QO5 A;  3HXV A;  2ART A;  2ZGW A;  4TVA B;  1G5H A;  4H2X A;  2FYK A;  3QO8 A;  1E1T A;  1H4Q A;  1KOG A;  1NNH A;  1HTT A;  1H4S A;  1NJ8 A;  4P75 C;  2EJ9 A;  1X2H A;  1H4T A;  2I4O A;  1WPY A;  2XGT A;  3NEN A;  4TTV A;  1USY C;  4YRS A;  2ZXF A;  1SES A;  4PHC A;  4CH3 A;  4P3N A;  4ZTZ B;  2ODR D;  2RHQ B;  3QO7 A;  2PMF A;  1GGM A;  4KR3 A;  3TEH A;  2E3C A;  4H2X B;  4CH6 A;  3QNE A;  1L0W A;  3ERR A;  5ELO A;  1EFW A;  4XU1 A;  1WYD A;  2DKG A;  4DPG A;  2XTI A;  3V8J A;  3REX A;  4EX5 A;  1SER A;  1B8A A;  2ZZE A;  4UPA A;  4YRP A;  2ALY B;  1YGB A;  4KR2 A;  2IY5 A;  4YCW A;  3NEM A;  2AKW B;  5ELN A;  2QHV A;  3E9H A; 
#chains in the Genus database with same CATH topology
 3IG2 A;  2ALY A;  3MAC A;  3BJU A;  2WCA A;  4U72 A;  4JV5 T;  4MAL A;  3AE6 A;  4JI6 T;  2XQ9 A;  1LKX A;  2KZ7 B;  1VCS A;  2CJB A;  4TVY A;  5HGQ A;  4PJL A;  4WJ3 M;  1D0X A;  3FJP A;  2WZH A;  2VKD A;  4XU2 A;  3HFV A;  3W15 B;  3Q5E A;  4ZI7 E;  3AB3 B;  1OED B;  2AKW A;  2KXP B;  2BKN A;  2ZCE A;  3EFR A;  5LXT E;  1EVK A;  3NWI A;  4GKK T;  2BZB A;  2UXC T;  2ZR3 A;  2DL1 A;  3UU4 A;  1SUM B;  2VKO A;  1YFR A;  3SRZ A;  4O4L E;  2X0L B;  4KQE A;  5HCM A;  3CPZ A;  4L87 A;  3ABV A;  3C4Z A;  3L1A A;  1W0A A;  3HXX A;  3O4X E;  3Q9D A;  4JI0 T;  5AQO B;  4B3T T;  1ZP0 A;  3LG7 A;  1FMV A;  2KWH A;  1SRY A;  3AEE A;  1CHU A;  2UUB T;  3D0T A;  3HL6 A;  5L3C B;  1WQ7 A;  2VKH A;  1SET A;  2ZM6 T;  4RMF A;  4XTY A;  4IST A;  3F57 A;  3I0O A;  5C2T A;  2FUP A;  4LML A;  4N78 D;  4UF0 A;  4LF9 T;  12AS A;  4LF6 T;  1BBU A;  4YYE A;  2ODV A;  2G0U A;  5EZY E;  4BA9 A;  1YFT A;  4EYU A;  3ZST A;  2L9Q A;  4U3C A;  4NUU A;  2WAU A;  4CN6 A;  4MHC A;  2EAY A;  1LRZ A;  3O1H A;  4YRK A;  3RUX A;  4OHF A;  3OYX A;  4EZ4 A;  3N9P A;  1NJ1 A;  2Z6E A;  3PUV F;  2JQH A;  2KIN B;  4IIJ E;  2QHS A;  2E9X A;  4CXW A;  5LGT B;  4PFO A;  3RLF F;  3ZMT B;  3HY1 A;  2C5K T;  4ZIB A;  1NJ5 A;  1X79 A;  3FBL A;  4DBQ A;  3O1J A;  4H02 A;  3ZMU B;  1B7Y B;  3L2Z A;  3AE8 A;  4YRT A;  4DUZ T;  2YDR A;  2WWU A;  2V8S V;  1WRD A;  3N9N A;  5BMV E;  3VKH A;  2R6G F;  4YRN A;  1QE0 A;  1H4V B;  5HEO A;  4YRO A;  5ABE A;  4H63 H;  5K1X A;  2CXF A;  3BK9 A;  1HX1 B;  4COF A;  2LOS A;  3ZCI A;  5CJ5 A;  2IUB A;  2A72 A;  2PBI A;  5H6R B;  2RHQ A;  1X01 A;  2CE7 A;  2CEA A;  4YJ2 E;  3UGQ A;  1T72 A;  3ZYK A;  3R6N A;  5L3D B;  1VOM A;  4TQD A;  4YRF A;  4X64 T;  2DZC A;  5CFB A;  5L47 A;  1SHZ C;  1JJC A;  3VRA A;  1I6Z A;  4YRM A;  3AEF A;  5AQS B;  2ZR2 A;  3SS1 A;  2NS6 A;  4HWS A;  4P74 A;  4OLF A;  2YN6 A;  5LG3 A;  2YOE A;  2CCQ A;  2NP9 A;  2LT3 A;  2BG9 B;  3RHW A;  4EV6 A;  3A32 A;  3ZC0 A;  1GQE A;  4P0A A;  2RA1 A;  1JJC B;  1LVK A;  5ABF A;  3UU8 A;  3PV0 F;  3LFM A;  1MNE A;  3LSV A;  1T8B A;  4YRI A;  4YHJ A;  2ACX A;  5AFU L;  3RPU A;  2YDS A;  2CHO A;  1Z0P A;  1ADY A;  5GON E;  1MMG A;  4K87 A;  1Y64 B;  2V7M A;  4U2Z A;  3HFZ B;  4NXN T;  4OX9 T;  1NJ2 A;  4CS2 A;  2J3M A;  4JI5 T;  2LM2 A;  4EO4 A;  2QHT A;  2NW8 A;  3FHN A;  3RQU A;  4X65 T;  2NR4 A;  2IC6 A;  4PJM A;  2UU9 T;  4A5X A;  2DJZ A;  3FB2 A;  3N9O A;  1IAP A;  2XQ5 A;  2AE9 A;  5LGN B;  3O1I A;  2VWA A;  4YRJ A;  3OTO T;  4LVM A;  3EDU A;  2C8M A;  4E51 A;  3ESL A;  3Q2M A;  3CX6 B;  4OP0 A;  2X9Y A;  4UP9 A;  4AKR B;  2DXU A;  3HXY A;  2UUC T;  3CQX C;  5AQG B;  4YRE A;  2LEH A;  2CWY A;  5JR9 A;  4KHP T;  1X56 A;  5FXW A;  3C98 B;  5HXE A;  3UTK A;  4XU0 A;  3IBP A;  1BR2 A;  1HC7 A;  1D0Z A;  3E0Z A;  3RH3 A;  4F6R C;  4DID B;  3IHR A;  5FY1 A;  4PK5 A;  3VQY A;  3PUY F;  2M6B A;  1BR0 A;  3MXZ A;  3P4S A;  3LC0 A;  1E1H B;  3ICA A;  4Z8X A;  3RIU A;  2DXT A;  4YRL A;  1MMN A;  2E9X C;  3CIR A;  2NW7 A;  3RKX A;  2B76 A;  4P09 A;  1WU7 A;  3N2K E;  4YDQ A;  2PG8 A;  3L4G B;  3VBB A;  3PUW F;  3RGL A;  1O3X A;  4HFV A;  2J62 A;  3HXZ A;  3I0Q A;  1YD8 G;  3HFZ A;  1US7 B;  3NVO A;  1WYB A;  2E5A A;  3KV9 A;  4H9Q C;  4IGU A;  2XPK A;  3AA0 B;  5HYA A;  4XAX B;  5LOV E;  3PU8 A;  4X1I E;  2CWO A;  3ZYM A;  1XNQ T;  3T1Y T;  4K86 A;  5LHH B;  4I55 E;  2V6X A;  4G85 A;  3TEG A;  4YXD A;  3UFG A;  1DU2 A;  4U33 A;  4YRG A;  4IRE A;  3UU3 A;  2LJL A;  2QA7 A;  4IT4 A;  2DQ3 A;  1XDP A;  4AKG A;  1B70 A;  2AMC B;  4AI6 A;  2ZIO A;  4OK0 A;  1ATI A;  5JDG A;  2LLY A;  5J2U E;  4P3O A;  1YFS A;  5HXR A;  5IYZ E;  2MBG A;  5FY7 A;  3NZP A;  4TWD A;  1HNX T;  2K5B B;  5JDM A;  2V7I A;  2ZGW A;  1HNZ T;  2FYK A;  1E1T A;  2ZM0 A;  4UV8 B;  4DR1 T;  3PUG A;  1MIY A;  3QNU A;  4TTV A;  5JR9 C;  2W00 A;  4ZI3 C;  1FMW A;  4B3M T;  2HHH T;  5FL0 A;  2ODR D;  2L8K A;  2RHQ B;  1U4Q A;  3P4P A;  3EDV A;  4KR3 A;  3QUJ A;  1KNR A;  2LKH A;  2J4G A;  2YEV C;  3L09 A;  3AEC A;  3GA8 A;  4HFD A;  2UXX B;  1HX8 A;  4LFB T;  3HKB E;  5L3E B;  2LHR A;  4ILB A;  3S4U A;  2DKG A;  3ZPO A;  5JDF A;  3DJB A;  5FVK A;  2IW5 B;  1SER A;  4HKA A;  2M6I A;  2X9X A;  1YGB A;  2YU2 A;  3H3M A;  4GYS A;  4YCW A;  3NEM A;  5HCJ A;  2VQE T;  1WNL A;  1EQR A;  3MKD A;  4YTP A;  1NAF A;  3AAI A;  3AE4 A;  2E64 A;  2WS3 A;  2ZLY A;  4QKN A;  2NW9 A;  4YPF A;  4WBN E;  2DTI A;  3HA4 A;  4LF7 T;  2BKO A;  5J2T E;  4Q25 A;  4AKH A;  2JJ9 A;  2Y6X A;  2E8I A;  1MMD A;  3VQW A;  5LGU B;  4P73 A;  4H2Y A;  4ADZ A;  4TWA A;  2WB5 A;  1UCU A;  1XDO A;  1UUR A;  2ACZ A;  3ZT5 A;  1HNW T;  4JEH B;  4Q15 A;  2Q7E A;  1W0B A;  2DU5 A;  3F2E A;  3M4P A;  4LVJ A;  1KF6 A;  4AXP A;  3EI0 A;  4JI1 T;  2FJE A;  1W66 A;  4J2C A;  3ZYL A;  4C90 A;  2VQF T;  2XAQ B;  11AS A;  3OVU A;  1LYL A;  2XY8 B;  3PZC A;  3LSQ A;  4ZTU B;  2DWG A;  4PK4 A;  5JVD E;  3L4G A;  3V7C A;  5EK3 A;  2V5C A;  2LSY A;  5CB4 E;  4HWF A;  4HVC A;  4DR2 T;  2YU1 A;  4AQF A;  2J3L A;  4H2W A;  2YK0 A;  5FKY A;  2IC9 A;  1WLE A;  2A3D A;  3JAF A;  2BS3 A;  2EJG A;  3KV6 A;  3P8C D;  5AQJ B;  4BJM A;  2RPA A;  3ZMV B;  5CGM A;  1J5E T;  2ZT8 A;  5LG4 A;  3HRK A;  4A56 A;  3AVR A;  2B1E A;  5FP3 A;  4DR6 T;  4H9N C;  4PFP A;  4DVD A;  1E22 A;  1NEK A;  2DHR A;  5LMN T;  3RC3 A;  5E3I A;  5FY0 A;  4JYA T;  1G51 A;  5LNK A;  3HR0 A;  2K3W A;  4WYV A;  5FYM A;  2G4C A;  4P73 C;  2BKP A;  2AMC A;  4RQF A;  1KK7 A;  4X62 T;  1IZN B;  2QHU A;  3P8T A;  2WMO A;  3K1S A;  5AQU B;  4TQF A;  1UX4 A;  4DV4 T;  2V7L A;  3PUQ A;  3RKW A;  1EIY B;  4JI3 T;  1XMO T;  3V5U A;  1IBK T;  4YFS A;  4IL4 A;  4H9S E;  2DNX A;  4QX8 B;  5LCY A;  5HXS A;  5AQT B;  4WZX A;  2N9D A;  4XTV A;  3UQ4 A;  4BAY B;  1NWM X;  4LMK A;  3T8O A;  2XQA A;  1EVL A;  2PME A;  3DTO A;  4YTN A;  2CHN A;  3REU A;  4E7S A;  2CJA A;  3V8L A;  2DQ0 A;  4P72 C;  1HCI A;  4WNK A;  3NZQ A;  1ASZ A;  1B7T A;  3IA3 A;  3CK6 A;  5ABH A;  2UXD T;  1H7C A;  1T98 A;  2FJD A;  4HWH A;  4B3R T;  3A5Z A;  2BVM A;  2LHN A;  3SOL A;  3VQX A;  5HEJ A;  3AED A;  2ARU A;  5IWA T;  5F5W A;  1YKE B;  4H9P C;  2QRX A;  4H63 V;  2EHO C;  2E10 A;  4V1A v;  3PUA A;  3A7R A;  3OYZ A;  3QB5 A;  3RKY A;  4ERR A;  3QK6 A;  4ZS3 A;  1Z7N A;  1HFA A;  1UX5 A;  3RAC A;  2FJB A;  4PJJ A;  4PG3 A;  2KT9 A;  2XAS B;  4UR9 A;  1VCT A;  1KMN A;  5HEG A;  2EWN A;  4P74 C;  2D0T A;  1IJ6 A;  3G06 A;  4TVW A;  1FIO A;  2A9U A;  3N9M A;  3IKM B;  3P4Q A;  4IE0 A;  3QB5 K;  4O4I E;  2CA5 A;  5BR8 T;  2CIM A;  4HTE A;  5JH7 E;  2VUR A;  2I0M A;  3A31 A;  4JBW F;  4HWT A;  2ZZG A;  1G73 A;  5DAB A;  3OBV E;  5AQF B;  4O2A E;  1KMM A;  3UUM A;  5FXX A;  1NYQ A;  1FYF A;  4UV9 B;  5C51 B;  1BIB A;  1KFY A;  2XZE A;  5IUX A;  2D5U A;  5CA1 E;  4CI1 B;  3JC6 C;  3GN5 B;  4HWD A;  4YJ3 E;  3KDS E;  3HTZ A;  2LRK A;  4AH6 A;  3RIU C;  4G63 A;  3TLU A;  4P71 A;  2J47 A;  4WF2 A;  1U5P A;  3FBZ A;  4EZH A;  2Y48 B;  3LK3 B;  2WWV A;  4DV2 T;  4DV6 T;  3RKG A;  4XU3 A;  4DV0 T;  3AE5 A;  5LBQ B;  4X5O A;  5AQP B;  4NCX A;  3HXW A;  3RYI E;  4XTX A;  4TNV A;  4YLH A;  2N1G A;  2XQ7 A;  3BQK A;  3N9L A;  5ADX L;  3QTC A;  3Q5X A;  4TWH A;  4ZXL A;  1OXZ A;  1KNP A;  1MMA A;  3HY0 A;  4ZS2 A;  2V5D A;  3C50 A;  5KXJ A;  2AXD S;  2DVE A;  2DCF A;  3ZCJ A;  4HGA A;  2W61 A;  4WBO A;  2ODR C;  4O8S A;  4HEA A;  4L0R A;  2EL9 A;  4TX5 A;  3VHL A;  3HKC E;  3LDQ B;  4IDO A;  2C0S A;  2PFV A;  4YCV A;  2YIN A;  2NTY A;  1Y01 A;  4UEM A;  3EUH A;  4I4T E;  1MND A;  2CJ9 A;  4UIG A;  3ETV A;  3WAJ A;  2JMK A;  3AE9 A;  3I1A A;  2H7O A;  1HG2 A;  4IDP A;  4DO0 A;  4MFR A;  5AQQ B;  1QLB A;  4DQ2 A;  3G1Z A;  4MLK A;  4YY3 T;  4XTU A;  5K1P A;  2H7V C;  1Z7M A;  2XHE B;  1WFD A;  1BR1 A;  3B13 A;  4TV8 E;  2V6Y A;  3B57 A;  2MPK A;  4IL9 A;  1XMQ T;  3KVA A;  3HXV A;  4LMJ A;  3QO5 A;  5JQG E;  2LSK A;  3L39 A;  2XSB A;  2ART A;  1R8I A;  2VKJ A;  2QYW A;  2X68 A;  3QO8 A;  2V6Y B;  2EHO D;  1KOG A;  1HTT A;  1WR0 A;  1NJ8 A;  1OED E;  1H4S A;  3GWH A;  2EJ9 A;  2I4O A;  4XBF B;  4JI4 T;  4YRS A;  2JRK A;  3X1D A;  2ZXF A;  4PHC A;  4ISS A;  5LJN A;  2BBH A;  3J7Y q;  1NEN A;  2CMR A;  2VB6 A;  4PNI A;  2JQ9 A;  2PMF A;  2BG9 A;  4AIU A;  3KFW X;  1ZKE A;  2MAW A;  4CH6 A;  3QNE A;  1L0W A;  4K0K T;  1Z8U A;  5ELO A;  3M3Z B;  1EFW A;  1WYD A;  2XTI A;  4OYK A;  4X1K E;  4EX5 A;  3CML A;  2W66 A;  4EOZ B;  2ALY B;  1EZ3 A;  4A97 A;  5ELN A;  1LVF A;  2QHV A;  2XUE A;  2XM1 A;  4RQE A;  3ZC1 A;  4GIW A;  1WLX A;  4Z90 A;  5IHY A;  4HWO A;  1XNR T;  4HWP A;  3MZK B;  4U2Y A;  4TZ4 C;  4IDN A;  4QX7 B;  1QUU A;  3FZK B;  2D0U A;  4ILU A;  3VR9 A;  3TLT A;  4LNS A;  3PU3 A;  2ZTG A;  3MF2 A;  5CA0 E;  1HR0 T;  2OLT A;  3P4R A;  5DQW A;  2IHR 1;  1VRB A;  1D1A A;  5M4Y A;  1SE7 A;  2UXN B;  2E5V A;  2VVS A;  2MTQ A;  1PYS B;  4J15 A;  4LFA T;  4H9R C;  4KUM B;  3N5L A;  4O2B E;  1B70 B;  3TUP A;  4GYR A;  3ONJ A;  3A7U A;  2C5J A;  3MA9 A;  4AKI A;  3BFM A;  4K0U A;  3UUB A;  4HN9 A;  5JDH A;  4LF4 T;  2KLQ A;  1WR6 A;  3UH0 A;  2IAK A;  4UP8 A;  3CX8 B;  2XQ8 A;  5AQK B;  4TV9 E;  1J5W A;  4DV7 T;  4ANJ A;  1UK5 A;  4HE8 A;  3AXJ A;  3OKQ A;  2W2U A;  4U74 A;  5LYJ E;  4XEO A;  1B76 A;  2CLY C;  4TN7 B;  3VU7 H;  2L3L A;  5HEU A;  3ZN0 B;  3A7A A;  4UF0 B;  3QC9 A;  5J1G A;  4ZOL E;  2IY5 B;  2PJQ A;  2XQ3 A;  5LA6 E;  3NET A;  3RC8 A;  4PAG A;  3AE2 A;  2W4X A;  4YHH T;  4XTW A;  1D1B A;  4XTZ A;  3FZM B;  2E2A A;  1JNR A;  5FVL A;  2DTH A;  3I9Y A;  3RF1 A;  3LSS A;  4I43 B;  4IDQ A;  3L3P A;  2DZ9 A;  4YSX A;  2WSS V;  1BIA A;  1W09 A;  2X67 A;  3AXJ B;  4ILC A;  2WY2 A;  5DQV A;  4JI7 T;  2YKS A;  2Q9Q B;  3VKG A;  3JAD A;  3VQV A;  2X0Y A;  1WYC A;  2XQ6 A;  3ZEF B;  3TEH B;  2Q7H A;  3BQI A;  1HXD A;  5C3J A;  4CS3 A;  4NUV A;  2LSG A;  2ZT7 A;  2P0L A;  2W0G A;  3AAA B;  3UU6 A;  5ETW A;  2ZT6 A;  3F31 A;  2BS4 A;  3K3O A;  4UXN B;  2ZIN A;  2E65 A;  3B5M A;  1ZV4 X;  4X20 E;  4YRR A;  2XSA A;  1BR4 A;  4HT4 A;  3KV5 A;  1EIY A;  5LP6 E;  3N9Q A;  2ZZF A;  4JI8 T;  2V26 A;  3RX6 A;  3FXE B;  2RHS B;  1FJG T;  3I7F A;  4P75 A;  3J9X 1;  2N2N A;  2C7I A;  3ZSS A;  3KBU A;  2EHO B;  3FZF B;  2KWI B;  4QH5 A;  3ETU A;  4UVC B;  3R07 A;  3WAK A;  4KHZ F;  4A98 A;  3EHZ A;  5LBM A;  4H2S A;  4WI1 A;  3M65 A;  4HA8 A;  3ZJ1 A;  1YQ4 A;  3RIF A;  4DMW A;  3CVR A;  4LF5 T;  3R84 B;  3KIN B;  5JDN A;  3P8V A;  4L5G A;  3PCO B;  3OPC A;  3RQW A;  5LMU T;  4GOU A;  4GK0 E;  2HN1 A;  4HFI A;  4CI2 B;  4GK5 E;  4G84 A;  2I59 A;  1S35 A;  2Q9Q C;  2JQK A;  4KX6 A;  2WM9 A;  4LFC T;  3CX7 B;  2CM0 A;  1V9D A;  2W63 A;  4BWA A;  2E41 A;  2H88 A;  3A74 A;  5ABG A;  3IAL A;  3LBX B;  4X66 T;  4QWN B;  4EB6 E;  1IBL T;  3HXU A;  3HI2 A;  2ODU A;  3IEE A;  3ZT7 A;  3MK7 C;  2HPL A;  5LHG B;  2E1H A;  2K9A A;  5J0Z A;  4I50 E;  2XJ7 A;  1D1C A;  2CPT A;  5HWY A;  3TLW A;  5JDQ A;  3PCO A;  4DR3 T;  3SWH A;  3U78 A;  3HRI A;  2IIU A;  1KEY A;  2DI4 A;  2HNI A;  3AEA A;  2CLY B;  1QF6 A;  3E9I A;  1UGO A;  2NTX A;  3P7I A;  2WZI A;  1NYR A;  3ONX A;  4F8H A;  1N33 T;  3QOF A;  1X2G A;  4IE6 A;  2ZIM A;  2X9H A;  1EOV A;  1JNZ A;  2Q5H A;  4X5T A;  1IBM T;  1HF8 A;  2X9W A;  4ZZB A;  4OFZ A;  3RRW A;  3DSQ A;  2ZM8 A;  1VQZ A;  2LM9 A;  1CUN A;  4BJN A;  3N2O A;  3LBX A;  2RHS A;  2HN2 A;  2VAS A;  2Y8D A;  3BQL A;  5L3G B;  1USY A;  3OJA A;  4QXB B;  3PUS A;  5HXH A;  2V7J A;  3PE0 A;  1C0A A;  3ZLI A;  4UVB B;  4ZEY A;  1M62 A;  2Q5I A;  3GN5 A;  4WW0 A;  4LVK A;  2ZMA A;  1ZEE A;  3T1H T;  4AKL A;  2WQY A;  4EGW A;  4TVA B;  1G5H A;  4H2X A;  1T7S A;  4YSZ A;  1NNH A;  2HPJ A;  4NIQ A;  3EAB A;  1X2H A;  3NEN A;  3NKZ A;  2BVL A;  3PUX F;  5JRE A;  4P3N A;  1I94 T;  2Q9Q A;  4ZTZ B;  4M1P A;  2WU2 A;  5LJM A;  2XAG B;  2XTL A;  1L0V A;  4B6X A;  4B3S T;  2NOX A;  3C64 A;  4NXM T;  5C8Y E;  2BS2 A;  2E3C A;  5HEH A;  4H2X B;  3TEH A;  3C4X A;  1SA0 E;  3ERR A;  2LSJ A;  2X0H A;  4QHO A;  4DPG A;  2JMH A;  3UUL A;  4DND A;  1B8A A;  2EHO A;  4CZZ B;  1QSD A;  2ZZE A;  4UPA A;  3JCF A;  5JRC A;  4KR2 A;  3RI5 A;  2IY5 A;  4DV5 T;  4G2A A;  4EXT A;  2A2F X;  5AQI B;  5AQH B;  3GMI A;  2LRL A;  2K48 A;  3AA7 B;  5HXC A;  3MQZ A;  1OED C;  4CH5 A;  2BDE A;  4U31 A;  5FXV A;  2X66 A;  2I4M A;  1OWA A;  1YQ3 A;  2BG9 C;  4BW9 A;  3A5Y A;  3IF8 B;  2WMN A;  5JRC B;  3A7M A;  3K3Q C;  5FNV E;  1ZOY A;  3NBX X;  4HWC A;  3AE3 A;  4YP0 A;  2KMF A;  3SFE A;  3CWZ B;  1AJ3 A;  3E08 A;  5A1L A;  4XEM A;  3AA6 B;  1YXR A;  5E0O A;  1XZY A;  2W62 A;  3LJC A;  3CKD A;  3PJA A;  5HAX A;  1WCR A;  4CXX A;  3V8K A;  1ASY A;  2VK9 A;  4IDZ A;  1HTJ F;  3PDY A;  3NRX A;  3I9W A;  4KBM B;  4JEU B;  4TVA A;  1IL2 A;  1YB3 A;  4FI5 A;  3LK2 B;  2DDZ A;  1E1O A;  4P3P A;  1X9B A;  2NWB A;  2DEQ A;  1BBW A;  2C5I T;  3LK4 2;  4AQY T;  4ZI2 D;  2XQ4 A;  4O2D A;  3DP7 A;  3H37 A;  1G8X A;  3U3I A;  4CI3 B;  5L3B B;  4H9O C;  2SPC A;  2V7K A;  1N36 T;  2MOZ A;  1J1J A;  3UU5 A;  5KMG P;  1KNZ A;  4DV1 T;  4IE4 A;  4L9I A;  4O4J E;  3KBT A;  3TKL B;  2I6H A;  4H2V A;  2XAJ B;  4X1Y E;  3JC6 D;  2FBW A;  4TUY E;  3W3S A;  2D2S A;  4AQF C;  4KMC A;  5KDM C;  1X55 A;  4CN1 A;  4E7Z A;  3UQ7 A;  3HKE E;  4EEB A;  3JAE A;  3ZKR A;  4DUY T;  4MBQ A;  5JDL A;  5H6Q B;  2H89 A;  3EVY A;  5FXZ A;  5TAO A;  4DBR A;  1X54 A;  5LHI B;  3P50 A;  1WQW A;  3WI3 A;  4H2T A;  2P5I A;  3O9X A;  2CXD A;  4P1N A;  4ZZC A;  2I4L A;  2WDQ A;  5C53 B;  3PUZ F;  3KFU A;  1NJ6 A;  4EAH A;  2LOP A;  5AQN B;  4TNW A;  3FXD B;  1ADJ A;  3ZMZ B;  4JUY A;  2DLR A;  3ANW B;  4YRQ A;  2KSR A;  1N9W A;  3UUX B;  2XAF B;  3EFS A;  2ZNJ A;  4LVL A;  2CBJ A;  2WU5 A;  2I4N A;  3E22 E;  5C52 B;  4PJN A;  4CQI A;  4NPP A;  4IE5 A;  3PUR A;  5L4E A;  1MIW A;  3K3N A;  1MIV A;  1YW0 A;  2IDO B;  3V7R A;  4Q6G A;  2K24 A;  3SFD A;  2GK9 A;  2WDV A;  2XQY A;  4UEL A;  2F4V T;  2BG9 E;  2M67 A;  4ASK A;  3AEG A;  4YT0 A;  5HWX A;  3TLV A;  1B7Y A;  3ZN1 B;  1XWM A;  4WJ4 A;  4U7I A;  2D9D A;  3VRB A;  2UUA T;  4GKJ T;  1ZHC A;  3PJA J;  2DTO A;  3V5S A;  3KV4 A;  2CRB A;  3V7S A;  1YKH B;  4UP7 A;  2Q7G A;  3AEB A;  2J1D G;  3Q5D A;  4P71 C;  4JI2 T;  5FL1 A;  2CXL A;  5JR9 B;  4KI0 F;  2Q9Q D;  3N2G E;  2WDR A;  2ES0 A;  2YDQ A;  4YSY A;  4RDX A;  1D0Y A;  3M4Q A;  3NEL A;  2DWK A;  3ZT6 A;  4U7Y A;  4YRC A;  3P8Y A;  4YTM A;  3Q5W A;  2OV9 A;  3RL6 A;  4PW8 A;  3KVB A;  4EIW A;  5KNN A;  3L8R A;  4Z91 A;  1E2A A;  1PYS A;  2WBL A;  2CGH A;  1N34 T;  4AIS A;  2E5L T;  2ARS A;  2HH7 A;  3RIA A;  2LSI A;  4AQG A;  2JPF A;  3RRC A;  3C51 A;  1FEW A;  4HWR A;  3IKL A;  4LVI A;  2EJF A;  5F8P A;  3PTR B;  2A8E A;  3MF1 A;  3RIR A;  1E24 A;  5AQV B;  5F3J A;  2ZT5 A;  3ZMS B;  4CH4 A;  2QGS A;  2MYS A;  5ABF B;  4CS4 A;  1HG5 A;  5KX5 E;  4YCU A;  5L4H A;  3ANW A;  2DU7 A;  3A5X A;  3WQZ A;  5JTG A;  4IHJ E;  4ILA A;  1W9R A;  2H3R A;  2E9X D;  2PTF A;  3UGT A;  2QVA A;  3H3A A;  4DR7 T;  1N32 T;  2ZNI A;  4FJO A;  4DMV A;  1E7P A;  4K88 A;  3P4W A;  4HWI B;  2X51 A;  4P0B A;  1S94 A;  4EED A;  4DR4 T;  4I0U A;  3AA1 B;  4HFB A;  4OYJ A;  3RYH E;  3NRY A;  4QH4 A;  4XZC A;  4QXH B;  2CBI A;  2WP9 A;  1IJ5 A;  3HKD E;  2BBJ A;  4ZHQ E;  2UXB T;  1M7K A;  3AE7 A;  4KP3 C;  4P72 A;  3RYF E;  3EAM A;  2P9B A;  2E9X B;  3AAE B;  5EK2 A;  4EYY R;  3TLS A;  4ZI2 C;  4HFE A;  3C4W A;  2V1D B;  1G5I A;  5FMN A;  3MEY A;  3AVS A;  1RIQ A;  4HFH A;  3CMQ A;  4UVA B;  4H2U A;  3CQG B;  2LE8 A;  4IE7 A;  2VL8 A;  4CXY A;  3OD1 A;  2ZM2 A;  4TWF A;  4PK6 A;  2XAH B;  2VVN A;  2XM2 A;  2KND A;  2JIW A;  3UT5 E;  4JLE A;  2RP4 A;  3RYC E;  3A8Y C;  2W67 A;  1H4Q A;  4P75 C;  2OA5 A;  1H4T A;  2XGT A;  4DR5 T;  1WPY A;  3ONL C;  4ZI3 D;  4DV3 T;  4HFC A;  5L2L A;  1USY C;  2FJA A;  3ZJ2 A;  4QH1 A;  5AQL B;  1SES A;  2JQQ A;  4CH3 A;  3UUN A;  2LKG A;  4LF8 T;  3QO7 A;  5EK4 A;  2VL0 A;  1GGM A;  5L3F B;  1UUS A;  4QXC B;  3K8P C;  4C91 A;  1HS7 A;  2IML A;  4XU1 A;  3RKO A;  4CN4 A;  3V8J A;  3REX A;  5LB7 B;  3VR8 A;  4YRP A;  3FZL B;  5AQM B;  3CQC B;  5DJQ C;  5AQR B;  3UFE A;  3MJX A;  1OED A;  2AKW B;  3FZH B;  3AE1 A;  4O4H E;  3E9H A; 
#chains in the Genus database with same CATH homology
 1WNL A;  1EQR A;  3IG2 A;  4RQE A;  2ALY A;  3BJU A;  2E64 A;  4HWO A;  3MQZ A;  4CH5 A;  4HWP A;  4YPF A;  2I4M A;  2DTI A;  4BW9 A;  3A5Y A;  2CJB A;  4TVY A;  5HGQ A;  3VQW A;  4P73 A;  3FJP A;  4LNS A;  4H2Y A;  4WJ3 M;  4TWA A;  4XU2 A;  3HFV A;  2ZTG A;  3MF2 A;  4YP0 A;  2AKW A;  4Q15 A;  2Q7E A;  2ZCE A;  3EFR A;  4XEM A;  2DU5 A;  1EVK A;  3M4P A;  4LVJ A;  1W66 A;  11AS A;  1LYL A;  2ZR3 A;  3PZC A;  3V8K A;  1PYS B;  4J15 A;  1ASY A;  3LSQ A;  4ZTU B;  3L4G A;  3V7C A;  1YFR A;  4KQE A;  4TVA A;  1B70 B;  3TUP A;  4HVC A;  4L87 A;  1IL2 A;  3L1A A;  3HXX A;  1YB3 A;  2J3L A;  4H2W A;  3A7U A;  1WLE A;  3BFM A;  2DDZ A;  1E1O A;  2EJG A;  4P3P A;  1SRY A;  2DEQ A;  1BBW A;  4O2D A;  3UH0 A;  4UP8 A;  2ZT8 A;  1WQ7 A;  1J5W A;  1SET A;  3HRK A;  4RMF A;  4XTY A;  4XEO A;  1B76 A;  1E22 A;  5E3I A;  12AS A;  1BBU A;  4YYE A;  1G51 A;  1YFT A;  4H2V A;  3A7A A;  2G4C A;  4P73 C;  2AMC A;  3W3S A;  2EAY A;  1X55 A;  4RQF A;  4YRK A;  2QHU A;  3P8T A;  2IY5 B;  3RUX A;  3NET A;  4TQF A;  1NJ1 A;  4XTW A;  3RKW A;  1EIY B;  1X54 A;  2QHS A;  4XTZ A;  1WQW A;  3HY1 A;  4H2T A;  2P5I A;  4ZIB A;  2DTH A;  4XTV A;  2I4L A;  3RF1 A;  5C53 B;  3LSS A;  1NJ5 A;  3KFU A;  2DZ9 A;  1NJ6 A;  4H02 A;  1B7Y B;  3L2Z A;  1BIA A;  1EVL A;  2PME A;  4YRT A;  1ADJ A;  3REU A;  3VQV A;  2CJA A;  3V8L A;  2DQ0 A;  4YRQ A;  4YRN A;  1QE0 A;  1N9W A;  1H4V B;  4P72 C;  3EFS A;  2ZNJ A;  4LVL A;  2I4N A;  4YRO A;  1ASZ A;  3TEH B;  5C52 B;  2Q7H A;  5K1X A;  1HXD A;  4CS3 A;  2RHQ A;  3A5Z A;  1X01 A;  2ZT7 A;  2P0L A;  3UGQ A;  3VQX A;  2ZT6 A;  4TQD A;  4YRF A;  2DZC A;  2ARU A;  2ZIN A;  1JJC A;  2E65 A;  3V7R A;  4Q6G A;  4YRM A;  5F5W A;  4YRR A;  2ZR2 A;  2E10 A;  4HT4 A;  2NS6 A;  4HWS A;  4P74 A;  3A7R A;  1EIY A;  4OLF A;  3RKY A;  2ZZF A;  1B7Y A;  4WJ4 A;  2RHS B;  3I7F A;  1Z7N A;  4P75 A;  3A32 A;  3RAC A;  2C7I A;  2DTO A;  4PG3 A;  3V7S A;  1JJC B;  1KMN A;  2EWN A;  4P74 C;  3R07 A;  4TVW A;  4UP7 A;  2Q7G A;  4P71 C;  3IKM B;  4YRI A;  4RDX A;  1ADY A;  2CIM A;  3M4Q A;  3NEL A;  4H2S A;  3A31 A;  4K87 A;  4WI1 A;  4HA8 A;  3HFZ B;  1NJ2 A;  4YRC A;  4CS2 A;  3P8Y A;  4HWT A;  2J3M A;  4EO4 A;  2ZZG A;  2QHT A;  3RL6 A;  5KNN A;  3P8V A;  3PCO B;  1KMM A;  1PYS A;  2DJZ A;  2CGH A;  2ARS A;  4YRJ A;  4LVM A;  2C8M A;  4G84 A;  4E51 A;  1NYQ A;  1FYF A;  5C51 B;  4HWR A;  4OP0 A;  4UP9 A;  3IKL A;  4LVI A;  2EJF A;  2DXU A;  1BIB A;  3HXY A;  2A8E A;  3MF1 A;  3RIR A;  4YRE A;  1E24 A;  2ZT5 A;  4BWA A;  1X56 A;  2E41 A;  3A74 A;  4XU0 A;  4CH4 A;  3IAL A;  4CS4 A;  4YCU A;  3HXU A;  1HC7 A;  2DU7 A;  3HTZ A;  4AH6 A;  2E1H A;  4P71 A;  3VQY A;  3WQZ A;  4WF2 A;  3LC0 A;  3ICA A;  3UGT A;  4XU3 A;  2DXT A;  3PCO A;  4YRL A;  4X5O A;  4NCX A;  3HXW A;  2ZNI A;  3HRI A;  3RKX A;  1WU7 A;  4YDQ A;  4XTX A;  3L4G B;  3VBB A;  4K88 A;  3RGL A;  2HNI A;  1QF6 A;  3E9I A;  3HXZ A;  3QTC A;  3HFZ A;  2E5A A;  1NYR A;  3HY0 A;  2DVE A;  1X2G A;  2ODR C;  2ZIM A;  1EOV A;  2Q5H A;  4K86 A;  2EL9 A;  4YCV A;  4G85 A;  4P72 A;  3TEG A;  3UFG A;  3DSQ A;  2CJ9 A;  1VQZ A;  4YRG A;  2RHS A;  2DQ3 A;  1USY A;  1B70 A;  1G5I A;  2AMC B;  2ZIO A;  3MEY A;  1RIQ A;  4DQ2 A;  1ATI A;  3G1Z A;  3CMQ A;  4XTU A;  5K1P A;  4H2U A;  4P3O A;  1YFS A;  1Z7M A;  3OD1 A;  1C0A A;  2Q5I A;  3QO5 A;  3HXV A;  4LVK A;  2ART A;  2ZGW A;  4TVA B;  1G5H A;  4H2X A;  2FYK A;  3QO8 A;  1E1T A;  1H4Q A;  1KOG A;  1NNH A;  1HTT A;  1H4S A;  1NJ8 A;  4P75 C;  2EJ9 A;  1X2H A;  1H4T A;  2I4O A;  1WPY A;  2XGT A;  3NEN A;  4TTV A;  1USY C;  4YRS A;  2ZXF A;  1SES A;  4PHC A;  4CH3 A;  4P3N A;  4ZTZ B;  2ODR D;  2RHQ B;  3QO7 A;  2PMF A;  1GGM A;  4KR3 A;  3TEH A;  2E3C A;  4H2X B;  4CH6 A;  3QNE A;  1L0W A;  3ERR A;  5ELO A;  1EFW A;  4XU1 A;  1WYD A;  2DKG A;  4DPG A;  2XTI A;  3V8J A;  3REX A;  4EX5 A;  1SER A;  1B8A A;  2ZZE A;  4UPA A;  4YRP A;  2ALY B;  1YGB A;  4KR2 A;  2IY5 A;  4YCW A;  3NEM A;  2AKW B;  5ELN A;  2QHV A;  3E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...