1J5WA

Crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
276
Chain Sequence
MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha chain
publication title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Ligase
total genus 95
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 1j5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1j5wA01
1B70A 4YRNA 3NENA 1QF6A 2EJ9A 12ASA 4K88A 3NETA 2QHVA 4P72A 2EWNA 3LSSA 2PMFA 4XU2A 5C52B 4WF2A 1X54A 4P71C 2XGTA 1N9WA 1EFWA 3FJPA 4YREA 4HWRA 3R07A 4TQDA 1Z7MA 4H2WA 4YRCA 1BBWA 4YRFA 4ZTUB 4LNSA 4YP0A 4RQFA 3QO8A 1SRYA 1KMNA 1HC7A 1E22A 3L2ZA 2J3LA 2PMEA 2QHSA 2XTIA 3QNEA 4J15A 4XTYA 3RUXA 2ZNJA 4OLFA 1SESA 2Q7EA 5E3IA 4XTUA 2ZT5A 4UP8A 4X5OA 1EIYB 4UPAA 1BBUA 3TEHA 4UP7A 4YRIA 4YRJA 4H2UA 2ARUA 3QTCA 2ZCEA 2EAYA 4YRSA 4O2DA 4DPGA 1BIAA 2I4MA 4Q6GA 2Q7GA 4H2SA 3MF1A 3HRKA 1NYQA 4YCUA 3BFMA 4HA8A 1KOGA 4XEOA 2DVEA 3A31A 3REXA 4YRLA 4XTVA 1ADJA 3UGQA 4YCWA 1BIBA 2P0LA 2DXUA 3TUPA 2RHSA 3L1AA 3CMQA 5K1XA 4XU1A 3IG2A 2I4LA 4WI1A 3RL6A 4WJ4A 2P5IA 1EIYA 4P3NA 3V7CA 3VQWA 4YYEA 2I4NA 4CH4A 3PCOB 3LSQA 4WJ3M 1WNLA 2QHUA 3A7AA 1USYA 1X55A 5HGQA 3W3SA 4H2VA 3PZCA 2DTIA 3VQVA 2ZIMA 4H2XB 1B7YB 1WLEA 4CH3A 3HXYA 4H2TA 2ZT8A 3TEGA 2DZCA 3TEHB 3A5YA 4XTXA 2E10A 1NJ8A 2ARTA 3G1ZA 2ARSA 2ALYA 4TTVA 4HWPA 1SERA 3PCOA 2AMCB 2DZ9A 1X01A 4G85A 4YDQA 4TVAA 4PG3A 4CS2A 4XTZA 2ODRD 5C53B 3LC0A 3M4QA 2CJ9A 4YRPA 2RHSB 4RMFA 4H2XA 3V7SA 1EQRA 4P73C 1B7YA 2EL9A 4L87A 5KNNA 5F5WA 4G84A 1EVLA 4P3OA 2Q5HA 1KMMA 4ZIBA 1NJ6A 4RDXA 3E9HA 1WQ7A 11ASA 1G5HA 2Q5IA 1NNHA 2ZTGA 4P71A 4TQFA 3HY1A 3NELA 3P8VA 2QHTA 3HY0A 3V8KA 3A32A 1G51A 1B8AA 2IY5B 2AMCA 4TVWA 2CJBA 2ZIOA 3UH0A 3A7UA 3RGLA 4OP0A 2ZINA 3QO5A 4H02A 2AKWB 4RQEA 3EFSA 2CIMA 4K87A 4HWOA 3IALA 2RHQA 3MEYA 4P73A 1H4QA 3L4GB 4KR3A 3RACA 1EOVA 1W66A 4YRRA 4P74C 4Q15A 1FYFA 4YCVA 4DQ2A 1Z7NA 3HXXA 1SETA 2ALYB 4YRMA 4P72C 3A74A 4TWAA 3DSQA 1YGBA 4XEMA 1RIQA 3RKWA 3V7RA 1IL2A 4TVAB 4ZTZB 3HXUA 1HTTA 1NJ5A 1ATIA 2IY5A 2E64A 1WU7A 4KQEA 2ZT6A 2CJAA 1GGMA 3RKXA 2AKWA 4E51A 2ZXFA 3RIRA 4PHCA 1E24A 1PYSA 1E1OA 3RKYA 3P8YA 1YFRA 2EJFA 4YPFA 3L4GA 3OD1A 5ELNA 2ZNIA 3UGTA 1X2HA 2HNIA 3HTZA 1NJ1A 2DDZA 4XU0A 4AH6A 1E1TA 4P74A 4XU3A 1ASZA 2DU5A 4YRQA 1L0WA 3WQZA 3V8LA 1VQZA 5C51B 2DU7A 3V8JA 3VBBA 2G4CA 2ZR2A 3HFZA 2E65A 3EFRA 2RHQB 3HFVA 3E9IA 4UP9A 2ODRC 1X2GA 2EJGA 1C0AA 4YRTA 2ZT7A 2E1HA 1JJCB 3M4PA 2J3MA 3A5ZA 4HVCA 1EVKA 2DTHA 2DKGA 1NYRA 2ZZEA 4P3PA 3ERRA 4EX5A 4K86A 3ICAA 2ZGWA 4CS3A 4XTWA 2C7IA 4CS4A 3RF1A 4HWTA 2DJZA 1J5WA 1ASYA 3BJUA 4P75C 4BW9A 1H4VB 3A7RA 3NEMA 1ADYA 1NJ2A 2ZZFA 4TVYA 2I4OA 4HWSA 1USYC 4NCXA 4BWAA 3HXWA 1PYSB 3KFUA 3HXZA 3QO7A 5ELOA 2DEQA 2DQ0A 4KR2A 2DTOA 4CH6A 2DXTA 4YRGA 1WQWA 1JJCA 2C8MA 4YROA 1H4SA 3I7FA 2CGHA 2E3CA 1B70B 2FYKA 1H4TA 1QE0A 2E5AA 3MF2A 4H2YA 1G5IA 1WYDA 1HXDA 2E41A 2ZR3A 1YB3A 2DQ3A 3IKMB 3HFZB 3VQYA 3IKLA 1LYLA 1YFTA 4P75A 3HXVA 3UFGA 3VQXA 2Q7HA 3P8TA 4CH5A 1YFSA 5K1PA 1B76A 4YRKA 3HRIA 2ZZGA 1X56A 4EO4A 1WPYA 3REUA
chains in the Genus database with same CATH superfamily
1QF6A 2N2NA 4X20E 3L39A 4HTEA 3AA7B 3FZHB 4N78D 2H7OA 5C52B 3L09A 2MOZA 4ZI2C 2XGTA 3JC6C 4TQDA 5L3FB 1Z7MA 4H2WA 4QKNA 2DCFA 3RHWA 4YRFA 4ZTUB 4GIWA 2FUPA 3PURA 4OK0A 4RQFA 4CN4A 1NWMX 5IYZE 2I59A 3ZPOA 1WYBA 2G0UA 2VVSA 5BMVE 2YINA 5A1LA 4DV6T 4XTYA 2W2UA 3RUXA 2ZNJA 3PU8A 4ISSA 3B13A 3L8RA 3VRBA 3GN5A 4PK6A 5DQWA 4XTUA 4I50E 4CI3B 2Q9QD 2CBIA 4X5OA 1EIYB 3RKGA 2CEAA 4UPAA 2YU2A 2NWBA 4JEHB 2XQ7A 4ASKA 3QNUA 2ZCEA 2NOXA 4YRSA 3LFMA 1YKEB 1BIAA 4H2SA 5DQVA 4IE5A 4BA9A 4JYAT 1KOGA 4NPPA 4EZ4A 4EGWA 4CN6A 2DVEA 1ZV4X 3T8OA 4AQFA 3REXA 1ADJA 1BIBA 3HI2A 3TUPA 3AECA 3N9PA 5LBMA 1W9RA 2IAKA 2ACXA 3PDYA 5JDGA 5K1XA 4LVMA 4XU1A 4IL9A 1S94A 4JI7T 5HWYA 4HE8A 4TWFA 3UUMA 1H7CA 1EIYA 5KMGP 3V7CA 1UX5A 3JCFA 4E7SA 4KMCA 4PAGA 4YYEA 2CXDA 4CH4A 3ZEFB 2OLTA 2Y48B 3A7AA 3GA8A 4UF0B 5LYJE 1USYA 2VURA 4L5GA 4H9PC 3TLUA 2XPKA 2ZIMA 4WZXA 3KV4A 2NR4A 4GK5E 5LMUT 3SWHA 4TZ4C 3CQCB 5EK3A 3HR0A 2CE7A 3TEHB 3C51A 2BS3A 2NTYA 3B5MA 1LRZA 2Y8DA 4DBRA 1X9BA 2YU1A 4I43B 2DZ9A 1JNZA 2UXCT 4TVAA 4UF0A 1MNDA 4PG3A 3AEDA 2ODRD 4C91A 3M4QA 3EVYA 4COFA 2W61A 1NAFA 2RHSB 4RMFA 3V7SA 1EQRA 4CZZB 2EL9A 4L87A 2A2FX 2NS6A 2V5CA 1XWMA 2DI4A 3B57A 2E8IA 3VRAA 4PNIA 2PFVA 2LKGA 3CX6B 4ZIBA 4LFCT 1NJ6A 4XBFB 3AB3B 1WQ7A 1G5HA 1HFAA 3I9WA 2KWIB 4P71A 2QRXA 4IHJE 2K48A 1DU2A 1BR4A 4TQFA 3NELA 2ZM6T 3QUJA 5L2LA 1X79A 4Z90A 1G51A 1B8AA 2CJBA 1I6ZA 2ZIOA 4I55E 1XDPA 3Q2MA 3BQIA 1UCUA 3QO5A 2E9XB 3P4QA 2BVLA 3EFSA 2CIMA 1N33T 3I0QA 4BJNA 5AQFB 5HCMA 3MEYA 2CPTA 3UU8A 4P73A 3L4GB 3N9NA 4P09A 5AQRB 5IHYA 3QB5A 1SETA 2ALYB 4B3MT 4P72C 3EHZA 1YGBA 1ZOYA 3CQXC 4V1Av 3HXUA 4P0AA 1NJ5A 2LSGA 3ZKRA 2E64A 2FJDA 2C5KT 3O4XE 3UU3A 2B1EA 2WZHA 3TLTA 4KQEA 3ANWB 2JQHA 3R84B 3LSVA 2KT9A 3RKXA 4YT0A 4E51A 2AE9A 4A97A 1E1OA 2W00A 3OJAA 3L4GA 3OD1A 3T1HT 2ZNIA 5ABEA 4DR6T 4EV6A 4OX9T 1NJ1A 2X0YA 4AH6A 4P74A 4DV0T 4X64T 4QH1A 5JR9C 3ZYKA 5C51B 3V5UA 2BG9A 2H3RA 3V8JA 2BDEA 2CWOA 3K3NA 2E65A 3UQ7A 3LG7A 3EFRA 3A8YC 2RHQB 3ZSTA 2UU9T 4EIWA 5M4YA 4DR1T 3KVBA 2BVMA 2CLYC 5LA6E 1C0AA 4E7ZA 4HFHA 2DTHA 2DKGA 4OHFA 5HAXA 4MALA 1NENA 3ICAA 2ZGWA 2KZ7B 1U4QA 3FBLA 4XTWA 4U33A 3RF1A 4JI2T 4ZI3D 2IUBA 2VKDA 2JJ9A 3H3MA 3NEMA 2IC6A 2KSRA 4ISTA 3RX6A 5KXJA 1BR1A 1PYSB 2V6YB 2KLQA 1HX8A 1WCRA 4OYJA 3HXZA 4AKGA 3QO7A 2ODUA 2DEQA 4YRGA 2DXTA 1UUSA 2PBIA 4TWHA 2LHNA 3ZMTB 5FL0A 3MF2A 2X66A 4H2YA 1HXDA 5CFBA 2ZR3A 2BZBA 2LSYA 4YXDA 3J7Yq 3RRWA 3IKMB 3IKLA 5F3JA 2UXNB 1YFTA 2XAGB 3BQKA 3HXVA 3CX7B 5HXHA 1QLBA 1MMAA 4DVDA 2V6YA 4X66T 3P8TA 1OXZA 3PUGA 3EI0A 5K1PA 5TAOA 4EB6E 5CGMA 2ZZGA 1B7TA 4IT4A 3KBTA 4BAYB 2V5DA 5ABFB 4YJ2E 3REUA 3FZKB 3AXJB 1I94T 2CM0A 2IW5B 3NETA 1M7KA 5JDQA 4XZCA 5JQGE 3LK42 4HFIA 3RRCA 4GKKT 3FJPA 3P4SA 2NTXA 3R07A 2UXBT 1S35A 4O8SA 1SRYA 4LMJA 5L4EA 1VOMA 1HC7A 1IJ6A 3HA4A 4IIJE 4DR2T 3KDSE 3I1AA 2J3LA 4QXHB 4HWCA 2XTIA 2DLRA 4J15A 5ABFA 3PUQA 4OLFA 4JI4T 2N9DA 2ZT5A 3DP7A 3MACA 4UP8A 1HF8A 4F6RC 3C4WA 3O9XA 4UP7A 4ADZA 2JQQA 4B3RT 5IWAT 4YRIA 3RIUC 4YRJA 4H2UA 2ARUA 3QTCA 2E9XD 1D0XA 5HWXA 2YK0A 3AE4A 3EABA 4DPGA 2I4MA 2JPFA 2K5BB 4YJ3E 3VKGA 4O4IE 1NYQA 4JI0T 2WMOA 3P50A 3TKLB 3A31A 4X62T 1D1CA 4YRLA 3U78A 3UGQA 4YLHA 2XQ5A 2Y6XA 2UXXB 2CXFA 5FXXA 3DTOA 3FHNA 2I4LA 4WI1A 5ABGA 3RL6A 2WWUA 3N9MA 4AQYT 5FXVA 3UFEA 3D0TA 4DBQA 3PCOB 2XUEA 3GMIA 4WJ3M 3KVAA 5EZYE 4H2VA 4PFOA 4WW0A 3AVSA 2IHR1 1WLXA 4YTPA 2WY2A 5L47A 4EEDA 3VQVA 3UU6A 3PUYF 4H2XB 2VVNA 5AQQB 5HCJA 5LHGB 1WLEA 4G2AA 3HXYA 4H2TA 2E5LT 3CWZB 4C90A 2DZCA 3PUVF 1KF6A 2V6XA 4JI3T 3NRXA 1NJ8A 4WBOA 1VCSA 2ARSA 4CI1B 3FZLB 3ZMUB 2DHRA 3TLVA 4CXYA 2XM2A 4HWPA 2CXLA 1SERA 3PCOA 5LXTE 3ZMVB 4G85A 4HKAA 4DIDB 2NP9A 4XTZA 4QHOA 3R6NA 5C53B 1YD8G 3SRZA 3LC0A 2CJ9A 4UVCB 4H2XA 4LF7T 2BBJA 3LK3B 4G84A 3FB2A 5KDMC 2KINB 2XQAA 2Q5HA 1KMMA 1G8XA 3JAEA 1KK7A 2A8EA 5AFUL 2Q5IA 3CKDA 2FJEA 2WDRA 4YSXA 3NVOA 2YOEA 2XHEB 4AXPA 5FY1A 5FYMA 3AEEA 2A3DA 2X9WA 3P8VA 4HWFA 3ZT6A 4TVWA 1KNPA 2D0UA 5J2TE 2ZMAA 2V7LA 2A72A 3CVRA 2V7MA 3RGLA 1OEDC 4EYYR 2FBWA 3UU5A 1IBMT 4EZHA 3Q5XA 5J0ZA 1XMQT 3IALA 1SA0E 2ZM2A 4MHCA 3CQGB 3RYIE 4UV9B 4LF6T 3ONLC 4Q15A 5LHIB 2HPJA 3ZJ2A 2J47A 3HL6A 4YRMA 4IE7A 3KBUA 4LFAT 4ZEYA 3AA0B 4TWAA 3DSQA 4XEMA 3ZMZB 1YKHB 4IE4A 3V7RA 4TVAB 3OPCA 4ZTZB 2KWHA 2HPLA 2RP4A 4NUVA 3Q5WA 1ATIA 4HEAA 2ZT6A 1GGMA 3ZSSA 2A9UA 3E22E 2CCQA 2DNXA 2ZXFA 3RIRA 3I9YA 3AE2A 1E24A 2XAHB 1O3XA 4H63V 4KHZF 1YFRA 2VQET 2W62A 2EJFA 1UK5A 3HKBE 4JI1T 3AAIA 2I6HA 4PJJA 1W0AA 4U7YA 2W67A 2DU5A 4YRQA 1L0WA 3WQZA 3V8LA 5LCYA 3VHLA 4DMWA 4M1PA 2NW9A 2LM2A 2ZR2A 3HFZA 4H9OC 3NRYA 1D0YA 2QVAA 4AQGA 4GYSA 4AKHA 3HFVA 3H37A 2BKOA 5JH7E 4IE0A 2FJAA 4NUUA 2EJGA 3M3ZB 3KV9A 2E1HA 2ZT7A 3ZN0B 4DR3T 1E1HB 1JJCB 3WAJA 2WZIA 3A5ZA 2JRKA 3CX8B 3S4UA 3V5SA 5AQPB 4ILCA 3T1YT 3E08A 1NYRA 1ZHCA 4TUYE 5HXSA 4K86A 4CS3A 4JBWF 1HS7A 4OYKA 2V7KA 3TLSA 3WI3A 2XSAA 3KINB 3AA6B 4O4JE 3N9LA 3UULA 2ZZFA 2I4OA 1USYC 1J5ET 2LE8A 1FEWA 1R8IA 3OYZA 2XY8B 2ZM0A 4NXMT 3QC9A 2DTOA 4CH6A 1JJCA 1WQWA 4A56A 3ZMSB 4YROA 2YEVC 4YSZA 2CGHA 2E3CA 1B70B 1VRBA 2P9BA 2QYWA 1HTJF 3N2GE 2YDQA 1MMNA 4UXNB 1BR0A 2V8SV 2BG9B 3VR8A 1AJ3A 3PUAA 2DQ3A 3VQYA 5JDMA 3PUWF 3QB5K 1V9DA 1D1BA 3VQXA 3LDQB 4PK4A 2V7JA 3RQWA 3PTRB 4QX7B 4X5TA 2MTQA 1U5PA 4YRKA 4G63A 4U72A 2WP9A 4LVLA 4EO4A 3Q5DA 5HXRA 3AAAB 4DV7T 4JLEA 3RKOA 2BS4A 1B70A 4YRNA 1Z0PA 2EJ9A 4K88A 2QHVA 2EWNA 2PMFA 2N1GA 5J1GA 3C64A 1W0BA 2F4VT 1X54A 4P71C 4DR4T 4AIUA 1MIVA 4YREA 2WCAA 3LJCA 1EZ3A 4YRCA 4QWNB 3KV6A 1BBWA 4LNSA 2XM1A 3ZT7A 4YP0A 2VKOA 1E22A 4H9RC 2CHNA 3L2ZA 5HEJA 2PMEA 2QHSA 2V1DB 3QNEA 2L3LA 3ETVA 5E3IA 2HHHT 4O2AE 5J2UE 3NZPA 2VB6A 4U74A 4YHHT 1MMGA 4HWIB 1LVFA 3UUXB 3C4XA 2PG8A 2XQ3A 1SUMB 3AEAA 2EHOC 4Q6GA 2VL0A 3KV5A 3MF1A 3HRKA 1Y64B 4PJMA 3HKEE 4HA8A 3FXEB 4EEBA 4UV8B 4DR5T 5JVDE 3P4PA 2E9XC 4FJOA 2XZEA 5LG4A 3J9X1 4KBMB 3RH3A 2WU2A 3VR9A 4PK5A 4EOZB 1IAPA 1KEYA 5H6QB 3L1AA 3OVUA 2XQ8A 5C8YE 3IG2A 4ILAA 4WJ4A 2P5IA 4LMLA 5F8PA 1FMVA 2H88A 2H7VC 2X9XA 4ZS2A 3GWHA 3RIUA 1UGOA 3LSQA 3F2EA 3LBXB 2QHUA 4U31A 3M65A 3W3SA 4KI0F 4BJMA 3UT5E 5LHHB 4NXNT 3FZFB 3ZYMA 3HKCE 3ZN1B 5AQLB 3AEBA 3ONJA 3RPUA 3CPZA 1B7YB 4LFBT 2MBGA 2D9DA 1IBKT 3ZC0A 3MJXA 1YQ3A 3QK6A 5LGTB 4YHJA 2FJBA 2E10A 2ARTA 2ZLYA 5JRCA 3F57A 5H6RB 2M67A 4U3CA 5AQVB 4A5XA 4TTVA 3BK9A 4ZI7E 5DABA 3SS1A 2AMCB 5CA1E 2ES0A 3O1IA 3LBXA 5AQMB 2JMKA 4YDQA 4F8HA 4AISA 3IHRA 4DUYT 4CS2A 2HH7A 4WYVA 5FY0A 4DV4T 2WQYA 2PJQA 1B7YA 3MA9A 3ZCIA 5KNNA 3JADA 1EVLA 2WWVA 4TNWA 4LVKA 5AQTB 3E9HA 2CHOA 3H3AA 2BBHA 2WDVA 2HN2A 3SOLA 2YKSA 2WM9A 2LRKA 5FKYA 3MZKB 5L4HA 3UU4A 3P4WA 4YTNA 2Z6EA 3HY1A 2Q9QC 5HEHA 5HXCA 1SE7A 5KX5E 2QHTA 3HY0A 3V8KA 2RA1A 2IY5B 2AMCA 4I4TE 2XAJB 1UX4A 4YTMA 3HKDE 3P8CD 2H89A 2AKWB 2MYSA 2VASA 4X65T 5HEOA 2XTLA 3ESLA 3MXZA 1Z8UA 1WR0A 2M6BA 4L9IA 3IBPA 4AI6A 3ZYLA 3W15B 4QH4A 3RACA 3UTKA 4WBNE 3PUSA 1FYFA 4YCVA 3HXXA 3MQZA 2NW7A 3A74A 1HNXT 1D1AA 1RIQA 4HWHA 5LGUB 1IL2A 2D5UA 5LB7B 3IF8B 2IY5A 1WU7A 1WR6A 5AQKB 2X67A 2AKWA 3RC3A 1Y01A 5FVLA 3PJAJ 3N2OA 3NWIA 1HNWT 2K3WA 2LSKA 3P8YA 1T98A 2SPCA 2J1DG 2ZM8A 4YPFA 5ELNA 1MIWA 1J1JA 3Q9DA 3UGTA 2VL8A 1FIOA 5CB4E 2DWKA 2DDZA 3NKZA 3O1HA 5AQSB 2M6IA 4XU3A 1M62A 4UELA 3AE5A 4CXWA 3WAKA 2X51A 4DMVA 2KMFA 2L9QA 2DU7A 2YDSA 2WSSV 3BQLA 3G06A 3VBBA 2G4CA 2XQ4A 5FNVE 1VCTA 4KUMB 1E7PA 5FXZA 2NW8A 3FXDB 2UUCT 2WBLA 4JUYA 3C50A 3MK7C 4UP9A 2ODRC 1X2GA 3K3QC 3AVRA 1BR2A 4YRTA 1SHZC 3ONXA 1T7SA 5ABHA 1N32T 1G73A 3OKQA 2W66A 4ERRA 2X0LB 1EVKA 1KNRA 4X1KE 1CUNA 3ERRA 4QH5A 4MLKA 5C2TA 2YDRA 4MBQA 2C7IA 1J5WA 2BS2A 3EUHA 3CK6A 3P7IA 2LSIA 3BJUA 4P75C 4BW9A 1MMDA 3UUBA 4EYUA 1ADYA 1NJ2A 3ZT5A 3PUXF 4NCXA 4NIQA 3HXWA 4ILUA 4H9NC 5ELOA 3JAFA 2DQ0A 3K8PC 2WMNA 3OTOT 4H9SE 4HGAA 1H4SA 5LJMA 3I7FA 4JV5T 3DJBA 1XNQT 2W4XA 4O2BE 1H4TA 3ZJ1A 5LG3A 1D0ZA 3LK2B 1G5IA 5FP3A 2E41A 3ZC1A 1YB3A 3HFZB 2BKNA 5AQIB 1LYLA 2XQYA 4U2ZA 3FBZA 4AKLA 3MKDA 5L3CB 4ZXLA 1HCIA 4X1YE 2E5VA 5CA0E 2Q7HA 4CH5A 4ZHQE 1B76A 4XAXB 4QXCB 3AE9A 5FXWA 3A5XA 2KXPB 4A98A 4ZI2D 4JI6T 2JQKA 1MIYA 5JDFA 2LEHA 3JC6D 3NENA 1YW0A 5DJQC 4L0RA 2XAQB 4HT4A 2VK9A 12ASA 2LRLA 4P72A 3LSSA 4CQIA 4XU2A 2VKHA 4WF2A 5JR9B 1WRDA 3IA3A 2AXDS 1N9WA 1EFWA 4JI5T 4HWRA 4LF8T 2K9AA 4DR7T 2JQ9A 5AQNB 5AQJB 3QO8A 4DV3T 1KMNA 3AEFA 2HN1A 5EK2A 2VQFT 4AQFC 2C5IT 2CLYB 4P1NA 3SFEA 4KHPT 3IEEA 4LVIA 3NBXX 2DWGA 1SESA 5FL1A 2Q7EA 2E2AA 2YN6A 4HFEA 5AQHB 3RIFA 4UVAB 3F31A 1UURA 4I0UA 2RPAA 5JR9A 3ZCJA 1BBUA 3TEHA 4AKRB 2LKHA 3N9QA 2I0MA 2EAYA 4CXXA 2WDQA 4O2DA 1YXRA 4EAHA 4ZI3C 4TNVA 2EHOB 2Q7GA 5FMNA 3RYFE 2PTFA 2D0TA 4YCUA 3BFMA 2WS3A 4XEOA 2LOPA 2IIUA 1LVKA 1XMOT 4FI5A 4HFDA 4TV9E 4XTVA 2ODVA 3CIRA 3TLWA 4YCWA 2P0LA 2DXUA 2WB5A 2K24A 2RHSA 4H9QC 1YQ4A 2BKPA 3PV0F 5L3BB 3CMQA 4ZOLE 2CA5A 1OEDE 2KNDA 4OFZA 2OV9A 4DV5T 4P3NA 3VQWA 3E0ZA 4EXTA 2XJ7A 3I0OA 2I4NA 2XAFB 1WNLA 3ZLIA 1FJGT 4IDNA 3FZMB 2IMLA 1N34T 2EHOA 4QX8B 3NZQA 1ZKEA 4ZZCA 1X55A 5HGQA 3PZCA 3O1JA 4IL4A 3KFWX 4IDOA 2DTIA 4Z91A 2L8KA 5LJNA 5LNKA 1IJ5A 3K3OA 2WU5A 4O4LE 2E9XA 4CH3A 2X9YA 3PUZF 4GK0E 2ZT8A 1FMWA 1HG2A 4B3TT 3TEGA 4ZZBA 2CBJA 2JMHA 2X0HA 4HN9A 3AE1A 3A5YA 1US7B 2C0SA 3K1SA 4XTXA 5LP6E 2LSJA 1ZEEA 5L3GB 3RC8A 3N5LA 3G1ZA 1HR0T 3EAMA 4YFSA 2ALYA 2LOSA 4LVJA 2CWYA 4Q25A 2MPKA 3RI5A 2MAWA 1X01A 1IBLT 1HNZT 3A7MA 1JNRA 4LF5T 4DV2T 4Z8XA 3VU7H 4GOUA 2WAUA 1KFYA 4YRPA 3ANWA 4ILBA 5GONE 4YY3T 1E2AA 4P73C 5F5WA 2LHRA 2LT3A 2DL1A 3EDUA 5IUXA 4P3OA 3PE0A 1LKXA 4UR9A 3UUNA 4KP3C 5EK4A 4RDXA 2IDOB 11ASA 1NNHA 2ZTGA 2QA7A 2X68A 4IREA 4UIGA 1GQEA 5JDHA 4AKIA 1N36T 3RQUA 1HG5A 1T72A 2Q9QB 3A32A 1ZP0A 3UH0A 2R6GF 3A7UA 4OP0A 2ZINA 4HFCA 4H02A 4KX6A 4RQEA 5ETWA 4LF9T 4K87A 4HWOA 2RHQA 4K0UA 3U3IA 3AE6A 1H4QA 4TWDA 4KR3A 5ADXL 1EOVA 1W66A 4YRRA 4UVBB 5HEGA 4P74C 4PW8A 5JRCB 4IE6A 3OBVE 4DQ2A 1Z7NA 3N9OA 1W09A 3L3PA 3AEGA 3RYHE 3RYCE 3QOFA 2BG9C 5AQUB 3RKWA 4IGUA 2Q9QA 1HTTA 2UUAT 4LMKA 3P4RA 5LOVE 1WFDA 2CJAA 3RIAA 1QUUA 4U2YA 5JDNA 3RLFF 1L0VA 2D2SA 2V26A 4PHCA 2W63A 3AA1B 3AE8A 1PYSA 1CHUA 3RKYA 2XQ9A 4HFVA 2W0GA 4K0KT 4TN7B 4O4HE 2XASB 1X2HA 2HNIA 3HTZA 2LJLA 4XU0A 1E1TA 2VKJA 4J2CA 4UEMA 1ASZA 2XSBA 4H63H 1OWAA 2C5JA 1KNZA 3PJAA 1VQZA 5FY7A 2UXDT 2IC9A 5HYAA 3C98B 3N2KE 2CMRA 1HX1B 3AE7A 4ANJA 4CN1A 2ACZA 3X1DA 3E9IA 2J4GA 3UQ4A 5L3EB 4B6XA 5BR8T 2QGSA 3M4PA 2J3MA 4HVCA 2JIWA 5JTGA 3ETUA 2VWAA 4DO0A 2ZZEA 4P3PA 4JEUB 3AXJA 5HXEA 4EX5A 4TV8E 4WNKA 2EHOD 2XQ6A 4HWTA 5FVKA 1MNEA 2DJZA 4CS4A 1ASYA 1WYCA 4PJNA 4MFRA 4IDQA 4QXBB 1H4VB 3C4ZA 3A7RA 4YSYA 5LMNT 3OYXA 5HEUA 1OEDB 4P0BA 2J62A 4TVYA 4HWSA 3VKHA 4CI2B 4BWAA 3KFUA 2UUBT 5AQOB 4PJLA 5AQGB 4X1IE 4KR2A 4IDZA 5L3DB 4JI8T 1T8BA 2C8MA 2LM9A 2B76A 3CMLA 4HWDA 2FYKA 1QE0A 2E5AA 4GYRA 1XZYA 3EDVA 2LLYA 1QSDA 1NEKA 4PFPA 5C3JA 1WYDA 1XNRT 5LGNB 2GK9A 4LF4T 2V7IA 1XDOA 4DNDA 5E0OA 5JREA 4DUZT 4GKJT 4IDPA 4DV1T 5CJ5A 2X9HA 4P75A 1OEDA 2CRBA 3SFDA 3UFGA 4TX5A 4ZS3A 3AAEB 4HFBA 1YFSA 4U7IA 3ABVA 1IZNB 3HRIA 1X56A 5JDLA 5LBQB 3AE3A 1WPYA 4B3ST 2OA5A 3PU3A 3Q5EA 2BG9E 3GN5B
chains in the Genus database with same CATH topology
1B70A 4YRNA 3NENA 1QF6A 2EJ9A 4HT4A 12ASA 4K88A 3NETA 2QHVA 4P72A 2EWNA 3LSSA 2PMFA 4XU2A 5C52B 4WF2A 1X54A 4P71C 2XGTA 1N9WA 1EFWA 3FJPA 4YREA 4HWRA 3R07A 4TQDA 1Z7MA 4H2WA 4YRCA 1BBWA 4YRFA 4ZTUB 4LNSA 4YP0A 4RQFA 3QO8A 1SRYA 1KMNA 1HC7A 1E22A 3L2ZA 2J3LA 2PMEA 2QHSA 2XTIA 3QNEA 4J15A 4XTYA 4LVIA 3RUXA 2ZNJA 4OLFA 1SESA 2Q7EA 5E3IA 4XTUA 2ZT5A 4UP8A 4X5OA 1EIYB 4UPAA 1BBUA 3TEHA 4UP7A 4YRIA 4YRJA 4H2UA 2ARUA 3QTCA 2ZCEA 2EAYA 4YRSA 4O2DA 4DPGA 1BIAA 2I4MA 4Q6GA 2Q7GA 4H2SA 3MF1A 3HRKA 1NYQA 4YCUA 3BFMA 4HA8A 1KOGA 4XEOA 2DVEA 3A31A 3REXA 4YRLA 4XTVA 1ADJA 3UGQA 4YCWA 1BIBA 2P0LA 2DXUA 3TUPA 2RHSA 3L1AA 3CMQA 5K1XA 4LVMA 4XU1A 3IG2A 2I4LA 4WI1A 3RL6A 4WJ4A 2P5IA 1EIYA 4P3NA 3V7CA 3VQWA 4YYEA 2I4NA 4CH4A 3PCOB 3LSQA 4WJ3M 1WNLA 2QHUA 3A7AA 1USYA 1X55A 5HGQA 3W3SA 4H2VA 3PZCA 2DTIA 3VQVA 2ZIMA 4H2XB 1B7YB 1WLEA 4CH3A 3HXYA 4H2TA 2ZT8A 3TEGA 2DZCA 3TEHB 3A5YA 4XTXA 2E10A 1NJ8A 2ARTA 3G1ZA 2ARSA 2ALYA 4LVJA 4TTVA 4HWPA 1SERA 3PCOA 2AMCB 2DZ9A 1X01A 4G85A 4YDQA 4TVAA 4PG3A 4CS2A 4XTZA 2ODRD 5C53B 3LC0A 3M4QA 2CJ9A 4YRPA 2RHSB 4RMFA 4H2XA 3V7SA 1EQRA 4P73C 1B7YA 2EL9A 4L87A 2NS6A 5KNNA 5F5WA 4G84A 1EVLA 4P3OA 2Q5HA 1KMMA 4ZIBA 1NJ6A 4LVKA 4RDXA 3E9HA 1WQ7A 2A8EA 11ASA 1G5HA 2Q5IA 1NNHA 2ZTGA 4P71A 4TQFA 3HY1A 3NELA 3P8VA 2QHTA 3HY0A 3V8KA 3A32A 1G51A 1B8AA 2IY5B 2AMCA 4TVWA 2CJBA 2ZIOA 3UH0A 3A7UA 3RGLA 4OP0A 2ZINA 3QO5A 4H02A 2AKWB 4RQEA 3EFSA 2CIMA 4K87A 4HWOA 3IALA 2RHQA 3MEYA 4P73A 1H4QA 3L4GB 4KR3A 3RACA 1EOVA 1W66A 4YRRA 4P74C 4Q15A 1FYFA 4YCVA 4DQ2A 1Z7NA 3HXXA 1SETA 2ALYB 3MQZA 4YRMA 4P72C 3A74A 4TWAA 3DSQA 1YGBA 4XEMA 1RIQA 3RKWA 3V7RA 1IL2A 4TVAB 4ZTZB 3HXUA 1HTTA 1NJ5A 1ATIA 2IY5A 2E64A 1WU7A 4KQEA 2ZT6A 2CJAA 1GGMA 3RKXA 2AKWA 4E51A 2ZXFA 3RIRA 4PHCA 1E24A 1PYSA 1E1OA 3RKYA 3P8YA 1YFRA 2EJFA 4YPFA 3L4GA 3OD1A 5ELNA 2ZNIA 3UGTA 1X2HA 2HNIA 3HTZA 1NJ1A 2DDZA 4XU0A 4AH6A 1E1TA 4P74A 4XU3A 1ASZA 2DU5A 4YRQA 1L0WA 3WQZA 3V8LA 1VQZA 5C51B 2DU7A 3V8JA 3VBBA 2G4CA 2ZR2A 3HFZA 2E65A 3EFRA 2RHQB 3HFVA 3E9IA 4UP9A 2ODRC 1X2GA 2EJGA 1C0AA 4YRTA 2ZT7A 2E1HA 1JJCB 3M4PA 2J3MA 3A5ZA 4HVCA 1EVKA 2DTHA 2DKGA 1NYRA 2ZZEA 4P3PA 3ERRA 4EX5A 4K86A 3ICAA 2ZGWA 4CS3A 4XTWA 2C7IA 4CS4A 3RF1A 4HWTA 2DJZA 1J5WA 1ASYA 3BJUA 4P75C 4BW9A 1H4VB 3A7RA 3NEMA 1ADYA 1NJ2A 2ZZFA 4TVYA 2I4OA 4HWSA 1USYC 4NCXA 4BWAA 3HXWA 1PYSB 3KFUA 3HXZA 3QO7A 5ELOA 2DEQA 2DQ0A 4KR2A 2DTOA 4CH6A 2DXTA 4YRGA 1WQWA 1JJCA 2C8MA 4YROA 1H4SA 3I7FA 2CGHA 2E3CA 1B70B 2FYKA 1H4TA 1QE0A 2E5AA 3MF2A 4H2YA 1G5IA 1WYDA 1HXDA 2E41A 2ZR3A 1YB3A 2DQ3A 3IKMB 3HFZB 3VQYA 3IKLA 1LYLA 1YFTA 4P75A 3HXVA 3UFGA 3VQXA 2Q7HA 3P8TA 4CH5A 1YFSA 5K1PA 1B76A 4YRKA 3HRIA 2ZZGA 4LVLA 1X56A 4EO4A 1WPYA 3REUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B70 A;  4YRN A;  3NEN A;  1QF6 A;  2EJ9 A;  12AS A;  4K88 A;  3NET A;  2QHV A;  4P72 A;  2EWN A;  3LSS A;  2PMF A;  4XU2 A;  5C52 B;  4WF2 A;  1X54 A;  4P71 C;  2XGT A;  1N9W A;  1EFW A;  3FJP A;  4YRE A;  4HWR A;  3R07 A;  4TQD A;  1Z7M A;  4H2W A;  4YRC A;  1BBW A;  4YRF A;  4ZTU B;  4LNS A;  4YP0 A;  4RQF A;  3QO8 A;  1SRY A;  1KMN A;  1HC7 A;  1E22 A;  3L2Z A;  2J3L A;  2PME A;  2QHS A;  2XTI A;  3QNE A;  4J15 A;  4XTY A;  3RUX A;  2ZNJ A;  4OLF A;  1SES A;  2Q7E A;  5E3I A;  4XTU A;  2ZT5 A;  4UP8 A;  4X5O A;  1EIY B;  4UPA A;  1BBU A;  3TEH A;  4UP7 A;  4YRI A;  4YRJ A;  4H2U A;  2ARU A;  3QTC A;  2ZCE A;  2EAY A;  4YRS A;  4O2D A;  4DPG A;  1BIA A;  2I4M A;  4Q6G A;  2Q7G A;  4H2S A;  3MF1 A;  3HRK A;  1NYQ A;  4YCU A;  3BFM A;  4HA8 A;  1KOG A;  4XEO A;  2DVE A;  3A31 A;  3REX A;  4YRL A;  4XTV A;  1ADJ A;  3UGQ A;  4YCW A;  1BIB A;  2P0L A;  2DXU A;  3TUP A;  2RHS A;  3L1A A;  3CMQ A;  5K1X A;  4XU1 A;  3IG2 A;  2I4L A;  4WI1 A;  3RL6 A;  4WJ4 A;  2P5I A;  1EIY A;  4P3N A;  3V7C A;  3VQW A;  4YYE A;  2I4N A;  4CH4 A;  3PCO B;  3LSQ A;  4WJ3 M;  1WNL A;  2QHU A;  3A7A A;  1USY A;  1X55 A;  5HGQ A;  3W3S A;  4H2V A;  3PZC A;  2DTI A;  3VQV A;  2ZIM A;  4H2X B;  1B7Y B;  1WLE A;  4CH3 A;  3HXY A;  4H2T A;  2ZT8 A;  3TEG A;  2DZC A;  3TEH B;  3A5Y A;  4XTX A;  2E10 A;  1NJ8 A;  2ART A;  3G1Z A;  2ARS A;  2ALY A;  4TTV A;  4HWP A;  1SER A;  3PCO A;  2AMC B;  2DZ9 A;  1X01 A;  4G85 A;  4YDQ A;  4TVA A;  4PG3 A;  4CS2 A;  4XTZ A;  2ODR D;  5C53 B;  3LC0 A;  3M4Q A;  2CJ9 A;  4YRP A;  2RHS B;  4RMF A;  4H2X A;  3V7S A;  1EQR A;  4P73 C;  1B7Y A;  2EL9 A;  4L87 A;  5KNN A;  5F5W A;  4G84 A;  1EVL A;  4P3O A;  2Q5H A;  1KMM A;  4ZIB A;  1NJ6 A;  4RDX A;  3E9H A;  1WQ7 A;  11AS A;  1G5H A;  2Q5I A;  1NNH A;  2ZTG A;  4P71 A;  4TQF A;  3HY1 A;  3NEL A;  3P8V A;  2QHT A;  3HY0 A;  3V8K A;  3A32 A;  1G51 A;  1B8A A;  2IY5 B;  2AMC A;  4TVW A;  2CJB A;  2ZIO A;  3UH0 A;  3A7U A;  3RGL A;  4OP0 A;  2ZIN A;  3QO5 A;  4H02 A;  2AKW B;  4RQE A;  3EFS A;  2CIM A;  4K87 A;  4HWO A;  3IAL A;  2RHQ A;  3MEY A;  4P73 A;  1H4Q A;  3L4G B;  4KR3 A;  3RAC A;  1EOV A;  1W66 A;  4YRR A;  4P74 C;  4Q15 A;  1FYF A;  4YCV A;  4DQ2 A;  1Z7N A;  3HXX A;  1SET A;  2ALY B;  4YRM A;  4P72 C;  3A74 A;  4TWA A;  3DSQ A;  1YGB A;  4XEM A;  1RIQ A;  3RKW A;  3V7R A;  1IL2 A;  4TVA B;  4ZTZ B;  3HXU A;  1HTT A;  1NJ5 A;  1ATI A;  2IY5 A;  2E64 A;  1WU7 A;  4KQE A;  2ZT6 A;  2CJA A;  1GGM A;  3RKX A;  2AKW A;  4E51 A;  2ZXF A;  3RIR A;  4PHC A;  1E24 A;  1PYS A;  1E1O A;  3RKY A;  3P8Y A;  1YFR A;  2EJF A;  4YPF A;  3L4G A;  3OD1 A;  5ELN A;  2ZNI A;  3UGT A;  1X2H A;  2HNI A;  3HTZ A;  1NJ1 A;  2DDZ A;  4XU0 A;  4AH6 A;  1E1T A;  4P74 A;  4XU3 A;  1ASZ A;  2DU5 A;  4YRQ A;  1L0W A;  3WQZ A;  3V8L A;  1VQZ A;  5C51 B;  2DU7 A;  3V8J A;  3VBB A;  2G4C A;  2ZR2 A;  3HFZ A;  2E65 A;  3EFR A;  2RHQ B;  3HFV A;  3E9I A;  4UP9 A;  2ODR C;  1X2G A;  2EJG A;  1C0A A;  4YRT A;  2ZT7 A;  2E1H A;  1JJC B;  3M4P A;  2J3M A;  3A5Z A;  4HVC A;  1EVK A;  2DTH A;  2DKG A;  1NYR A;  2ZZE A;  4P3P A;  3ERR A;  4EX5 A;  4K86 A;  3ICA A;  2ZGW A;  4CS3 A;  4XTW A;  2C7I A;  4CS4 A;  3RF1 A;  4HWT A;  2DJZ A;  1J5W A;  1ASY A;  3BJU A;  4P75 C;  4BW9 A;  1H4V B;  3A7R A;  3NEM A;  1ADY A;  1NJ2 A;  2ZZF A;  4TVY A;  2I4O A;  4HWS A;  1USY C;  4NCX A;  4BWA A;  3HXW A;  1PYS B;  3KFU A;  3HXZ A;  3QO7 A;  5ELO A;  2DEQ A;  2DQ0 A;  4KR2 A;  2DTO A;  4CH6 A;  2DXT A;  4YRG A;  1WQW A;  1JJC A;  2C8M A;  4YRO A;  1H4S A;  3I7F A;  2CGH A;  2E3C A;  1B70 B;  2FYK A;  1H4T A;  1QE0 A;  2E5A A;  3MF2 A;  4H2Y A;  1G5I A;  1WYD A;  1HXD A;  2E41 A;  2ZR3 A;  1YB3 A;  2DQ3 A;  3IKM B;  3HFZ B;  3VQY A;  3IKL A;  1LYL A;  1YFT A;  4P75 A;  3HXV A;  3UFG A;  3VQX A;  2Q7H A;  3P8T A;  4CH5 A;  1YFS A;  5K1P A;  1B76 A;  4YRK A;  3HRI A;  2ZZG A;  1X56 A;  4EO4 A;  1WPY A;  3REU A; 
#chains in the Genus database with same CATH topology
 1QF6 A;  2N2N A;  4X20 E;  3L39 A;  4HTE A;  3AA7 B;  3FZH B;  4N78 D;  2H7O A;  5C52 B;  3L09 A;  2MOZ A;  4ZI2 C;  2XGT A;  3JC6 C;  4TQD A;  5L3F B;  1Z7M A;  4H2W A;  4QKN A;  2DCF A;  3RHW A;  4YRF A;  4ZTU B;  4GIW A;  2FUP A;  3PUR A;  4OK0 A;  4RQF A;  4CN4 A;  1NWM X;  5IYZ E;  2I59 A;  3ZPO A;  1WYB A;  2G0U A;  2VVS A;  5BMV E;  2YIN A;  5A1L A;  4DV6 T;  4XTY A;  2W2U A;  3RUX A;  2ZNJ A;  3PU8 A;  4ISS A;  3B13 A;  3L8R A;  3VRB A;  3GN5 A;  4PK6 A;  5DQW A;  4XTU A;  4I50 E;  4CI3 B;  2Q9Q D;  2CBI A;  4X5O A;  1EIY B;  3RKG A;  2CEA A;  4UPA A;  2YU2 A;  2NWB A;  4JEH B;  2XQ7 A;  4ASK A;  3QNU A;  2ZCE A;  2NOX A;  4YRS A;  3LFM A;  1YKE B;  1BIA A;  4H2S A;  5DQV A;  4IE5 A;  4BA9 A;  4JYA T;  1KOG A;  4NPP A;  4EZ4 A;  4EGW A;  4CN6 A;  2DVE A;  1ZV4 X;  3T8O A;  4AQF A;  3REX A;  1ADJ A;  1BIB A;  3HI2 A;  3TUP A;  3AEC A;  3N9P A;  5LBM A;  1W9R A;  2IAK A;  2ACX A;  3PDY A;  5JDG A;  5K1X A;  4LVM A;  4XU1 A;  4IL9 A;  1S94 A;  4JI7 T;  5HWY A;  4HE8 A;  4TWF A;  3UUM A;  1H7C A;  1EIY A;  5KMG P;  3V7C A;  1UX5 A;  3JCF A;  4E7S A;  4KMC A;  4PAG A;  4YYE A;  2CXD A;  4CH4 A;  3ZEF B;  2OLT A;  2Y48 B;  3A7A A;  3GA8 A;  4UF0 B;  5LYJ E;  1USY A;  2VUR A;  4L5G A;  4H9P C;  3TLU A;  2XPK A;  2ZIM A;  4WZX A;  3KV4 A;  2NR4 A;  4GK5 E;  5LMU T;  3SWH A;  4TZ4 C;  3CQC B;  5EK3 A;  3HR0 A;  2CE7 A;  3TEH B;  3C51 A;  2BS3 A;  2NTY A;  3B5M A;  1LRZ A;  2Y8D A;  4DBR A;  1X9B A;  2YU1 A;  4I43 B;  2DZ9 A;  1JNZ A;  2UXC T;  4TVA A;  4UF0 A;  1MND A;  4PG3 A;  3AED A;  2ODR D;  4C91 A;  3M4Q A;  3EVY A;  4COF A;  2W61 A;  1NAF A;  2RHS B;  4RMF A;  3V7S A;  1EQR A;  4CZZ B;  2EL9 A;  4L87 A;  2A2F X;  2NS6 A;  2V5C A;  1XWM A;  2DI4 A;  3B57 A;  2E8I A;  3VRA A;  4PNI A;  2PFV A;  2LKG A;  3CX6 B;  4ZIB A;  4LFC T;  1NJ6 A;  4XBF B;  3AB3 B;  1WQ7 A;  1G5H A;  1HFA A;  3I9W A;  2KWI B;  4P71 A;  2QRX A;  4IHJ E;  2K48 A;  1DU2 A;  1BR4 A;  4TQF A;  3NEL A;  2ZM6 T;  3QUJ A;  5L2L A;  1X79 A;  4Z90 A;  1G51 A;  1B8A A;  2CJB A;  1I6Z A;  2ZIO A;  4I55 E;  1XDP A;  3Q2M A;  3BQI A;  1UCU A;  3QO5 A;  2E9X B;  3P4Q A;  2BVL A;  3EFS A;  2CIM A;  1N33 T;  3I0Q A;  4BJN A;  5AQF B;  5HCM A;  3MEY A;  2CPT A;  3UU8 A;  4P73 A;  3L4G B;  3N9N A;  4P09 A;  5AQR B;  5IHY A;  3QB5 A;  1SET A;  2ALY B;  4B3M T;  4P72 C;  3EHZ A;  1YGB A;  1ZOY A;  3CQX C;  4V1A v;  3HXU A;  4P0A A;  1NJ5 A;  2LSG A;  3ZKR A;  2E64 A;  2FJD A;  2C5K T;  3O4X E;  3UU3 A;  2B1E A;  2WZH A;  3TLT A;  4KQE A;  3ANW B;  2JQH A;  3R84 B;  3LSV A;  2KT9 A;  3RKX A;  4YT0 A;  4E51 A;  2AE9 A;  4A97 A;  1E1O A;  2W00 A;  3OJA A;  3L4G A;  3OD1 A;  3T1H T;  2ZNI A;  5ABE A;  4DR6 T;  4EV6 A;  4OX9 T;  1NJ1 A;  2X0Y A;  4AH6 A;  4P74 A;  4DV0 T;  4X64 T;  4QH1 A;  5JR9 C;  3ZYK A;  5C51 B;  3V5U A;  2BG9 A;  2H3R A;  3V8J A;  2BDE A;  2CWO A;  3K3N A;  2E65 A;  3UQ7 A;  3LG7 A;  3EFR A;  3A8Y C;  2RHQ B;  3ZST A;  2UU9 T;  4EIW A;  5M4Y A;  4DR1 T;  3KVB A;  2BVM A;  2CLY C;  5LA6 E;  1C0A A;  4E7Z A;  4HFH A;  2DTH A;  2DKG A;  4OHF A;  5HAX A;  4MAL A;  1NEN A;  3ICA A;  2ZGW A;  2KZ7 B;  1U4Q A;  3FBL A;  4XTW A;  4U33 A;  3RF1 A;  4JI2 T;  4ZI3 D;  2IUB A;  2VKD A;  2JJ9 A;  3H3M A;  3NEM A;  2IC6 A;  2KSR A;  4IST A;  3RX6 A;  5KXJ A;  1BR1 A;  1PYS B;  2V6Y B;  2KLQ A;  1HX8 A;  1WCR A;  4OYJ A;  3HXZ A;  4AKG A;  3QO7 A;  2ODU A;  2DEQ A;  4YRG A;  2DXT A;  1UUS A;  2PBI A;  4TWH A;  2LHN A;  3ZMT B;  5FL0 A;  3MF2 A;  2X66 A;  4H2Y A;  1HXD A;  5CFB A;  2ZR3 A;  2BZB A;  2LSY A;  4YXD A;  3J7Y q;  3RRW A;  3IKM B;  3IKL A;  5F3J A;  2UXN B;  1YFT A;  2XAG B;  3BQK A;  3HXV A;  3CX7 B;  5HXH A;  1QLB A;  1MMA A;  4DVD A;  2V6Y A;  4X66 T;  3P8T A;  1OXZ A;  3PUG A;  3EI0 A;  5K1P A;  5TAO A;  4EB6 E;  5CGM A;  2ZZG A;  1B7T A;  4IT4 A;  3KBT A;  4BAY B;  2V5D A;  5ABF B;  4YJ2 E;  3REU A;  3FZK B;  3AXJ B;  1I94 T;  2CM0 A;  2IW5 B;  3NET A;  1M7K A;  5JDQ A;  4XZC A;  5JQG E;  3LK4 2;  4HFI A;  3RRC A;  4GKK T;  3FJP A;  3P4S A;  2NTX A;  3R07 A;  2UXB T;  1S35 A;  4O8S A;  1SRY A;  4LMJ A;  5L4E A;  1VOM A;  1HC7 A;  1IJ6 A;  3HA4 A;  4IIJ E;  4DR2 T;  3KDS E;  3I1A A;  2J3L A;  4QXH B;  4HWC A;  2XTI A;  2DLR A;  4J15 A;  5ABF A;  3PUQ A;  4OLF A;  4JI4 T;  2N9D A;  2ZT5 A;  3DP7 A;  3MAC A;  4UP8 A;  1HF8 A;  4F6R C;  3C4W A;  3O9X A;  4UP7 A;  4ADZ A;  2JQQ A;  4B3R T;  5IWA T;  4YRI A;  3RIU C;  4YRJ A;  4H2U A;  2ARU A;  3QTC A;  2E9X D;  1D0X A;  5HWX A;  2YK0 A;  3AE4 A;  3EAB A;  4DPG A;  2I4M A;  2JPF A;  2K5B B;  4YJ3 E;  3VKG A;  4O4I E;  1NYQ A;  4JI0 T;  2WMO A;  3P50 A;  3TKL B;  3A31 A;  4X62 T;  1D1C A;  4YRL A;  3U78 A;  3UGQ A;  4YLH A;  2XQ5 A;  2Y6X A;  2UXX B;  2CXF A;  5FXX A;  3DTO A;  3FHN A;  2I4L A;  4WI1 A;  5ABG A;  3RL6 A;  2WWU A;  3N9M A;  4AQY T;  5FXV A;  3UFE A;  3D0T A;  4DBQ A;  3PCO B;  2XUE A;  3GMI A;  4WJ3 M;  3KVA A;  5EZY E;  4H2V A;  4PFO A;  4WW0 A;  3AVS A;  2IHR 1;  1WLX A;  4YTP A;  2WY2 A;  5L47 A;  4EED A;  3VQV A;  3UU6 A;  3PUY F;  4H2X B;  2VVN A;  5AQQ B;  5HCJ A;  5LHG B;  1WLE A;  4G2A A;  3HXY A;  4H2T A;  2E5L T;  3CWZ B;  4C90 A;  2DZC A;  3PUV F;  1KF6 A;  2V6X A;  4JI3 T;  3NRX A;  1NJ8 A;  4WBO A;  1VCS A;  2ARS A;  4CI1 B;  3FZL B;  3ZMU B;  2DHR A;  3TLV A;  4CXY A;  2XM2 A;  4HWP A;  2CXL A;  1SER A;  3PCO A;  5LXT E;  3ZMV B;  4G85 A;  4HKA A;  4DID B;  2NP9 A;  4XTZ A;  4QHO A;  3R6N A;  5C53 B;  1YD8 G;  3SRZ A;  3LC0 A;  2CJ9 A;  4UVC B;  4H2X A;  4LF7 T;  2BBJ A;  3LK3 B;  4G84 A;  3FB2 A;  5KDM C;  2KIN B;  2XQA A;  2Q5H A;  1KMM A;  1G8X A;  3JAE A;  1KK7 A;  2A8E A;  5AFU L;  2Q5I A;  3CKD A;  2FJE A;  2WDR A;  4YSX A;  3NVO A;  2YOE A;  2XHE B;  4AXP A;  5FY1 A;  5FYM A;  3AEE A;  2A3D A;  2X9W A;  3P8V A;  4HWF A;  3ZT6 A;  4TVW A;  1KNP A;  2D0U A;  5J2T E;  2ZMA A;  2V7L A;  2A72 A;  3CVR A;  2V7M A;  3RGL A;  1OED C;  4EYY R;  2FBW A;  3UU5 A;  1IBM T;  4EZH A;  3Q5X A;  5J0Z A;  1XMQ T;  3IAL A;  1SA0 E;  2ZM2 A;  4MHC A;  3CQG B;  3RYI E;  4UV9 B;  4LF6 T;  3ONL C;  4Q15 A;  5LHI B;  2HPJ A;  3ZJ2 A;  2J47 A;  3HL6 A;  4YRM A;  4IE7 A;  3KBU A;  4LFA T;  4ZEY A;  3AA0 B;  4TWA A;  3DSQ A;  4XEM A;  3ZMZ B;  1YKH B;  4IE4 A;  3V7R A;  4TVA B;  3OPC A;  4ZTZ B;  2KWH A;  2HPL A;  2RP4 A;  4NUV A;  3Q5W A;  1ATI A;  4HEA A;  2ZT6 A;  1GGM A;  3ZSS A;  2A9U A;  3E22 E;  2CCQ A;  2DNX A;  2ZXF A;  3RIR A;  3I9Y A;  3AE2 A;  1E24 A;  2XAH B;  1O3X A;  4H63 V;  4KHZ F;  1YFR A;  2VQE T;  2W62 A;  2EJF A;  1UK5 A;  3HKB E;  4JI1 T;  3AAI A;  2I6H A;  4PJJ A;  1W0A A;  4U7Y A;  2W67 A;  2DU5 A;  4YRQ A;  1L0W A;  3WQZ A;  3V8L A;  5LCY A;  3VHL A;  4DMW A;  4M1P A;  2NW9 A;  2LM2 A;  2ZR2 A;  3HFZ A;  4H9O C;  3NRY A;  1D0Y A;  2QVA A;  4AQG A;  4GYS A;  4AKH A;  3HFV A;  3H37 A;  2BKO A;  5JH7 E;  4IE0 A;  2FJA A;  4NUU A;  2EJG A;  3M3Z B;  3KV9 A;  2E1H A;  2ZT7 A;  3ZN0 B;  4DR3 T;  1E1H B;  1JJC B;  3WAJ A;  2WZI A;  3A5Z A;  2JRK A;  3CX8 B;  3S4U A;  3V5S A;  5AQP B;  4ILC A;  3T1Y T;  3E08 A;  1NYR A;  1ZHC A;  4TUY E;  5HXS A;  4K86 A;  4CS3 A;  4JBW F;  1HS7 A;  4OYK A;  2V7K A;  3TLS A;  3WI3 A;  2XSA A;  3KIN B;  3AA6 B;  4O4J E;  3N9L A;  3UUL A;  2ZZF A;  2I4O A;  1USY C;  1J5E T;  2LE8 A;  1FEW A;  1R8I A;  3OYZ A;  2XY8 B;  2ZM0 A;  4NXM T;  3QC9 A;  2DTO A;  4CH6 A;  1JJC A;  1WQW A;  4A56 A;  3ZMS B;  4YRO A;  2YEV C;  4YSZ A;  2CGH A;  2E3C A;  1B70 B;  1VRB A;  2P9B A;  2QYW A;  1HTJ F;  3N2G E;  2YDQ A;  1MMN A;  4UXN B;  1BR0 A;  2V8S V;  2BG9 B;  3VR8 A;  1AJ3 A;  3PUA A;  2DQ3 A;  3VQY A;  5JDM A;  3PUW F;  3QB5 K;  1V9D A;  1D1B A;  3VQX A;  3LDQ B;  4PK4 A;  2V7J A;  3RQW A;  3PTR B;  4QX7 B;  4X5T A;  2MTQ A;  1U5P A;  4YRK A;  4G63 A;  4U72 A;  2WP9 A;  4LVL A;  4EO4 A;  3Q5D A;  5HXR A;  3AAA B;  4DV7 T;  4JLE A;  3RKO A;  2BS4 A;  1B70 A;  4YRN A;  1Z0P A;  2EJ9 A;  4K88 A;  2QHV A;  2EWN A;  2PMF A;  2N1G A;  5J1G A;  3C64 A;  1W0B A;  2F4V T;  1X54 A;  4P71 C;  4DR4 T;  4AIU A;  1MIV A;  4YRE A;  2WCA A;  3LJC A;  1EZ3 A;  4YRC A;  4QWN B;  3KV6 A;  1BBW A;  4LNS A;  2XM1 A;  3ZT7 A;  4YP0 A;  2VKO A;  1E22 A;  4H9R C;  2CHN A;  3L2Z A;  5HEJ A;  2PME A;  2QHS A;  2V1D B;  3QNE A;  2L3L A;  3ETV A;  5E3I A;  2HHH T;  4O2A E;  5J2U E;  3NZP A;  2VB6 A;  4U74 A;  4YHH T;  1MMG A;  4HWI B;  1LVF A;  3UUX B;  3C4X A;  2PG8 A;  2XQ3 A;  1SUM B;  3AEA A;  2EHO C;  4Q6G A;  2VL0 A;  3KV5 A;  3MF1 A;  3HRK A;  1Y64 B;  4PJM A;  3HKE E;  4HA8 A;  3FXE B;  4EEB A;  4UV8 B;  4DR5 T;  5JVD E;  3P4P A;  2E9X C;  4FJO A;  2XZE A;  5LG4 A;  3J9X 1;  4KBM B;  3RH3 A;  2WU2 A;  3VR9 A;  4PK5 A;  4EOZ B;  1IAP A;  1KEY A;  5H6Q B;  3L1A A;  3OVU A;  2XQ8 A;  5C8Y E;  3IG2 A;  4ILA A;  4WJ4 A;  2P5I A;  4LML A;  5F8P A;  1FMV A;  2H88 A;  2H7V C;  2X9X A;  4ZS2 A;  3GWH A;  3RIU A;  1UGO A;  3LSQ A;  3F2E A;  3LBX B;  2QHU A;  4U31 A;  3M65 A;  3W3S A;  4KI0 F;  4BJM A;  3UT5 E;  5LHH B;  4NXN T;  3FZF B;  3ZYM A;  3HKC E;  3ZN1 B;  5AQL B;  3AEB A;  3ONJ A;  3RPU A;  3CPZ A;  1B7Y B;  4LFB T;  2MBG A;  2D9D A;  1IBK T;  3ZC0 A;  3MJX A;  1YQ3 A;  3QK6 A;  5LGT B;  4YHJ A;  2FJB A;  2E10 A;  2ART A;  2ZLY A;  5JRC A;  3F57 A;  5H6R B;  2M67 A;  4U3C A;  5AQV B;  4A5X A;  4TTV A;  3BK9 A;  4ZI7 E;  5DAB A;  3SS1 A;  2AMC B;  5CA1 E;  2ES0 A;  3O1I A;  3LBX A;  5AQM B;  2JMK A;  4YDQ A;  4F8H A;  4AIS A;  3IHR A;  4DUY T;  4CS2 A;  2HH7 A;  4WYV A;  5FY0 A;  4DV4 T;  2WQY A;  2PJQ A;  1B7Y A;  3MA9 A;  3ZCI A;  5KNN A;  3JAD A;  1EVL A;  2WWV A;  4TNW A;  4LVK A;  5AQT B;  3E9H A;  2CHO A;  3H3A A;  2BBH A;  2WDV A;  2HN2 A;  3SOL A;  2YKS A;  2WM9 A;  2LRK A;  5FKY A;  3MZK B;  5L4H A;  3UU4 A;  3P4W A;  4YTN A;  2Z6E A;  3HY1 A;  2Q9Q C;  5HEH A;  5HXC A;  1SE7 A;  5KX5 E;  2QHT A;  3HY0 A;  3V8K A;  2RA1 A;  2IY5 B;  2AMC A;  4I4T E;  2XAJ B;  1UX4 A;  4YTM A;  3HKD E;  3P8C D;  2H89 A;  2AKW B;  2MYS A;  2VAS A;  4X65 T;  5HEO A;  2XTL A;  3ESL A;  3MXZ A;  1Z8U A;  1WR0 A;  2M6B A;  4L9I A;  3IBP A;  4AI6 A;  3ZYL A;  3W15 B;  4QH4 A;  3RAC A;  3UTK A;  4WBN E;  3PUS A;  1FYF A;  4YCV A;  3HXX A;  3MQZ A;  2NW7 A;  3A74 A;  1HNX T;  1D1A A;  1RIQ A;  4HWH A;  5LGU B;  1IL2 A;  2D5U A;  5LB7 B;  3IF8 B;  2IY5 A;  1WU7 A;  1WR6 A;  5AQK B;  2X67 A;  2AKW A;  3RC3 A;  1Y01 A;  5FVL A;  3PJA J;  3N2O A;  3NWI A;  1HNW T;  2K3W A;  2LSK A;  3P8Y A;  1T98 A;  2SPC A;  2J1D G;  2ZM8 A;  4YPF A;  5ELN A;  1MIW A;  1J1J A;  3Q9D A;  3UGT A;  2VL8 A;  1FIO A;  5CB4 E;  2DWK A;  2DDZ A;  3NKZ A;  3O1H A;  5AQS B;  2M6I A;  4XU3 A;  1M62 A;  4UEL A;  3AE5 A;  4CXW A;  3WAK A;  2X51 A;  4DMV A;  2KMF A;  2L9Q A;  2DU7 A;  2YDS A;  2WSS V;  3BQL A;  3G06 A;  3VBB A;  2G4C A;  2XQ4 A;  5FNV E;  1VCT A;  4KUM B;  1E7P A;  5FXZ A;  2NW8 A;  3FXD B;  2UUC T;  2WBL A;  4JUY A;  3C50 A;  3MK7 C;  4UP9 A;  2ODR C;  1X2G A;  3K3Q C;  3AVR A;  1BR2 A;  4YRT A;  1SHZ C;  3ONX A;  1T7S A;  5ABH A;  1N32 T;  1G73 A;  3OKQ A;  2W66 A;  4ERR A;  2X0L B;  1EVK A;  1KNR A;  4X1K E;  1CUN A;  3ERR A;  4QH5 A;  4MLK A;  5C2T A;  2YDR A;  4MBQ A;  2C7I A;  1J5W A;  2BS2 A;  3EUH A;  3CK6 A;  3P7I A;  2LSI A;  3BJU A;  4P75 C;  4BW9 A;  1MMD A;  3UUB A;  4EYU A;  1ADY A;  1NJ2 A;  3ZT5 A;  3PUX F;  4NCX A;  4NIQ A;  3HXW A;  4ILU A;  4H9N C;  5ELO A;  3JAF A;  2DQ0 A;  3K8P C;  2WMN A;  3OTO T;  4H9S E;  4HGA A;  1H4S A;  5LJM A;  3I7F A;  4JV5 T;  3DJB A;  1XNQ T;  2W4X A;  4O2B E;  1H4T A;  3ZJ1 A;  5LG3 A;  1D0Z A;  3LK2 B;  1G5I A;  5FP3 A;  2E41 A;  3ZC1 A;  1YB3 A;  3HFZ B;  2BKN A;  5AQI B;  1LYL A;  2XQY A;  4U2Z A;  3FBZ A;  4AKL A;  3MKD A;  5L3C B;  4ZXL A;  1HCI A;  4X1Y E;  2E5V A;  5CA0 E;  2Q7H A;  4CH5 A;  4ZHQ E;  1B76 A;  4XAX B;  4QXC B;  3AE9 A;  5FXW A;  3A5X A;  2KXP B;  4A98 A;  4ZI2 D;  4JI6 T;  2JQK A;  1MIY A;  5JDF A;  2LEH A;  3JC6 D;  3NEN A;  1YW0 A;  5DJQ C;  4L0R A;  2XAQ B;  4HT4 A;  2VK9 A;  12AS A;  2LRL A;  4P72 A;  3LSS A;  4CQI A;  4XU2 A;  2VKH A;  4WF2 A;  5JR9 B;  1WRD A;  3IA3 A;  2AXD S;  1N9W A;  1EFW A;  4JI5 T;  4HWR A;  4LF8 T;  2K9A A;  4DR7 T;  2JQ9 A;  5AQN B;  5AQJ B;  3QO8 A;  4DV3 T;  1KMN A;  3AEF A;  2HN1 A;  5EK2 A;  2VQF T;  4AQF C;  2C5I T;  2CLY B;  4P1N A;  3SFE A;  4KHP T;  3IEE A;  4LVI A;  3NBX X;  2DWG A;  1SES A;  5FL1 A;  2Q7E A;  2E2A A;  2YN6 A;  4HFE A;  5AQH B;  3RIF A;  4UVA B;  3F31 A;  1UUR A;  4I0U A;  2RPA A;  5JR9 A;  3ZCJ A;  1BBU A;  3TEH A;  4AKR B;  2LKH A;  3N9Q A;  2I0M A;  2EAY A;  4CXX A;  2WDQ A;  4O2D A;  1YXR A;  4EAH A;  4ZI3 C;  4TNV A;  2EHO B;  2Q7G A;  5FMN A;  3RYF E;  2PTF A;  2D0T A;  4YCU A;  3BFM A;  2WS3 A;  4XEO A;  2LOP A;  2IIU A;  1LVK A;  1XMO T;  4FI5 A;  4HFD A;  4TV9 E;  4XTV A;  2ODV A;  3CIR A;  3TLW A;  4YCW A;  2P0L A;  2DXU A;  2WB5 A;  2K24 A;  2RHS A;  4H9Q C;  1YQ4 A;  2BKP A;  3PV0 F;  5L3B B;  3CMQ A;  4ZOL E;  2CA5 A;  1OED E;  2KND A;  4OFZ A;  2OV9 A;  4DV5 T;  4P3N A;  3VQW A;  3E0Z A;  4EXT A;  2XJ7 A;  3I0O A;  2I4N A;  2XAF B;  1WNL A;  3ZLI A;  1FJG T;  4IDN A;  3FZM B;  2IML A;  1N34 T;  2EHO A;  4QX8 B;  3NZQ A;  1ZKE A;  4ZZC A;  1X55 A;  5HGQ A;  3PZC A;  3O1J A;  4IL4 A;  3KFW X;  4IDO A;  2DTI A;  4Z91 A;  2L8K A;  5LJN A;  5LNK A;  1IJ5 A;  3K3O A;  2WU5 A;  4O4L E;  2E9X A;  4CH3 A;  2X9Y A;  3PUZ F;  4GK0 E;  2ZT8 A;  1FMW A;  1HG2 A;  4B3T T;  3TEG A;  4ZZB A;  2CBJ A;  2JMH A;  2X0H A;  4HN9 A;  3AE1 A;  3A5Y A;  1US7 B;  2C0S A;  3K1S A;  4XTX A;  5LP6 E;  2LSJ A;  1ZEE A;  5L3G B;  3RC8 A;  3N5L A;  3G1Z A;  1HR0 T;  3EAM A;  4YFS A;  2ALY A;  2LOS A;  4LVJ A;  2CWY A;  4Q25 A;  2MPK A;  3RI5 A;  2MAW A;  1X01 A;  1IBL T;  1HNZ T;  3A7M A;  1JNR A;  4LF5 T;  4DV2 T;  4Z8X A;  3VU7 H;  4GOU A;  2WAU A;  1KFY A;  4YRP A;  3ANW A;  4ILB A;  5GON E;  4YY3 T;  1E2A A;  4P73 C;  5F5W A;  2LHR A;  2LT3 A;  2DL1 A;  3EDU A;  5IUX A;  4P3O A;  3PE0 A;  1LKX A;  4UR9 A;  3UUN A;  4KP3 C;  5EK4 A;  4RDX A;  2IDO B;  11AS A;  1NNH A;  2ZTG A;  2QA7 A;  2X68 A;  4IRE A;  4UIG A;  1GQE A;  5JDH A;  4AKI A;  1N36 T;  3RQU A;  1HG5 A;  1T72 A;  2Q9Q B;  3A32 A;  1ZP0 A;  3UH0 A;  2R6G F;  3A7U A;  4OP0 A;  2ZIN A;  4HFC A;  4H02 A;  4KX6 A;  4RQE A;  5ETW A;  4LF9 T;  4K87 A;  4HWO A;  2RHQ A;  4K0U A;  3U3I A;  3AE6 A;  1H4Q A;  4TWD A;  4KR3 A;  5ADX L;  1EOV A;  1W66 A;  4YRR A;  4UVB B;  5HEG A;  4P74 C;  4PW8 A;  5JRC B;  4IE6 A;  3OBV E;  4DQ2 A;  1Z7N A;  3N9O A;  1W09 A;  3L3P A;  3AEG A;  3RYH E;  3RYC E;  3QOF A;  2BG9 C;  5AQU B;  3RKW A;  4IGU A;  2Q9Q A;  1HTT A;  2UUA T;  4LMK A;  3P4R A;  5LOV E;  1WFD A;  2CJA A;  3RIA A;  1QUU A;  4U2Y A;  5JDN A;  3RLF F;  1L0V A;  2D2S A;  2V26 A;  4PHC A;  2W63 A;  3AA1 B;  3AE8 A;  1PYS A;  1CHU A;  3RKY A;  2XQ9 A;  4HFV A;  2W0G A;  4K0K T;  4TN7 B;  4O4H E;  2XAS B;  1X2H A;  2HNI A;  3HTZ A;  2LJL A;  4XU0 A;  1E1T A;  2VKJ A;  4J2C A;  4UEM A;  1ASZ A;  2XSB A;  4H63 H;  1OWA A;  2C5J A;  1KNZ A;  3PJA A;  1VQZ A;  5FY7 A;  2UXD T;  2IC9 A;  5HYA A;  3C98 B;  3N2K E;  2CMR A;  1HX1 B;  3AE7 A;  4ANJ A;  4CN1 A;  2ACZ A;  3X1D A;  3E9I A;  2J4G A;  3UQ4 A;  5L3E B;  4B6X A;  5BR8 T;  2QGS A;  3M4P A;  2J3M A;  4HVC A;  2JIW A;  5JTG A;  3ETU A;  2VWA A;  4DO0 A;  2ZZE A;  4P3P A;  4JEU B;  3AXJ A;  5HXE A;  4EX5 A;  4TV8 E;  4WNK A;  2EHO D;  2XQ6 A;  4HWT A;  5FVK A;  1MNE A;  2DJZ A;  4CS4 A;  1ASY A;  1WYC A;  4PJN A;  4MFR A;  4IDQ A;  4QXB B;  1H4V B;  3C4Z A;  3A7R A;  4YSY A;  5LMN T;  3OYX A;  5HEU A;  1OED B;  4P0B A;  2J62 A;  4TVY A;  4HWS A;  3VKH A;  4CI2 B;  4BWA A;  3KFU A;  2UUB T;  5AQO B;  4PJL A;  5AQG B;  4X1I E;  4KR2 A;  4IDZ A;  5L3D B;  4JI8 T;  1T8B A;  2C8M A;  2LM9 A;  2B76 A;  3CML A;  4HWD A;  2FYK A;  1QE0 A;  2E5A A;  4GYR A;  1XZY A;  3EDV A;  2LLY A;  1QSD A;  1NEK A;  4PFP A;  5C3J A;  1WYD A;  1XNR T;  5LGN B;  2GK9 A;  4LF4 T;  2V7I A;  1XDO A;  4DND A;  5E0O A;  5JRE A;  4DUZ T;  4GKJ T;  4IDP A;  4DV1 T;  5CJ5 A;  2X9H A;  4P75 A;  1OED A;  2CRB A;  3SFD A;  3UFG A;  4TX5 A;  4ZS3 A;  3AAE B;  4HFB A;  1YFS A;  4U7I A;  3ABV A;  1IZN B;  3HRI A;  1X56 A;  5JDL A;  5LBQ B;  3AE3 A;  1WPY A;  4B3S T;  2OA5 A;  3PU3 A;  3Q5E A;  2BG9 E;  3GN5 B; 
#chains in the Genus database with same CATH homology
 1B70 A;  4YRN A;  3NEN A;  1QF6 A;  2EJ9 A;  4HT4 A;  12AS A;  4K88 A;  3NET A;  2QHV A;  4P72 A;  2EWN A;  3LSS A;  2PMF A;  4XU2 A;  5C52 B;  4WF2 A;  1X54 A;  4P71 C;  2XGT A;  1N9W A;  1EFW A;  3FJP A;  4YRE A;  4HWR A;  3R07 A;  4TQD A;  1Z7M A;  4H2W A;  4YRC A;  1BBW A;  4YRF A;  4ZTU B;  4LNS A;  4YP0 A;  4RQF A;  3QO8 A;  1SRY A;  1KMN A;  1HC7 A;  1E22 A;  3L2Z A;  2J3L A;  2PME A;  2QHS A;  2XTI A;  3QNE A;  4J15 A;  4XTY A;  4LVI A;  3RUX A;  2ZNJ A;  4OLF A;  1SES A;  2Q7E A;  5E3I A;  4XTU A;  2ZT5 A;  4UP8 A;  4X5O A;  1EIY B;  4UPA A;  1BBU A;  3TEH A;  4UP7 A;  4YRI A;  4YRJ A;  4H2U A;  2ARU A;  3QTC A;  2ZCE A;  2EAY A;  4YRS A;  4O2D A;  4DPG A;  1BIA A;  2I4M A;  4Q6G A;  2Q7G A;  4H2S A;  3MF1 A;  3HRK A;  1NYQ A;  4YCU A;  3BFM A;  4HA8 A;  1KOG A;  4XEO A;  2DVE A;  3A31 A;  3REX A;  4YRL A;  4XTV A;  1ADJ A;  3UGQ A;  4YCW A;  1BIB A;  2P0L A;  2DXU A;  3TUP A;  2RHS A;  3L1A A;  3CMQ A;  5K1X A;  4LVM A;  4XU1 A;  3IG2 A;  2I4L A;  4WI1 A;  3RL6 A;  4WJ4 A;  2P5I A;  1EIY A;  4P3N A;  3V7C A;  3VQW A;  4YYE A;  2I4N A;  4CH4 A;  3PCO B;  3LSQ A;  4WJ3 M;  1WNL A;  2QHU A;  3A7A A;  1USY A;  1X55 A;  5HGQ A;  3W3S A;  4H2V A;  3PZC A;  2DTI A;  3VQV A;  2ZIM A;  4H2X B;  1B7Y B;  1WLE A;  4CH3 A;  3HXY A;  4H2T A;  2ZT8 A;  3TEG A;  2DZC A;  3TEH B;  3A5Y A;  4XTX A;  2E10 A;  1NJ8 A;  2ART A;  3G1Z A;  2ARS A;  2ALY A;  4LVJ A;  4TTV A;  4HWP A;  1SER A;  3PCO A;  2AMC B;  2DZ9 A;  1X01 A;  4G85 A;  4YDQ A;  4TVA A;  4PG3 A;  4CS2 A;  4XTZ A;  2ODR D;  5C53 B;  3LC0 A;  3M4Q A;  2CJ9 A;  4YRP A;  2RHS B;  4RMF A;  4H2X A;  3V7S A;  1EQR A;  4P73 C;  1B7Y A;  2EL9 A;  4L87 A;  2NS6 A;  5KNN A;  5F5W A;  4G84 A;  1EVL A;  4P3O A;  2Q5H A;  1KMM A;  4ZIB A;  1NJ6 A;  4LVK A;  4RDX A;  3E9H A;  1WQ7 A;  2A8E A;  11AS A;  1G5H A;  2Q5I A;  1NNH A;  2ZTG A;  4P71 A;  4TQF A;  3HY1 A;  3NEL A;  3P8V A;  2QHT A;  3HY0 A;  3V8K A;  3A32 A;  1G51 A;  1B8A A;  2IY5 B;  2AMC A;  4TVW A;  2CJB A;  2ZIO A;  3UH0 A;  3A7U A;  3RGL A;  4OP0 A;  2ZIN A;  3QO5 A;  4H02 A;  2AKW B;  4RQE A;  3EFS A;  2CIM A;  4K87 A;  4HWO A;  3IAL A;  2RHQ A;  3MEY A;  4P73 A;  1H4Q A;  3L4G B;  4KR3 A;  3RAC A;  1EOV A;  1W66 A;  4YRR A;  4P74 C;  4Q15 A;  1FYF A;  4YCV A;  4DQ2 A;  1Z7N A;  3HXX A;  1SET A;  2ALY B;  3MQZ A;  4YRM A;  4P72 C;  3A74 A;  4TWA A;  3DSQ A;  1YGB A;  4XEM A;  1RIQ A;  3RKW A;  3V7R A;  1IL2 A;  4TVA B;  4ZTZ B;  3HXU A;  1HTT A;  1NJ5 A;  1ATI A;  2IY5 A;  2E64 A;  1WU7 A;  4KQE A;  2ZT6 A;  2CJA A;  1GGM A;  3RKX A;  2AKW A;  4E51 A;  2ZXF A;  3RIR A;  4PHC A;  1E24 A;  1PYS A;  1E1O A;  3RKY A;  3P8Y A;  1YFR A;  2EJF A;  4YPF A;  3L4G A;  3OD1 A;  5ELN A;  2ZNI A;  3UGT A;  1X2H A;  2HNI A;  3HTZ A;  1NJ1 A;  2DDZ A;  4XU0 A;  4AH6 A;  1E1T A;  4P74 A;  4XU3 A;  1ASZ A;  2DU5 A;  4YRQ A;  1L0W A;  3WQZ A;  3V8L A;  1VQZ A;  5C51 B;  2DU7 A;  3V8J A;  3VBB A;  2G4C A;  2ZR2 A;  3HFZ A;  2E65 A;  3EFR A;  2RHQ B;  3HFV A;  3E9I A;  4UP9 A;  2ODR C;  1X2G A;  2EJG A;  1C0A A;  4YRT A;  2ZT7 A;  2E1H A;  1JJC B;  3M4P A;  2J3M A;  3A5Z A;  4HVC A;  1EVK A;  2DTH A;  2DKG A;  1NYR A;  2ZZE A;  4P3P A;  3ERR A;  4EX5 A;  4K86 A;  3ICA A;  2ZGW A;  4CS3 A;  4XTW A;  2C7I A;  4CS4 A;  3RF1 A;  4HWT A;  2DJZ A;  1J5W A;  1ASY A;  3BJU A;  4P75 C;  4BW9 A;  1H4V B;  3A7R A;  3NEM A;  1ADY A;  1NJ2 A;  2ZZF A;  4TVY A;  2I4O A;  4HWS A;  1USY C;  4NCX A;  4BWA A;  3HXW A;  1PYS B;  3KFU A;  3HXZ A;  3QO7 A;  5ELO A;  2DEQ A;  2DQ0 A;  4KR2 A;  2DTO A;  4CH6 A;  2DXT A;  4YRG A;  1WQW A;  1JJC A;  2C8M A;  4YRO A;  1H4S A;  3I7F A;  2CGH A;  2E3C A;  1B70 B;  2FYK A;  1H4T A;  1QE0 A;  2E5A A;  3MF2 A;  4H2Y A;  1G5I A;  1WYD A;  1HXD A;  2E41 A;  2ZR3 A;  1YB3 A;  2DQ3 A;  3IKM B;  3HFZ B;  3VQY A;  3IKL A;  1LYL A;  1YFT A;  4P75 A;  3HXV A;  3UFG A;  3VQX A;  2Q7H A;  3P8T A;  4CH5 A;  1YFS A;  5K1P A;  1B76 A;  4YRK A;  3HRI A;  2ZZG A;  4LVL A;  1X56 A;  4EO4 A;  1WPY A;  3REU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...