1J5WA

Crystal structure of glycyl-trna synthetase alpha chain (tm0216) from thermotoga maritima at 1.95 a resolution
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
281
structure length
276
Chain Sequence
b'MYLQDVIMKLNDFWASKGCLLEQPYDMEVGAGTFHPATFFGSLRKGPWKVAYVQPSRRPTENPNRLQRYFQYQVIIKPSPENSQELYLESLEYLGINLKEHDIRFVEDNWESPTLGAWGVGWEVWLDGMEITQFTYFQQIGGISLKDIPLEITYGLERIAMYLQGVDNVYEVQWNENVKYGDVFLENEREFSVFNFEEANVGLLFRHFDEYEKEFYRLVEKNLYLPAYDYILKCSHTFNLLDARGAISVSQRQTYVKRIQAMARKAARVFLEVQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycyl-tRNA synthetase alpha chain
publication title Crystal structure of Glycyl-tRNA synthetase alpha chain (TM0216) from Thermotoga maritima at 1.95 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Ligase
total genus 95
structure length 276
sequence length 281
chains with identical sequence B
ec nomenclature ec 6.1.1.14: Glycine--tRNA ligase.
pdb deposition date 2002-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.180 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Class II aaRS and biotin synthetases; domain 2 1j5wA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1j5wA01
2PMEA 1YFRA 1Z7MA 4XU3A 1NYRA 4P73A 3A5ZA 4YCUA 1YB3A 4CH4A 2ZT6A 4P71A 3TEGA 4P3OA 2Q7EA 5C52B 4YROA 4AH6A 2P0LA 2ALYB 2ZGWA 2I4OA 1X56A 4TVAB 2C8MA 1E22A 3NEMA 2Q5HA 2Q7HA 3UFGA 3RKXA 1NJ1A 3QO7A 3RL6A 1VQZA 3A31A 4ZTUB 4PHCA 1SRYA 1B70A 4H02A 3HFZA 2ZCEA 1KOGA 1B76A 3M4PA 1ASYA 1NYQA 2ZT5A 2DZ9A 1H4VB 2EJ9A 4LNSA 1BBUA 2EWNA 2CGHA 1X01A 4YRLA 3VBBA 2PMFA 4K88A 1HTTA 3L1AA 2ZINA 3V7RA 4EO4A 4HWPA 1SERA 2DJZA 2EJFA 3TEHB 4YRKA 4WJ4A 3TUPA 2AKWA 3MF2A 4H2SA 4J15A 1HC7A 3HXYA 4RDXA 4X5OA 1LYLA 4RMFA 1NJ6A 3BJUA 4H2YA 1EVKA 3QO8A 1NJ8A 1QE0A 3EFSA 2AMCB 4UP9A 1KMMA 1B70B 2Q5IA 4OP0A 3HY1A 4YCWA 2E3CA 4KQEA 4YDQA 1EOVA 4Q6GA 3HRIA 2CJ9A 3HY0A 3LC0A 3MF1A 2ALYA 4CH6A 4TVYA 1X2HA 1SETA 4TVAA 3V8JA 3HXZA 5ELOA 3ERRA 3M4QA 2DEQA 4HA8A 1USYA 5ELNA 2ZZFA 4WJ3M 4K87A 4YP0A 4CH5A 4YRFA 3RACA 3V7SA 3RIRA 1N9WA 2DTHA 1EVLA 5HGQA 2ZIOA 3A74A 3HFVA 1WU7A 4CH3A 2I4LA 1WLEA 2ZZGA 4KR3A 3FJPA 4YRTA 4KR2A 3RF1A 2E41A 4BWAA 5K1PA 3TEHA 1E24A 4P74C 2CJBA 4L87A 4YPFA 1L0WA 3KFUA 3A5YA 1YFTA 4YRGA 1X54A 2RHSB 4WF2A 3V7CA 1G5HA 4CS2A 3QO5A 1EFWA 3RUXA 2P5IA 2HNIA 4OLFA 2AMCA 2J3LA 4TQFA 1YGBA 2ODRD 1WNLA 1EQRA 3RKWA 1X55A 4P75C 4P72C 1BBWA 2EAYA 2DU7A 4YRIA 3P8VA 3QNEA 4G85A 2ZXFA 2EJGA 4YRPA 1RIQA 1B7YB 4P73C 5C51B 4YRQA 5C53B 1Z7NA 3DSQA 2ZZEA 3E9IA 2ZNJA 4XTZA 4P71C 3NENA 1NJ5A 3NELA 4TWAA 3HTZA 1BIBA 3L2ZA 4YRNA 4HWOA 4HWTA 4BW9A 3VQYA 3MEYA 1EIYB 4RQFA 1WYDA 3HXXA 5E3IA 2DXUA 4YRRA 2ZR3A 3VQXA 1WQWA 4NCXA 2IY5A 3PZCA 2E64A 3PCOA 3E9HA 2RHQB 3L4GB 1E1OA 4XU2A 4XTVA 3A7AA 4ZIBA 2DDZA 4XTWA 4H2UA 3LSQA 1YFSA 3QTCA 3IKLA 4XU0A 4P3PA 1WQ7A 2DZCA 1W66A 2RHSA 2ZTGA 3V8LA 4YRMA 2E1HA 3HXVA 4H2XB 2ARTA 2DXTA 1G5IA 4Q15A 5K1XA 1C0AA 3ICAA 2FYKA 1PYSB 4PG3A 4XTUA 1E1TA 1X2GA 2ZR2A 4RQEA 2IY5B 4P3NA 3HRKA 1B7YA 4K86A 2DU5A 4TVWA 1GGMA 2DTOA 2QHUA 1H4QA 3A7RA 1NNHA 3PCOB 1ASZA 2CIMA 2DKGA 1JJCB 2DVEA 1FYFA 3VQWA 2XGTA 3RKYA 1B8AA 1ADJA 4XTYA 1EIYA 4H2VA 3HXWA 4XTXA 4CS4A 3VQVA 4YRSA 3UGQA 1ADYA 4YYEA 3IALA 4H2WA 4HWSA 2E65A 1USYC 1HXDA 2ARSA 3IKMB 3HXUA 5F5WA 2RHQA 3L4GA 1J5WA 3IG2A 3UH0A 4YRCA 2XTIA 4DPGA 3OD1A 2ZIMA 4XEOA 4DQ2A 4YCVA 4G84A 1G51A 4E51A 2CJAA 2Q7GA 4H2TA 4H2XA 1NJ2A 3I7FA 4TTVA 3RGLA 2I4NA 5KNNA 4XU1A 2E5AA 3P8TA 3LSSA 4UP8A 1PYSA 2DTIA 2ZT8A 11ASA 2J3MA 3WQZA 3REUA 4EX5A 1BIAA 2QHTA 3UGTA 2ARUA 3G1ZA 3P8YA 2DQ0A 1H4SA 3W3SA 3R07A 2G4CA 4UP7A 2ZT7A 3NETA 4UPAA 2QHVA 2DQ3A 3HFZB 3A7UA 4WI1A 1H4TA 1JJCA 4ZTZB 2I4MA 4P74A 2ZNIA 3CMQA 3REXA 2C7IA 4YRJA 3V8KA 2EL9A 3A32A 12ASA 4YREA 2QHSA 4HWRA 1IL2A 4XEMA 2AKWB 4TQDA 4O2DA 1ATIA 4CS3A 3EFRA 2E10A 4HVCA 1KMNA 4P75A 2ODRC 1QF6A 4P72A 1WPYA 3BFMA 1SESA
chains in the Genus database with same CATH superfamily
4YJ3E 2PMEA 4DUZT 3MZKB 4IE5A 3V5UA 1OEDB 1NYRA 3A5ZA 4IE4A 4YTNA 4P71A 5FP3A 2I59A 3TEGA 1KEYA 4AH6A 5AQPB 3O9XA 2ALYB 2ZGWA 3RIUA 1X56A 3RQUA 3P4PA 4ASKA 1N34T 5HCJA 4IL4A 2Q5HA 1NJ1A 5CGMA 1VQZA 3GN5A 3UU3A 4PHCA 2ZCEA 2W61A 2N1GA 5EZYE 3M4PA 1D0XA 2D0TA 4GK5E 2ZT5A 4BAYB 2EJ9A 3UUMA 5AQFB 1M7KA 4LFCT 2NS6A 4B6XA 2CGHA 4DBRA 2K5BB 2WMNA 4K88A 4QHOA 3V7RA 1IBKT 2DJZA 5HWXA 3TUPA 4HFDA 2DL1A 2UXNB 4J15A 4JI7T 1MNEA 1LYLA 4RMFA 2L9QA 4GKKT 1HG5A 5ABGA 2KINB 2YU2A 3PJAA 1M62A 5LHGB 2YN6A 1S94A 3UFEA 3EFSA 3ONJA 1W0BA 2MYSA 2BKNA 1B70B 2BG9B 3UU5A 3AE8A 3HY1A 4HFIA 3RC3A 4IREA 4QH1A 1EOVA 1YQ4A 1VCTA 2CJ9A 2UXXB 3S4UA 3HY0A 3LC0A 4CN6A 5AQHB 2W67A 2CBIA 1SETA 4TVAA 1KNPA 3J7Yq 4Z90A 2XAHB 1B7TA 3ERRA 4PJMA 3M4QA 3TLSA 2EHOA 4C91A 5FVLA 1U4QA 3FZKB 4PK5A 2I0MA 3RC8A 1USYA 4U72A 4DV5T 3ZN0B 4KMCA 4K87A 3NBXX 3PDYA 5J0ZA 3LK2B 4IE6A 3CX6B 4JI1T 5HGQA 2CBJA 2Q9QB 2NP9A 3HFVA 1ZOYA 2NR4A 2W4XA 3KBTA 2X9WA 3OPCA 2WMOA 4YTMA 4KUMB 2HH7A 4YRTA 4P0AA 2OV9A 5HWYA 2NW8A 4MALA 4DR5T 4JI5T 5AFUL 3KFUA 2ZM0A 1YFTA 2DHRA 3EUHA 4DNDA 5FXXA 3ZSTA 3RUXA 1IBLT 2AMCA 2VL8A 5LBMA 1YGBA 5AQSB 3UU6A 2LSYA 4P72C 4O2AE 2W63A 4IIJE 2G0UA 2J47A 3P8VA 2A72A 3RIFA 2XUEA 5CB4E 2W62A 3K1SA 2EJGA 4TN7B 5C51B 4TX5A 4DR1T 5HAXA 3OYZA 5LA6E 5H6QB 2B1EA 3E9IA 2D5UA 4JI3T 4XTZA 4P71C 3NENA 5JDHA 3FZFB 4TWAA 3GWHA 3HTZA 3L2ZA 3PE0A 4V1Av 3RIUC 4RQFA 4Q25A 4U2ZA 3H37A 3HXXA 2VKOA 5L3CB 3P50A 1MMAA 5LCYA 3UULA 5LJNA 4NCXA 3C4WA 3AA7B 2E64A 4LVKA 4UVCB 5HEHA 2RHQB 5FL0A 5AQGB 2DDZA 4XTWA 3IEEA 2KLQA 2DZCA 1MMDA 2A8EA 2V1DB 4YRMA 4UV9B 3HXVA 1YKEB 4YLHA 4OK0A 3NRXA 2D0UA 1MMGA 3AXJA 1UX5A 2E5VA 1EZ3A 3A8YC 3AEDA 3Q9DA 3PUYF 1WCRA 4XTUA 1E1TA 4I55E 2MTQA 1X2GA 2WWUA 2ZR2A 3RQWA 3CX7B 3KV4A 2A3DA 2XPKA 5HXHA 4P3NA 3HRKA 4K86A 4TVWA 2DTOA 4AKRB 3A7RA 3PCOB 2IDOB 4TNWA 2XQYA 5EK2A 3AAIA 4DV6T 4ADZA 4CN4A 2WS3A 3VQWA 4JI2T 1B8AA 1X9BA 2XAFB 2DI4A 2UXDT 2J62A 2JMKA 2VVNA 4LF7T 4O4JE 3RYFE 2EHOC 1HNWT 2V5CA 1USYC 4YY3T 4ZXLA 3ZC0A 3LBXB 3O1JA 2XQ7A 3L4GA 3PUWF 4QWNB 3RLFF 4DPGA 3O4XE 3OD1A 5ABHA 2ZIMA 4PJNA 1ZKEA 4UELA 5LMUT 4L0RA 4LF4T 3CQXC 3SRZA 2WDQA 5KNNA 4LVIA 4TV9E 2KXPB 1PYSA 5KXJA 2LHRA 3KVBA 5FY1A 4TWHA 2J3MA 3REUA 3WQZA 2YEVC 2WQYA 3JAFA 3OTOT 1KNZA 4B3RT 2Y8DA 5FYMA 2G4CA 3GN5B 4ZZCA 1H4TA 4U74A 4O8SA 2WZHA 1T98A 2WCAA 5L47A 4P74A 1SA0E 4MFRA 3C50A 3TLTA 2UUCT 4J2CA 2NW7A 2K3WA 4YREA 2QHSA 4I50E 1IL2A 2WSSV 4HFEA 2OLTA 4O2DA 2Z6EA 3AA1B 4CS3A 5ETWA 2FJDA 1CUNA 4HN9A 2E10A 2E8IA 4HWHA 3UUXB 3TLVA 4P75A 1QF6A 5C8YE 2NTXA 2LJLA 4H9SE 3MXZA 5F3JA 2K9AA 3K3NA 5AQJB 5FMNA 3SWHA 1YFRA 2VKDA 4IE7A 4WW0A 4EV6A 1YB3A 4CH4A 2XQ9A 2X9XA 4JUYA 1SE7A 2ZT6A 3QUJA 1O3XA 4DUYT 5C52B 2Q7EA 4CXXA 3EI0A 4YROA 2P0LA 1HNXT 3GA8A 3FXDB 3SFDA 5HEOA 4TVAB 3PU3A 3L3PA 4UV8B 3HKEE 2EHOB 4A97A 4PK4A 2FJAA 3ETUA 2X0HA 2CWOA 4YSYA 5FXZA 3N2OA 3PV0F 1SRYA 4CXWA 3HFZA 4MHCA 3KV6A 1ASYA 4GKJT 5HYAA 3BQLA 1R8IA 2V8SV 4QH5A 3B5MA 4ZI3D 5M4YA 3VBBA 1XDPA 2RP4A 1HTTA 3L1AA 3CQGB 4EO4A 1SERA 3FB2A 3AEEA 1UX4A 5L3BB 3MF2A 3PUAA 1HC7A 2WZIA 3HXYA 4X5OA 1CHUA 3BJUA 3DP7A 4NUVA 4H2YA 2XAGB 3SOLA 5JDQA 2ES0A 5FXWA 1KNRA 3AE9A 4LFBT 5EK3A 2AMCB 4HFVA 2Q5IA 3LDQB 1GQEA 4C90A 4HE8A 3NKZA 2JIWA 2CXLA 2MOZA 3X1DA 3PUXF 4TVYA 2VK9A 4NIQA 2PTFA 5CFBA 1VRBA 3KV5A 3V8JA 4OYJA 5JREA 2HPLA 4PK6A 2DEQA 3IA3A 5A1LA 4EOZB 3KVAA 5ELNA 5HXSA 4WJ3M 1LVKA 4GK0E 4YRFA 3RACA 4AQYT 3V7SA 2WU5A 3UT5E 2MBGA 1N9WA 4EYUA 1Y01A 2DTHA 5L4HA 2FUPA 1HFAA 1NENA 1WLEA 3CX8B 4EEBA 2V7MA 2ZZGA 2IC6A 4KR3A 4DV2T 4A98A 2Y48B 2BZBA 4LF5T 2V6YB 3ZKRA 4NXNT 4ILBA 3RF1A 4KHZF 2X0LB 2E41A 1OXZA 2WBLA 3TEHA 1E24A 4P74C 4DMWA 4L87A 1E1HB 5ABFA 2NTYA 3A5YA 3PJAJ 2N2NA 1SHZC 2BDEA 3ONXA 1OEDE 3EDUA 2E9XA 1YKHB 3CKDA 5FY7A 3AE7A 2QA7A 3NZQA 3ZYLA 1YD8G 3QO5A 2P5IA 2HNIA 3AXJB 4GYRA 4TQFA 2F4VT 4QH4A 2XAJB 2ODRD 1WFDA 3AEFA 3LFMA 4P75C 2FBWA 2Q9QD 4COFA 5FY0A 1D1AA 2M6BA 3P4SA 3ZPOA 2KNDA 2M6IA 3HKDE 2C0SA 5AQLB 4Z91A 4F6RC 5LB7B 3AE5A 2BBJA 1RIQA 4QX7B 2DLRA 2A2FX 3BQIA 4YSXA 4YRQA 3JCFA 3DSQA 5AQUB 2ZNJA 5JDFA 1NAFA 2JQQA 1NJ5A 1FEWA 4X1YE 5HXCA 4BJNA 1BIBA 3N2KE 3QB5A 4BW9A 3H3AA 3V5SA 2XQ3A 3F31A 4YHJA 2LM2A 5E3IA 5JTGA 1HCIA 3ZJ2A 4E7SA 2ZR3A 4TUYE 2LOSA 4AQFC 4B3ST 3PZCA 5FKYA 3L4GB 3C4ZA 1JNZA 4I43B 4H2UA 4ZZBA 1YFSA 3FZHB 2BVMA 3C64A 2VURA 2BG9E 4XU0A 1WQ7A 3VHLA 3VKHA 3V8LA 3KFWX 3CQCB 2E1HA 3PU8A 4PAGA 2ARTA 1E2AA 3RH3A 4TNVA 5LHIB 4HGAA 1HG2A 5LP6E 1PYSB 4PG3A 5AQTB 1V9DA 4IGUA 4LF9T 3O1HA 3QB5K 4ERRA 2IY5B 3ZSSA 5L3GB 4NUUA 2DU5A 4TZ4C 1GGMA 4AI6A 3P4RA 2BS3A 3NZPA 3VRBA 1NNHA 1ASZA 2PG8A 4ILCA 2CIMA 4DMVA 3ZT6A 1FYFA 3OVUA 2XGTA 3RKYA 4IDNA 2XTLA 3HXWA 4XTXA 5HEJA 4IT4A 3N2GE 3VQVA 1XZYA 3PTRB 1ADYA 4YYEA 5FL1A 5BR8T 4H2WA 2KT9A 4HWSA 2N9DA 4JV5T 1HXDA 2JJ9A 3RI5A 2ARSA 4PJJA 4UEMA 1BR1A 1WLXA 4KBMB 2OA5A 2WDVA 5GONE 3IG2A 3E0ZA 3I1AA 4YRCA 2XTIA 2XQ4A 5JR9A 4PW8A 2UUBT 2JMHA 4XEOA 4DQ2A 4YCVA 2LRLA 5HCMA 2YK0A 2CJAA 4H2TA 4H2XA 5L3DB 1SUMB 1W09A 1NJ2A 2I4NA 2E5AA 3P8TA 4DVDA 2E9XC 3LSSA 4H9OC 4UVBB 2X9HA 2ZT8A 3Q5DA 3CVRA 11ASA 4EX5A 2XM2A 5KX5E 3FXEB 3FHNA 3VR8A 2ARUA 4HFBA 3P8YA 4AKHA 3R07A 4CI2B 3N9QA 4EZ4A 2H7OA 3NETA 4DO0A 2NOXA 2DQ3A 3W15B 2NW9A 3HFZB 3N5LA 3KBUA 1JJCA 1VOMA 4ILAA 1IZNB 2C5KT 3HKCE 2CPTA 1US7B 4PJLA 2AE9A 5J2TE 4WZXA 4YRJA 2X51A 1J1JA 2CLYC 5KMGP 1J5ET 3GMIA 2IMLA 3C4XA 2V7JA 3AE4A 2IUBA 4O2BE 3WI3A 2JPFA 1ATIA 3FZLB 2YDQA 1MMNA 1D0ZA 4KI0F 3I0OA 3EFRA 4LVJA 4WYVA 5LGNB 4YSZA 3JC6C 1WPYA 2V7IA 4EB6E 3ZJ1A 3A5XA 4ILUA 1WR0A 2JQHA 5LGUB 2WAUA 4XU3A 3P4WA 5AQVB 4YCUA 4ZS2A 1VCSA 4CZZB 1WYCA 4L9IA 1MIYA 2XQAA 5AQKB 2J1DG 3AE6A 2M67A 1BR0A 4IDPA 1MNDA 3P4QA 2KMFA 2I4OA 4B3MT 5HXRA 1G73A 5KDMC 3P8CD 4IHJE 5CA0E 4IDOA 1E22A 5LG3A 2Q7HA 3UFGA 3RKXA 3RL6A 2IC9A 1T8BA 4ZTUB 3PURA 3ZT7A 1HNZT 2C5JA 5J1GA 1UUSA 1B70A 2BG9A 4H02A 2IIUA 1MIWA 3H3MA 3ZLIA 1HTJF 5ABEA 3RYHE 4U3CA 3CIRA 4YRLA 2W0GA 4M1PA 2PBIA 2ZINA 2YDRA 3TLWA 1UK5A 4HWPA 2EJFA 3TEHB 2LLYA 4WJ4A 2AKWA 3UUNA 1NWMX 4H2SA 4DV3T 3RRCA 4BJMA 5ABFB 4OFZA 2EHOD 5LYJE 4TWDA 1NJ6A 3ZCJA 2E9XB 3QO8A 4QXCB 2XQ5A 1NJ8A 1LRZA 4ISTA 5JVDE 3CMLA 4HFCA 4UP9A 1KMMA 2AXDS 2YKSA 4YCWA 2H88A 2E3CA 4YDQA 2BS2A 4GYSA 2FJBA 2ACZA 2DWKA 4LMKA 4X1KE 5JR9C 2LOPA 3ZN1B 3MF1A 4KX6A 4X64T 2DWGA 2CCQA 3VR9A 5LHHB 4PFOA 2CLYB 2LM9A 3RKGA 2KSRA 1HR0T 2YINA 1YW0A 5HEGA 4DV4T 5DQVA 4HA8A 4JI0T 4K0UA 3AB3B 5JDLA 4YJ2E 4CH5A 3EHZA 2CM0A 2WY2A 3RIRA 3VU7H 5JDGA 2E2AA 3A74A 4MLKA 2CEAA 4H63V 1ZHCA 3I0QA 3AA0B 4U7IA 3UUBA 4HWDA 3VRAA 1KFYA 3MA9A 4EIWA 4CI3B 5K1PA 2LT3A 4F8HA 1L0WA 3T1HT 3Q5XA 1LKXA 4HFHA 4WF2A 3V7CA 1QUUA 2H89A 4X5TA 4CS2A 3LJCA 2H3RA 2ODVA 4K0KT 5LNKA 4KP3C 3L09A 1WNLA 1EQRA 1D0YA 3RKWA 4G63A 3AEAA 4LMJA 3C51A 2EAYA 3Q5EA 4H9NC 4CN1A 3MJXA 3LSVA 3N9MA 4O4HE 4G85A 2FJEA 2ZXFA 3PUSA 2X9YA 4QXBB 3ANWA 2VKJA 3WAJA 5C53B 4ZS3A 2ZZEA 4XAXB 3KINB 4WNKA 5BMVE 2CHNA 4UF0A 4XZCA 4YRNA 1YQ3A 4HWIB 4O4LE 4HWTA 3ZMZB 3ZYKA 2B76A 1XMOT 3VQYA 2L3LA 3SFEA 2WDRA 1N32T 1WYDA 3UTKA 2PJQA 3N9NA 2BKOA 2JRKA 2DXUA 3E08A 4YRRA 3VQXA 3U78A 3M3ZB 1XDOA 1KF6A 3JAEA 4ZEYA 5DABA 4U33A 2XZEA 3EABA 3PCOA 1E1OA 3QNUA 4XU2A 4XTVA 4JLEA 5JR9B 4EGWA 3M65A 3QTCA 4P3PA 2XASB 5TAOA 1W66A 2RHSA 2ZTGA 4A56A 2MPKA 3OJAA 2YU1A 4H2XB 2W66A 4ZI2C 2A9UA 1G5IA 1MIVA 4JBWF 1OWAA 4E7ZA 3AE2A 3ICAA 2D9DA 2UUAT 3UU4A 5IWAT 1WYBA 2QVAA 3RYCE 2DNXA 5FVKA 2V6XA 3CWZB 1FMWA 1B7YA 3RPUA 2VKHA 4P0BA 5LOVE 1E7PA 3JADA 3WAKA 4XBFB 2CA5A 5L3EB 3DTOA 3HL6A 4H9RC 1Z8UA 3A7MA 3FBZA 1JJCB 2XSAA 2DVEA 2ODUA 1ADJA 2LSJA 2YDSA 1EIYA 4H2VA 4LFAT 2XY8B 4CS4A 4YRSA 1ZP0A 3TKLB 2CXDA 3T8OA 3QOFA 3RRWA 2I6HA 3PUGA 2LSGA 4ZI2D 3F57A 1IBMT 1W0AA 3IKMB 4ZOLE 3HXUA 3AVSA 3FBLA 4KHPT 5DJQC 5F5WA 1J5WA 3ONLC 3UH0A 3RKOA 2IAKA 3K3OA 4X20E 1X79A 2CMRA 5L4EA 2MAWA 2V26A 4AIUA 1G51A 2Q7GA 4HEAA 1BR4A 5HEUA 3QK6A 2ZM6T 5LXTE 4H9PC 3CK6A 3I7FA 4TTVA 4XU1A 1H7CA 4UP8A 4IL9A 3UQ7A 2CRBA 2K24A 2ZMAA 3VKGA 2LSKA 2IW5B 2L8KA 5J2UE 3UGTA 1H4SA 4X66T 3W3SA 4NXMT 2JQ9A 3K8PC 1IJ5A 3A7UA 1N36T 3QC9A 5LMNT 4ZTZB 3FZMB 3REXA 3ZC1A 2C7IA 1N33T 3V8KA 5IYZE 4ISSA 2EL9A 3A32A 12ASA 1DU2A 4AQGA 5AQIB 1UURA 4ZHQE 3HI2A 2VB6A 3AEBA 2AKWB 4TQDA 2BS4A 2D2SA 4OX9T 4NPPA 4HVCA 4U2YA 4DV0T 1NEKA 3ETVA 5AQQB 4DR6T 5JRCA 3ZMSB 2JQKA 1L0VA 3K3QC 5JH7E 4X65T 3T1YT 5LBQB 1Z7MA 4P73A 1IAPA 4TV8E 3OYXA 3LK42 5CA1E 4OYKA 2CXFA 4P3OA 4HT4A 2BVLA 2X0YA 1T72A 5L3FB 1LVFA 3IBPA 2C8MA 4YFSA 3NEMA 4WBOA 4HKAA 3QO7A 3PUZF 2HN1A 4EXTA 3G06A 5LJMA 3A31A 4JEUB 3KDSE 3RX6A 4CI1B 2VQFT 4X62T 2XJ7A 1KOGA 3P7IA 1B76A 2QGSA 4TWFA 2ZM2A 5IHYA 1NYQA 2DZ9A 1H4VB 2CWYA 5AQRB 4LNSA 1BBUA 2EWNA 5AQOB 1X01A 4FJOA 2PMFA 5IUXA 1W9RA 3EDVA 5CJ5A 3RHWA 4YRKA 5F8PA 4IE0A 5HXEA 3D0TA 4EZHA 4RDXA 2ZLYA 3AE1A 3CPZA 3AE3A 3PUVF 3UU8A 1EVKA 1BR2A 2WWVA 1QE0A 2XM1A 3EAMA 4AXPA 5JDNA 4YHHT 3NRYA 4A5XA 1OEDA 4OP0A 1JNRA 4QXHB 4KQEA 3AECA 4Q6GA 3HRIA 5JQGE 2V6YA 1D1BA 1HX1B 4EYYR 1WRDA 3B57A 3ZMUB 4U31A 2ALYA 3ANWB 4CH6A 2KZ7B 4I4TE 2RA1A 1X2HA 3AAAB 3B13A 4UF0B 3HXZA 1FIOA 2K48A 4UIGA 5LG4A 5ELOA 2E5LT 4LF6T 2E9XD 1YXRA 3ZT5A 3HKBE 2J4GA 4UR9A 2ZZFA 4HWFA 2LEHA 3ZEFB 4YP0A 3AA6B 4QKNA 3DJBA 1HS7A 2ZM8A 4CQIA 1EVLA 2QYWA 3O1IA 2X67A 2ZIOA 1Z0PA 1WU7A 4YT0A 4CH3A 2I4LA 3I9YA 4DBQA 2UU9T 3ZMTB 1U5PA 3FJPA 4OHFA 2WB5A 4P09A 4KR2A 4IDQA 4BWAA 3BK9A 1FMVA 3N9PA 1T7SA 2X66A 2CJBA 4YPFA 2VASA 4JI4T 3UQ4A 4YRGA 4DR3T 3AVRA 2CE7A 1X54A 2RHSB 4H63H 4CXYA 1XNQT 3Q2MA 4LVLA 1G5HA 4LMLA 2RPAA 5FNVE 2SPCA 3ZMVB 2XQ6A 1EFWA 4OLFA 4JI8T 2J3LA 3JC6D 3C98B 3OKQA 3BQKA 4B3TT 1X55A 1BBWA 4N78D 5E0OA 2DU7A 4YRIA 4JEHB 3N9LA 3QNEA 4BA9A 4YRPA 1B7YB 4P73C 2YOEA 1Z7NA 1AJ3A 3NELA 4AKLA 4PFPA 4IDZA 3KV9A 4HWOA 4YTPA 2HHHT 3MEYA 2LSIA 1EIYB 3OBVE 2PFVA 4MBQA 5EK4A 4O4IE 3I9WA 2V5DA 1QLBA 2LRKA 5H6RB 1G8XA 2Q9QA 2VWAA 1WQWA 3HR0A 1IJ6A 2IY5A 3MKDA 1QSDA 1ZEEA 2BKPA 4EAHA 2QRXA 3R6NA 3ZYMA 3E9HA 3EVYA 4GIWA 2XSBA 5C3JA 4L5GA 2UXBT 2C5IT 3A7AA 4ZIBA 4U7YA 3LSQA 1HX8A 3IKLA 3MK7C 4I0UA 2KWIB 3NVOA 3RYIE 5ADXL 1HF8A 2DXTA 4PNIA 4EEDA 4DIDB 3ABVA 4UXNB 1XNRT 4Q15A 5K1XA 5LGTB 1C0AA 2FYKA 3MQZA 3N9OA 2WM9A 2VQET 4AISA 2W2UA 2GK9A 3AEGA 4RQEA 1OEDC 4P1NA 2UXCT 2QHUA 1H4QA 1D1CA 1KK7A 2WU2A 3SS1A 3L39A 4LVMA 2IHR1 4DV7T 3J9X1 4ZI3C 1S35A 2DKGA 4DR2T 2NWBA 1WR6A 2P9BA 2Y6XA 1UCUA 4QX8B 4XTYA 2X68A 3PUQA 4ANJA 3AAEB 2H7VC 5FXVA 2VL0A 2V7LA 3UGQA 4YXDA 3IALA 2DCFA 3IHRA 2E65A 4H9QC 3ESLA 1ZV4X 4FI5A 3R84B 2LKHA 2RHQA 5JRCB 2CHOA 4AQFA 3LG7A 3Q5WA 3HA4A 4HWCA 5JDMA 4G84A 4E51A 4UVAB 3RGLA 2ACXA 4X1IE 3F2EA 4AKIA 3L8RA 2DTIA 4LF8T 5AQNB 1UGOA 4GOUA 1I94T 2W00A 2HN2A 3RIAA 2VVSA 1BIAA 2LE8A 1I6ZA 2BG9C 2QHTA 1XMQT 4DR4T 4G2AA 3G1ZA 4AKGA 2DQ0A 4JI6T 4UP7A 2ZT7A 4WBNE 4UPAA 2QHVA 2LHNA 2WP9A 4WI1A 2V7KA 4DV1T 2KWHA 3NWIA 2I4MA 1Y64B 2ZNIA 4JYAT 3CMQA 4Z8XA 2XAQB 5DQWA 2R6GF 3IF8B 3E22E 4HWRA 4XEMA 2LKGA 4DR7T 2XHEB 2XQ8A 3ZCIA 3LBXA 5AQMB 3LK3B 2BBHA 3MACA 3TLUA 1KMNA 2HPJA 1FJGT 2ODRC 4P72A 5L2LA 4HTEA 3U3IA 3BFMA 2Q9QC 1SESA 1XWMA 5C2TA 4ZI7E
chains in the Genus database with same CATH topology
2PMEA 1YFRA 1Z7MA 4XU3A 1NYRA 4P73A 3A5ZA 4YCUA 1YB3A 4CH4A 2ZT6A 4P71A 3TEGA 4P3OA 2Q7EA 5C52B 4YROA 4AH6A 2P0LA 4HT4A 2ALYB 2ZGWA 2I4OA 1X56A 4TVAB 2C8MA 1E22A 3NEMA 2Q5HA 2Q7HA 3UFGA 3RKXA 1NJ1A 3QO7A 3RL6A 1VQZA 3A31A 4ZTUB 4PHCA 1SRYA 1B70A 4H02A 3HFZA 2ZCEA 1KOGA 1B76A 3M4PA 1ASYA 1NYQA 2ZT5A 2DZ9A 1H4VB 2EJ9A 4LNSA 1BBUA 2EWNA 2NS6A 2CGHA 1X01A 4YRLA 3VBBA 2PMFA 4K88A 1HTTA 3L1AA 2ZINA 3V7RA 4EO4A 4HWPA 1SERA 2DJZA 2EJFA 3TEHB 4YRKA 4WJ4A 3TUPA 2AKWA 3MF2A 4H2SA 4J15A 1HC7A 3HXYA 4RDXA 4X5OA 1LYLA 4RMFA 1NJ6A 3BJUA 4H2YA 1EVKA 3QO8A 1NJ8A 1QE0A 3EFSA 2AMCB 4UP9A 1KMMA 1B70B 2Q5IA 4OP0A 3HY1A 4YCWA 2E3CA 4KQEA 4YDQA 1EOVA 4Q6GA 3HRIA 2CJ9A 3HY0A 3LC0A 3MF1A 2ALYA 4CH6A 4TVYA 1X2HA 1SETA 4TVAA 3V8JA 3HXZA 5ELOA 3ERRA 3M4QA 2DEQA 4HA8A 1USYA 5ELNA 2ZZFA 4WJ3M 4K87A 4YP0A 4CH5A 4YRFA 3RACA 3V7SA 3RIRA 1N9WA 2DTHA 1EVLA 5HGQA 2ZIOA 3A74A 3HFVA 1WU7A 4CH3A 2I4LA 1WLEA 2ZZGA 4KR3A 3FJPA 4YRTA 4KR2A 3RF1A 2E41A 4BWAA 5K1PA 3TEHA 1E24A 4P74C 2CJBA 4L87A 4YPFA 1L0WA 3KFUA 3A5YA 1YFTA 4YRGA 1X54A 2RHSB 4WF2A 3V7CA 4LVLA 1G5HA 4CS2A 3QO5A 1EFWA 3RUXA 2P5IA 2HNIA 4OLFA 2AMCA 2J3LA 4TQFA 1YGBA 2ODRD 1WNLA 1EQRA 3RKWA 1X55A 4P75C 4P72C 1BBWA 2EAYA 2DU7A 4YRIA 3P8VA 3QNEA 4G85A 2ZXFA 2EJGA 4YRPA 1RIQA 1B7YB 4P73C 5C51B 4YRQA 5C53B 1Z7NA 3DSQA 2ZZEA 3E9IA 2ZNJA 4XTZA 4P71C 3NENA 1NJ5A 3NELA 4TWAA 3HTZA 1BIBA 3L2ZA 4YRNA 4HWOA 4HWTA 4BW9A 3VQYA 3MEYA 1EIYB 4RQFA 1WYDA 3HXXA 5E3IA 2DXUA 4YRRA 2ZR3A 3VQXA 1WQWA 4NCXA 2IY5A 3PZCA 2E64A 4LVKA 3PCOA 3E9HA 2RHQB 3L4GB 1E1OA 4XU2A 4XTVA 3A7AA 4ZIBA 2DDZA 4XTWA 4H2UA 3LSQA 1YFSA 3QTCA 3IKLA 4XU0A 4P3PA 1WQ7A 2DZCA 2A8EA 1W66A 2RHSA 2ZTGA 3V8LA 4YRMA 2E1HA 3HXVA 4H2XB 2ARTA 2DXTA 1G5IA 4Q15A 5K1XA 1C0AA 3ICAA 2FYKA 1PYSB 4PG3A 4XTUA 3MQZA 1E1TA 1X2GA 2ZR2A 4RQEA 2IY5B 4P3NA 3HRKA 1B7YA 4K86A 2DU5A 4TVWA 1GGMA 2DTOA 2QHUA 1H4QA 3A7RA 1NNHA 3PCOB 1ASZA 4LVMA 2CIMA 2DKGA 1JJCB 2DVEA 1FYFA 3VQWA 2XGTA 3RKYA 1B8AA 1ADJA 4XTYA 1EIYA 4H2VA 3HXWA 4XTXA 4CS4A 3VQVA 4YRSA 3UGQA 1ADYA 4YYEA 3IALA 4H2WA 4HWSA 2E65A 1USYC 1HXDA 2ARSA 3IKMB 3HXUA 5F5WA 2RHQA 3L4GA 1J5WA 3IG2A 3UH0A 4YRCA 2XTIA 4DPGA 3OD1A 2ZIMA 4XEOA 4DQ2A 4YCVA 4G84A 1G51A 4E51A 2CJAA 2Q7GA 4H2TA 4H2XA 1NJ2A 3I7FA 4TTVA 3RGLA 2I4NA 5KNNA 4LVIA 4XU1A 2E5AA 3P8TA 3LSSA 4UP8A 1PYSA 2DTIA 2ZT8A 11ASA 2J3MA 3WQZA 3REUA 4EX5A 1BIAA 2QHTA 3UGTA 2ARUA 3G1ZA 3P8YA 2DQ0A 1H4SA 3W3SA 3R07A 2G4CA 4UP7A 2ZT7A 3NETA 4UPAA 2QHVA 2DQ3A 3HFZB 3A7UA 4WI1A 1H4TA 1JJCA 4ZTZB 2I4MA 4P74A 2ZNIA 3CMQA 3REXA 2C7IA 4YRJA 3V8KA 2EL9A 3A32A 12ASA 4YREA 2QHSA 4HWRA 1IL2A 4XEMA 2AKWB 4TQDA 4O2DA 1ATIA 4CS3A 3EFRA 4LVJA 2E10A 4HVCA 1KMNA 4P75A 2ODRC 1QF6A 4P72A 1WPYA 3BFMA 1SESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PME A;  1YFR A;  1Z7M A;  4XU3 A;  1NYR A;  4P73 A;  3A5Z A;  4YCU A;  1YB3 A;  4CH4 A;  2ZT6 A;  4P71 A;  3TEG A;  4P3O A;  2Q7E A;  5C52 B;  4YRO A;  4AH6 A;  2P0L A;  2ALY B;  2ZGW A;  2I4O A;  1X56 A;  4TVA B;  2C8M A;  1E22 A;  3NEM A;  2Q5H A;  2Q7H A;  3UFG A;  3RKX A;  1NJ1 A;  3QO7 A;  3RL6 A;  1VQZ A;  3A31 A;  4ZTU B;  4PHC A;  1SRY A;  1B70 A;  4H02 A;  3HFZ A;  2ZCE A;  1KOG A;  1B76 A;  3M4P A;  1ASY A;  1NYQ A;  2ZT5 A;  2DZ9 A;  1H4V B;  2EJ9 A;  4LNS A;  1BBU A;  2EWN A;  2CGH A;  1X01 A;  4YRL A;  3VBB A;  2PMF A;  4K88 A;  1HTT A;  3L1A A;  2ZIN A;  3V7R A;  4EO4 A;  4HWP A;  1SER A;  2DJZ A;  2EJF A;  3TEH B;  4YRK A;  4WJ4 A;  3TUP A;  2AKW A;  3MF2 A;  4H2S A;  4J15 A;  1HC7 A;  3HXY A;  4RDX A;  4X5O A;  1LYL A;  4RMF A;  1NJ6 A;  3BJU A;  4H2Y A;  1EVK A;  3QO8 A;  1NJ8 A;  1QE0 A;  3EFS A;  2AMC B;  4UP9 A;  1KMM A;  1B70 B;  2Q5I A;  4OP0 A;  3HY1 A;  4YCW A;  2E3C A;  4KQE A;  4YDQ A;  1EOV A;  4Q6G A;  3HRI A;  2CJ9 A;  3HY0 A;  3LC0 A;  3MF1 A;  2ALY A;  4CH6 A;  4TVY A;  1X2H A;  1SET A;  4TVA A;  3V8J A;  3HXZ A;  5ELO A;  3ERR A;  3M4Q A;  2DEQ A;  4HA8 A;  1USY A;  5ELN A;  2ZZF A;  4WJ3 M;  4K87 A;  4YP0 A;  4CH5 A;  4YRF A;  3RAC A;  3V7S A;  3RIR A;  1N9W A;  2DTH A;  1EVL A;  5HGQ A;  2ZIO A;  3A74 A;  3HFV A;  1WU7 A;  4CH3 A;  2I4L A;  1WLE A;  2ZZG A;  4KR3 A;  3FJP A;  4YRT A;  4KR2 A;  3RF1 A;  2E41 A;  4BWA A;  5K1P A;  3TEH A;  1E24 A;  4P74 C;  2CJB A;  4L87 A;  4YPF A;  1L0W A;  3KFU A;  3A5Y A;  1YFT A;  4YRG A;  1X54 A;  2RHS B;  4WF2 A;  3V7C A;  1G5H A;  4CS2 A;  3QO5 A;  1EFW A;  3RUX A;  2P5I A;  2HNI A;  4OLF A;  2AMC A;  2J3L A;  4TQF A;  1YGB A;  2ODR D;  1WNL A;  1EQR A;  3RKW A;  1X55 A;  4P75 C;  4P72 C;  1BBW A;  2EAY A;  2DU7 A;  4YRI A;  3P8V A;  3QNE A;  4G85 A;  2ZXF A;  2EJG A;  4YRP A;  1RIQ A;  1B7Y B;  4P73 C;  5C51 B;  4YRQ A;  5C53 B;  1Z7N A;  3DSQ A;  2ZZE A;  3E9I A;  2ZNJ A;  4XTZ A;  4P71 C;  3NEN A;  1NJ5 A;  3NEL A;  4TWA A;  3HTZ A;  1BIB A;  3L2Z A;  4YRN A;  4HWO A;  4HWT A;  4BW9 A;  3VQY A;  3MEY A;  1EIY B;  4RQF A;  1WYD A;  3HXX A;  5E3I A;  2DXU A;  4YRR A;  2ZR3 A;  3VQX A;  1WQW A;  4NCX A;  2IY5 A;  3PZC A;  2E64 A;  3PCO A;  3E9H A;  2RHQ B;  3L4G B;  1E1O A;  4XU2 A;  4XTV A;  3A7A A;  4ZIB A;  2DDZ A;  4XTW A;  4H2U A;  3LSQ A;  1YFS A;  3QTC A;  3IKL A;  4XU0 A;  4P3P A;  1WQ7 A;  2DZC A;  1W66 A;  2RHS A;  2ZTG A;  3V8L A;  4YRM A;  2E1H A;  3HXV A;  4H2X B;  2ART A;  2DXT A;  1G5I A;  4Q15 A;  5K1X A;  1C0A A;  3ICA A;  2FYK A;  1PYS B;  4PG3 A;  4XTU A;  1E1T A;  1X2G A;  2ZR2 A;  4RQE A;  2IY5 B;  4P3N A;  3HRK A;  1B7Y A;  4K86 A;  2DU5 A;  4TVW A;  1GGM A;  2DTO A;  2QHU A;  1H4Q A;  3A7R A;  1NNH A;  3PCO B;  1ASZ A;  2CIM A;  2DKG A;  1JJC B;  2DVE A;  1FYF A;  3VQW A;  2XGT A;  3RKY A;  1B8A A;  1ADJ A;  4XTY A;  1EIY A;  4H2V A;  3HXW A;  4XTX A;  4CS4 A;  3VQV A;  4YRS A;  3UGQ A;  1ADY A;  4YYE A;  3IAL A;  4H2W A;  4HWS A;  2E65 A;  1USY C;  1HXD A;  2ARS A;  3IKM B;  3HXU A;  5F5W A;  2RHQ A;  3L4G A;  1J5W A;  3IG2 A;  3UH0 A;  4YRC A;  2XTI A;  4DPG A;  3OD1 A;  2ZIM A;  4XEO A;  4DQ2 A;  4YCV A;  4G84 A;  1G51 A;  4E51 A;  2CJA A;  2Q7G A;  4H2T A;  4H2X A;  1NJ2 A;  3I7F A;  4TTV A;  3RGL A;  2I4N A;  5KNN A;  4XU1 A;  2E5A A;  3P8T A;  3LSS A;  4UP8 A;  1PYS A;  2DTI A;  2ZT8 A;  11AS A;  2J3M A;  3WQZ A;  3REU A;  4EX5 A;  1BIA A;  2QHT A;  3UGT A;  2ARU A;  3G1Z A;  3P8Y A;  2DQ0 A;  1H4S A;  3W3S A;  3R07 A;  2G4C A;  4UP7 A;  2ZT7 A;  3NET A;  4UPA A;  2QHV A;  2DQ3 A;  3HFZ B;  3A7U A;  4WI1 A;  1H4T A;  1JJC A;  4ZTZ B;  2I4M A;  4P74 A;  2ZNI A;  3CMQ A;  3REX A;  2C7I A;  4YRJ A;  3V8K A;  2EL9 A;  3A32 A;  12AS A;  4YRE A;  2QHS A;  4HWR A;  1IL2 A;  4XEM A;  2AKW B;  4TQD A;  4O2D A;  1ATI A;  4CS3 A;  3EFR A;  2E10 A;  4HVC A;  1KMN A;  4P75 A;  2ODR C;  1QF6 A;  4P72 A;  1WPY A;  3BFM A;  1SES A; 
#chains in the Genus database with same CATH topology
 4YJ3 E;  2PME A;  4DUZ T;  3MZK B;  4IE5 A;  3V5U A;  1OED B;  1NYR A;  3A5Z A;  4IE4 A;  4YTN A;  4P71 A;  5FP3 A;  2I59 A;  3TEG A;  1KEY A;  4AH6 A;  5AQP B;  3O9X A;  2ALY B;  2ZGW A;  3RIU A;  1X56 A;  3RQU A;  3P4P A;  4ASK A;  1N34 T;  5HCJ A;  4IL4 A;  2Q5H A;  1NJ1 A;  5CGM A;  1VQZ A;  3GN5 A;  3UU3 A;  4PHC A;  2ZCE A;  2W61 A;  2N1G A;  5EZY E;  3M4P A;  1D0X A;  2D0T A;  4GK5 E;  2ZT5 A;  4BAY B;  2EJ9 A;  3UUM A;  5AQF B;  1M7K A;  4LFC T;  2NS6 A;  4B6X A;  2CGH A;  4DBR A;  2K5B B;  2WMN A;  4K88 A;  4QHO A;  3V7R A;  1IBK T;  2DJZ A;  5HWX A;  3TUP A;  4HFD A;  2DL1 A;  2UXN B;  4J15 A;  4JI7 T;  1MNE A;  1LYL A;  4RMF A;  2L9Q A;  4GKK T;  1HG5 A;  5ABG A;  2KIN B;  2YU2 A;  3PJA A;  1M62 A;  5LHG B;  2YN6 A;  1S94 A;  3UFE A;  3EFS A;  3ONJ A;  1W0B A;  2MYS A;  2BKN A;  1B70 B;  2BG9 B;  3UU5 A;  3AE8 A;  3HY1 A;  4HFI A;  3RC3 A;  4IRE A;  4QH1 A;  1EOV A;  1YQ4 A;  1VCT A;  2CJ9 A;  2UXX B;  3S4U A;  3HY0 A;  3LC0 A;  4CN6 A;  5AQH B;  2W67 A;  2CBI A;  1SET A;  4TVA A;  1KNP A;  3J7Y q;  4Z90 A;  2XAH B;  1B7T A;  3ERR A;  4PJM A;  3M4Q A;  3TLS A;  2EHO A;  4C91 A;  5FVL A;  1U4Q A;  3FZK B;  4PK5 A;  2I0M A;  3RC8 A;  1USY A;  4U72 A;  4DV5 T;  3ZN0 B;  4KMC A;  4K87 A;  3NBX X;  3PDY A;  5J0Z A;  3LK2 B;  4IE6 A;  3CX6 B;  4JI1 T;  5HGQ A;  2CBJ A;  2Q9Q B;  2NP9 A;  3HFV A;  1ZOY A;  2NR4 A;  2W4X A;  3KBT A;  2X9W A;  3OPC A;  2WMO A;  4YTM A;  4KUM B;  2HH7 A;  4YRT A;  4P0A A;  2OV9 A;  5HWY A;  2NW8 A;  4MAL A;  4DR5 T;  4JI5 T;  5AFU L;  3KFU A;  2ZM0 A;  1YFT A;  2DHR A;  3EUH A;  4DND A;  5FXX A;  3ZST A;  3RUX A;  1IBL T;  2AMC A;  2VL8 A;  5LBM A;  1YGB A;  5AQS B;  3UU6 A;  2LSY A;  4P72 C;  4O2A E;  2W63 A;  4IIJ E;  2G0U A;  2J47 A;  3P8V A;  2A72 A;  3RIF A;  2XUE A;  5CB4 E;  2W62 A;  3K1S A;  2EJG A;  4TN7 B;  5C51 B;  4TX5 A;  4DR1 T;  5HAX A;  3OYZ A;  5LA6 E;  5H6Q B;  2B1E A;  3E9I A;  2D5U A;  4JI3 T;  4XTZ A;  4P71 C;  3NEN A;  5JDH A;  3FZF B;  4TWA A;  3GWH A;  3HTZ A;  3L2Z A;  3PE0 A;  4V1A v;  3RIU C;  4RQF A;  4Q25 A;  4U2Z A;  3H37 A;  3HXX A;  2VKO A;  5L3C B;  3P50 A;  1MMA A;  5LCY A;  3UUL A;  5LJN A;  4NCX A;  3C4W A;  3AA7 B;  2E64 A;  4LVK A;  4UVC B;  5HEH A;  2RHQ B;  5FL0 A;  5AQG B;  2DDZ A;  4XTW A;  3IEE A;  2KLQ A;  2DZC A;  1MMD A;  2A8E A;  2V1D B;  4YRM A;  4UV9 B;  3HXV A;  1YKE B;  4YLH A;  4OK0 A;  3NRX A;  2D0U A;  1MMG A;  3AXJ A;  1UX5 A;  2E5V A;  1EZ3 A;  3A8Y C;  3AED A;  3Q9D A;  3PUY F;  1WCR A;  4XTU A;  1E1T A;  4I55 E;  2MTQ A;  1X2G A;  2WWU A;  2ZR2 A;  3RQW A;  3CX7 B;  3KV4 A;  2A3D A;  2XPK A;  5HXH A;  4P3N A;  3HRK A;  4K86 A;  4TVW A;  2DTO A;  4AKR B;  3A7R A;  3PCO B;  2IDO B;  4TNW A;  2XQY A;  5EK2 A;  3AAI A;  4DV6 T;  4ADZ A;  4CN4 A;  2WS3 A;  3VQW A;  4JI2 T;  1B8A A;  1X9B A;  2XAF B;  2DI4 A;  2UXD T;  2J62 A;  2JMK A;  2VVN A;  4LF7 T;  4O4J E;  3RYF E;  2EHO C;  1HNW T;  2V5C A;  1USY C;  4YY3 T;  4ZXL A;  3ZC0 A;  3LBX B;  3O1J A;  2XQ7 A;  3L4G A;  3PUW F;  4QWN B;  3RLF F;  4DPG A;  3O4X E;  3OD1 A;  5ABH A;  2ZIM A;  4PJN A;  1ZKE A;  4UEL A;  5LMU T;  4L0R A;  4LF4 T;  3CQX C;  3SRZ A;  2WDQ A;  5KNN A;  4LVI A;  4TV9 E;  2KXP B;  1PYS A;  5KXJ A;  2LHR A;  3KVB A;  5FY1 A;  4TWH A;  2J3M A;  3REU A;  3WQZ A;  2YEV C;  2WQY A;  3JAF A;  3OTO T;  1KNZ A;  4B3R T;  2Y8D A;  5FYM A;  2G4C A;  3GN5 B;  4ZZC A;  1H4T A;  4U74 A;  4O8S A;  2WZH A;  1T98 A;  2WCA A;  5L47 A;  4P74 A;  1SA0 E;  4MFR A;  3C50 A;  3TLT A;  2UUC T;  4J2C A;  2NW7 A;  2K3W A;  4YRE A;  2QHS A;  4I50 E;  1IL2 A;  2WSS V;  4HFE A;  2OLT A;  4O2D A;  2Z6E A;  3AA1 B;  4CS3 A;  5ETW A;  2FJD A;  1CUN A;  4HN9 A;  2E10 A;  2E8I A;  4HWH A;  3UUX B;  3TLV A;  4P75 A;  1QF6 A;  5C8Y E;  2NTX A;  2LJL A;  4H9S E;  3MXZ A;  5F3J A;  2K9A A;  3K3N A;  5AQJ B;  5FMN A;  3SWH A;  1YFR A;  2VKD A;  4IE7 A;  4WW0 A;  4EV6 A;  1YB3 A;  4CH4 A;  2XQ9 A;  2X9X A;  4JUY A;  1SE7 A;  2ZT6 A;  3QUJ A;  1O3X A;  4DUY T;  5C52 B;  2Q7E A;  4CXX A;  3EI0 A;  4YRO A;  2P0L A;  1HNX T;  3GA8 A;  3FXD B;  3SFD A;  5HEO A;  4TVA B;  3PU3 A;  3L3P A;  4UV8 B;  3HKE E;  2EHO B;  4A97 A;  4PK4 A;  2FJA A;  3ETU A;  2X0H A;  2CWO A;  4YSY A;  5FXZ A;  3N2O A;  3PV0 F;  1SRY A;  4CXW A;  3HFZ A;  4MHC A;  3KV6 A;  1ASY A;  4GKJ T;  5HYA A;  3BQL A;  1R8I A;  2V8S V;  4QH5 A;  3B5M A;  4ZI3 D;  5M4Y A;  3VBB A;  1XDP A;  2RP4 A;  1HTT A;  3L1A A;  3CQG B;  4EO4 A;  1SER A;  3FB2 A;  3AEE A;  1UX4 A;  5L3B B;  3MF2 A;  3PUA A;  1HC7 A;  2WZI A;  3HXY A;  4X5O A;  1CHU A;  3BJU A;  3DP7 A;  4NUV A;  4H2Y A;  2XAG B;  3SOL A;  5JDQ A;  2ES0 A;  5FXW A;  1KNR A;  3AE9 A;  4LFB T;  5EK3 A;  2AMC B;  4HFV A;  2Q5I A;  3LDQ B;  1GQE A;  4C90 A;  4HE8 A;  3NKZ A;  2JIW A;  2CXL A;  2MOZ A;  3X1D A;  3PUX F;  4TVY A;  2VK9 A;  4NIQ A;  2PTF A;  5CFB A;  1VRB A;  3KV5 A;  3V8J A;  4OYJ A;  5JRE A;  2HPL A;  4PK6 A;  2DEQ A;  3IA3 A;  5A1L A;  4EOZ B;  3KVA A;  5ELN A;  5HXS A;  4WJ3 M;  1LVK A;  4GK0 E;  4YRF A;  3RAC A;  4AQY T;  3V7S A;  2WU5 A;  3UT5 E;  2MBG A;  1N9W A;  4EYU A;  1Y01 A;  2DTH A;  5L4H A;  2FUP A;  1HFA A;  1NEN A;  1WLE A;  3CX8 B;  4EEB A;  2V7M A;  2ZZG A;  2IC6 A;  4KR3 A;  4DV2 T;  4A98 A;  2Y48 B;  2BZB A;  4LF5 T;  2V6Y B;  3ZKR A;  4NXN T;  4ILB A;  3RF1 A;  4KHZ F;  2X0L B;  2E41 A;  1OXZ A;  2WBL A;  3TEH A;  1E24 A;  4P74 C;  4DMW A;  4L87 A;  1E1H B;  5ABF A;  2NTY A;  3A5Y A;  3PJA J;  2N2N A;  1SHZ C;  2BDE A;  3ONX A;  1OED E;  3EDU A;  2E9X A;  1YKH B;  3CKD A;  5FY7 A;  3AE7 A;  2QA7 A;  3NZQ A;  3ZYL A;  1YD8 G;  3QO5 A;  2P5I A;  2HNI A;  3AXJ B;  4GYR A;  4TQF A;  2F4V T;  4QH4 A;  2XAJ B;  2ODR D;  1WFD A;  3AEF A;  3LFM A;  4P75 C;  2FBW A;  2Q9Q D;  4COF A;  5FY0 A;  1D1A A;  2M6B A;  3P4S A;  3ZPO A;  2KND A;  2M6I A;  3HKD E;  2C0S A;  5AQL B;  4Z91 A;  4F6R C;  5LB7 B;  3AE5 A;  2BBJ A;  1RIQ A;  4QX7 B;  2DLR A;  2A2F X;  3BQI A;  4YSX A;  4YRQ A;  3JCF A;  3DSQ A;  5AQU B;  2ZNJ A;  5JDF A;  1NAF A;  2JQQ A;  1NJ5 A;  1FEW A;  4X1Y E;  5HXC A;  4BJN A;  1BIB A;  3N2K E;  3QB5 A;  4BW9 A;  3H3A A;  3V5S A;  2XQ3 A;  3F31 A;  4YHJ A;  2LM2 A;  5E3I A;  5JTG A;  1HCI A;  3ZJ2 A;  4E7S A;  2ZR3 A;  4TUY E;  2LOS A;  4AQF C;  4B3S T;  3PZC A;  5FKY A;  3L4G B;  3C4Z A;  1JNZ A;  4I43 B;  4H2U A;  4ZZB A;  1YFS A;  3FZH B;  2BVM A;  3C64 A;  2VUR A;  2BG9 E;  4XU0 A;  1WQ7 A;  3VHL A;  3VKH A;  3V8L A;  3KFW X;  3CQC B;  2E1H A;  3PU8 A;  4PAG A;  2ART A;  1E2A A;  3RH3 A;  4TNV A;  5LHI B;  4HGA A;  1HG2 A;  5LP6 E;  1PYS B;  4PG3 A;  5AQT B;  1V9D A;  4IGU A;  4LF9 T;  3O1H A;  3QB5 K;  4ERR A;  2IY5 B;  3ZSS A;  5L3G B;  4NUU A;  2DU5 A;  4TZ4 C;  1GGM A;  4AI6 A;  3P4R A;  2BS3 A;  3NZP A;  3VRB A;  1NNH A;  1ASZ A;  2PG8 A;  4ILC A;  2CIM A;  4DMV A;  3ZT6 A;  1FYF A;  3OVU A;  2XGT A;  3RKY A;  4IDN A;  2XTL A;  3HXW A;  4XTX A;  5HEJ A;  4IT4 A;  3N2G E;  3VQV A;  1XZY A;  3PTR B;  1ADY A;  4YYE A;  5FL1 A;  5BR8 T;  4H2W A;  2KT9 A;  4HWS A;  2N9D A;  4JV5 T;  1HXD A;  2JJ9 A;  3RI5 A;  2ARS A;  4PJJ A;  4UEM A;  1BR1 A;  1WLX A;  4KBM B;  2OA5 A;  2WDV A;  5GON E;  3IG2 A;  3E0Z A;  3I1A A;  4YRC A;  2XTI A;  2XQ4 A;  5JR9 A;  4PW8 A;  2UUB T;  2JMH A;  4XEO A;  4DQ2 A;  4YCV A;  2LRL A;  5HCM A;  2YK0 A;  2CJA A;  4H2T A;  4H2X A;  5L3D B;  1SUM B;  1W09 A;  1NJ2 A;  2I4N A;  2E5A A;  3P8T A;  4DVD A;  2E9X C;  3LSS A;  4H9O C;  4UVB B;  2X9H A;  2ZT8 A;  3Q5D A;  3CVR A;  11AS A;  4EX5 A;  2XM2 A;  5KX5 E;  3FXE B;  3FHN A;  3VR8 A;  2ARU A;  4HFB A;  3P8Y A;  4AKH A;  3R07 A;  4CI2 B;  3N9Q A;  4EZ4 A;  2H7O A;  3NET A;  4DO0 A;  2NOX A;  2DQ3 A;  3W15 B;  2NW9 A;  3HFZ B;  3N5L A;  3KBU A;  1JJC A;  1VOM A;  4ILA A;  1IZN B;  2C5K T;  3HKC E;  2CPT A;  1US7 B;  4PJL A;  2AE9 A;  5J2T E;  4WZX A;  4YRJ A;  2X51 A;  1J1J A;  2CLY C;  5KMG P;  1J5E T;  3GMI A;  2IML A;  3C4X A;  2V7J A;  3AE4 A;  2IUB A;  4O2B E;  3WI3 A;  2JPF A;  1ATI A;  3FZL B;  2YDQ A;  1MMN A;  1D0Z A;  4KI0 F;  3I0O A;  3EFR A;  4LVJ A;  4WYV A;  5LGN B;  4YSZ A;  3JC6 C;  1WPY A;  2V7I A;  4EB6 E;  3ZJ1 A;  3A5X A;  4ILU A;  1WR0 A;  2JQH A;  5LGU B;  2WAU A;  4XU3 A;  3P4W A;  5AQV B;  4YCU A;  4ZS2 A;  1VCS A;  4CZZ B;  1WYC A;  4L9I A;  1MIY A;  2XQA A;  5AQK B;  2J1D G;  3AE6 A;  2M67 A;  1BR0 A;  4IDP A;  1MND A;  3P4Q A;  2KMF A;  2I4O A;  4B3M T;  5HXR A;  1G73 A;  5KDM C;  3P8C D;  4IHJ E;  5CA0 E;  4IDO A;  1E22 A;  5LG3 A;  2Q7H A;  3UFG A;  3RKX A;  3RL6 A;  2IC9 A;  1T8B A;  4ZTU B;  3PUR A;  3ZT7 A;  1HNZ T;  2C5J A;  5J1G A;  1UUS A;  1B70 A;  2BG9 A;  4H02 A;  2IIU A;  1MIW A;  3H3M A;  3ZLI A;  1HTJ F;  5ABE A;  3RYH E;  4U3C A;  3CIR A;  4YRL A;  2W0G A;  4M1P A;  2PBI A;  2ZIN A;  2YDR A;  3TLW A;  1UK5 A;  4HWP A;  2EJF A;  3TEH B;  2LLY A;  4WJ4 A;  2AKW A;  3UUN A;  1NWM X;  4H2S A;  4DV3 T;  3RRC A;  4BJM A;  5ABF B;  4OFZ A;  2EHO D;  5LYJ E;  4TWD A;  1NJ6 A;  3ZCJ A;  2E9X B;  3QO8 A;  4QXC B;  2XQ5 A;  1NJ8 A;  1LRZ A;  4IST A;  5JVD E;  3CML A;  4HFC A;  4UP9 A;  1KMM A;  2AXD S;  2YKS A;  4YCW A;  2H88 A;  2E3C A;  4YDQ A;  2BS2 A;  4GYS A;  2FJB A;  2ACZ A;  2DWK A;  4LMK A;  4X1K E;  5JR9 C;  2LOP A;  3ZN1 B;  3MF1 A;  4KX6 A;  4X64 T;  2DWG A;  2CCQ A;  3VR9 A;  5LHH B;  4PFO A;  2CLY B;  2LM9 A;  3RKG A;  2KSR A;  1HR0 T;  2YIN A;  1YW0 A;  5HEG A;  4DV4 T;  5DQV A;  4HA8 A;  4JI0 T;  4K0U A;  3AB3 B;  5JDL A;  4YJ2 E;  4CH5 A;  3EHZ A;  2CM0 A;  2WY2 A;  3RIR A;  3VU7 H;  5JDG A;  2E2A A;  3A74 A;  4MLK A;  2CEA A;  4H63 V;  1ZHC A;  3I0Q A;  3AA0 B;  4U7I A;  3UUB A;  4HWD A;  3VRA A;  1KFY A;  3MA9 A;  4EIW A;  4CI3 B;  5K1P A;  2LT3 A;  4F8H A;  1L0W A;  3T1H T;  3Q5X A;  1LKX A;  4HFH A;  4WF2 A;  3V7C A;  1QUU A;  2H89 A;  4X5T A;  4CS2 A;  3LJC A;  2H3R A;  2ODV A;  4K0K T;  5LNK A;  4KP3 C;  3L09 A;  1WNL A;  1EQR A;  1D0Y A;  3RKW A;  4G63 A;  3AEA A;  4LMJ A;  3C51 A;  2EAY A;  3Q5E A;  4H9N C;  4CN1 A;  3MJX A;  3LSV A;  3N9M A;  4O4H E;  4G85 A;  2FJE A;  2ZXF A;  3PUS A;  2X9Y A;  4QXB B;  3ANW A;  2VKJ A;  3WAJ A;  5C53 B;  4ZS3 A;  2ZZE A;  4XAX B;  3KIN B;  4WNK A;  5BMV E;  2CHN A;  4UF0 A;  4XZC A;  4YRN A;  1YQ3 A;  4HWI B;  4O4L E;  4HWT A;  3ZMZ B;  3ZYK A;  2B76 A;  1XMO T;  3VQY A;  2L3L A;  3SFE A;  2WDR A;  1N32 T;  1WYD A;  3UTK A;  2PJQ A;  3N9N A;  2BKO A;  2JRK A;  2DXU A;  3E08 A;  4YRR A;  3VQX A;  3U78 A;  3M3Z B;  1XDO A;  1KF6 A;  3JAE A;  4ZEY A;  5DAB A;  4U33 A;  2XZE A;  3EAB A;  3PCO A;  1E1O A;  3QNU A;  4XU2 A;  4XTV A;  4JLE A;  5JR9 B;  4EGW A;  3M65 A;  3QTC A;  4P3P A;  2XAS B;  5TAO A;  1W66 A;  2RHS A;  2ZTG A;  4A56 A;  2MPK A;  3OJA A;  2YU1 A;  4H2X B;  2W66 A;  4ZI2 C;  2A9U A;  1G5I A;  1MIV A;  4JBW F;  1OWA A;  4E7Z A;  3AE2 A;  3ICA A;  2D9D A;  2UUA T;  3UU4 A;  5IWA T;  1WYB A;  2QVA A;  3RYC E;  2DNX A;  5FVK A;  2V6X A;  3CWZ B;  1FMW A;  1B7Y A;  3RPU A;  2VKH A;  4P0B A;  5LOV E;  1E7P A;  3JAD A;  3WAK A;  4XBF B;  2CA5 A;  5L3E B;  3DTO A;  3HL6 A;  4H9R C;  1Z8U A;  3A7M A;  3FBZ A;  1JJC B;  2XSA A;  2DVE A;  2ODU A;  1ADJ A;  2LSJ A;  2YDS A;  1EIY A;  4H2V A;  4LFA T;  2XY8 B;  4CS4 A;  4YRS A;  1ZP0 A;  3TKL B;  2CXD A;  3T8O A;  3QOF A;  3RRW A;  2I6H A;  3PUG A;  2LSG A;  4ZI2 D;  3F57 A;  1IBM T;  1W0A A;  3IKM B;  4ZOL E;  3HXU A;  3AVS A;  3FBL A;  4KHP T;  5DJQ C;  5F5W A;  1J5W A;  3ONL C;  3UH0 A;  3RKO A;  2IAK A;  3K3O A;  4X20 E;  1X79 A;  2CMR A;  5L4E A;  2MAW A;  2V26 A;  4AIU A;  1G51 A;  2Q7G A;  4HEA A;  1BR4 A;  5HEU A;  3QK6 A;  2ZM6 T;  5LXT E;  4H9P C;  3CK6 A;  3I7F A;  4TTV A;  4XU1 A;  1H7C A;  4UP8 A;  4IL9 A;  3UQ7 A;  2CRB A;  2K24 A;  2ZMA A;  3VKG A;  2LSK A;  2IW5 B;  2L8K A;  5J2U E;  3UGT A;  1H4S A;  4X66 T;  3W3S A;  4NXM T;  2JQ9 A;  3K8P C;  1IJ5 A;  3A7U A;  1N36 T;  3QC9 A;  5LMN T;  4ZTZ B;  3FZM B;  3REX A;  3ZC1 A;  2C7I A;  1N33 T;  3V8K A;  5IYZ E;  4ISS A;  2EL9 A;  3A32 A;  12AS A;  1DU2 A;  4AQG A;  5AQI B;  1UUR A;  4ZHQ E;  3HI2 A;  2VB6 A;  3AEB A;  2AKW B;  4TQD A;  2BS4 A;  2D2S A;  4OX9 T;  4NPP A;  4HVC A;  4U2Y A;  4DV0 T;  1NEK A;  3ETV A;  5AQQ B;  4DR6 T;  5JRC A;  3ZMS B;  2JQK A;  1L0V A;  3K3Q C;  5JH7 E;  4X65 T;  3T1Y T;  5LBQ B;  1Z7M A;  4P73 A;  1IAP A;  4TV8 E;  3OYX A;  3LK4 2;  5CA1 E;  4OYK A;  2CXF A;  4P3O A;  4HT4 A;  2BVL A;  2X0Y A;  1T72 A;  5L3F B;  1LVF A;  3IBP A;  2C8M A;  4YFS A;  3NEM A;  4WBO A;  4HKA A;  3QO7 A;  3PUZ F;  2HN1 A;  4EXT A;  3G06 A;  5LJM A;  3A31 A;  4JEU B;  3KDS E;  3RX6 A;  4CI1 B;  2VQF T;  4X62 T;  2XJ7 A;  1KOG A;  3P7I A;  1B76 A;  2QGS A;  4TWF A;  2ZM2 A;  5IHY A;  1NYQ A;  2DZ9 A;  1H4V B;  2CWY A;  5AQR B;  4LNS A;  1BBU A;  2EWN A;  5AQO B;  1X01 A;  4FJO A;  2PMF A;  5IUX A;  1W9R A;  3EDV A;  5CJ5 A;  3RHW A;  4YRK A;  5F8P A;  4IE0 A;  5HXE A;  3D0T A;  4EZH A;  4RDX A;  2ZLY A;  3AE1 A;  3CPZ A;  3AE3 A;  3PUV F;  3UU8 A;  1EVK A;  1BR2 A;  2WWV A;  1QE0 A;  2XM1 A;  3EAM A;  4AXP A;  5JDN A;  4YHH T;  3NRY A;  4A5X A;  1OED A;  4OP0 A;  1JNR A;  4QXH B;  4KQE A;  3AEC A;  4Q6G A;  3HRI A;  5JQG E;  2V6Y A;  1D1B A;  1HX1 B;  4EYY R;  1WRD A;  3B57 A;  3ZMU B;  4U31 A;  2ALY A;  3ANW B;  4CH6 A;  2KZ7 B;  4I4T E;  2RA1 A;  1X2H A;  3AAA B;  3B13 A;  4UF0 B;  3HXZ A;  1FIO A;  2K48 A;  4UIG A;  5LG4 A;  5ELO A;  2E5L T;  4LF6 T;  2E9X D;  1YXR A;  3ZT5 A;  3HKB E;  2J4G A;  4UR9 A;  2ZZF A;  4HWF A;  2LEH A;  3ZEF B;  4YP0 A;  3AA6 B;  4QKN A;  3DJB A;  1HS7 A;  2ZM8 A;  4CQI A;  1EVL A;  2QYW A;  3O1I A;  2X67 A;  2ZIO A;  1Z0P A;  1WU7 A;  4YT0 A;  4CH3 A;  2I4L A;  3I9Y A;  4DBQ A;  2UU9 T;  3ZMT B;  1U5P A;  3FJP A;  4OHF A;  2WB5 A;  4P09 A;  4KR2 A;  4IDQ A;  4BWA A;  3BK9 A;  1FMV A;  3N9P A;  1T7S A;  2X66 A;  2CJB A;  4YPF A;  2VAS A;  4JI4 T;  3UQ4 A;  4YRG A;  4DR3 T;  3AVR A;  2CE7 A;  1X54 A;  2RHS B;  4H63 H;  4CXY A;  1XNQ T;  3Q2M A;  4LVL A;  1G5H A;  4LML A;  2RPA A;  5FNV E;  2SPC A;  3ZMV B;  2XQ6 A;  1EFW A;  4OLF A;  4JI8 T;  2J3L A;  3JC6 D;  3C98 B;  3OKQ A;  3BQK A;  4B3T T;  1X55 A;  1BBW A;  4N78 D;  5E0O A;  2DU7 A;  4YRI A;  4JEH B;  3N9L A;  3QNE A;  4BA9 A;  4YRP A;  1B7Y B;  4P73 C;  2YOE A;  1Z7N A;  1AJ3 A;  3NEL A;  4AKL A;  4PFP A;  4IDZ A;  3KV9 A;  4HWO A;  4YTP A;  2HHH T;  3MEY A;  2LSI A;  1EIY B;  3OBV E;  2PFV A;  4MBQ A;  5EK4 A;  4O4I E;  3I9W A;  2V5D A;  1QLB A;  2LRK A;  5H6R B;  1G8X A;  2Q9Q A;  2VWA A;  1WQW A;  3HR0 A;  1IJ6 A;  2IY5 A;  3MKD A;  1QSD A;  1ZEE A;  2BKP A;  4EAH A;  2QRX A;  3R6N A;  3ZYM A;  3E9H A;  3EVY A;  4GIW A;  2XSB A;  5C3J A;  4L5G A;  2UXB T;  2C5I T;  3A7A A;  4ZIB A;  4U7Y A;  3LSQ A;  1HX8 A;  3IKL A;  3MK7 C;  4I0U A;  2KWI B;  3NVO A;  3RYI E;  5ADX L;  1HF8 A;  2DXT A;  4PNI A;  4EED A;  4DID B;  3ABV A;  4UXN B;  1XNR T;  4Q15 A;  5K1X A;  5LGT B;  1C0A A;  2FYK A;  3MQZ A;  3N9O A;  2WM9 A;  2VQE T;  4AIS A;  2W2U A;  2GK9 A;  3AEG A;  4RQE A;  1OED C;  4P1N A;  2UXC T;  2QHU A;  1H4Q A;  1D1C A;  1KK7 A;  2WU2 A;  3SS1 A;  3L39 A;  4LVM A;  2IHR 1;  4DV7 T;  3J9X 1;  4ZI3 C;  1S35 A;  2DKG A;  4DR2 T;  2NWB A;  1WR6 A;  2P9B A;  2Y6X A;  1UCU A;  4QX8 B;  4XTY A;  2X68 A;  3PUQ A;  4ANJ A;  3AAE B;  2H7V C;  5FXV A;  2VL0 A;  2V7L A;  3UGQ A;  4YXD A;  3IAL A;  2DCF A;  3IHR A;  2E65 A;  4H9Q C;  3ESL A;  1ZV4 X;  4FI5 A;  3R84 B;  2LKH A;  2RHQ A;  5JRC B;  2CHO A;  4AQF A;  3LG7 A;  3Q5W A;  3HA4 A;  4HWC A;  5JDM A;  4G84 A;  4E51 A;  4UVA B;  3RGL A;  2ACX A;  4X1I E;  3F2E A;  4AKI A;  3L8R A;  2DTI A;  4LF8 T;  5AQN B;  1UGO A;  4GOU A;  1I94 T;  2W00 A;  2HN2 A;  3RIA A;  2VVS A;  1BIA A;  2LE8 A;  1I6Z A;  2BG9 C;  2QHT A;  1XMQ T;  4DR4 T;  4G2A A;  3G1Z A;  4AKG A;  2DQ0 A;  4JI6 T;  4UP7 A;  2ZT7 A;  4WBN E;  4UPA A;  2QHV A;  2LHN A;  2WP9 A;  4WI1 A;  2V7K A;  4DV1 T;  2KWH A;  3NWI A;  2I4M A;  1Y64 B;  2ZNI A;  4JYA T;  3CMQ A;  4Z8X A;  2XAQ B;  5DQW A;  2R6G F;  3IF8 B;  3E22 E;  4HWR A;  4XEM A;  2LKG A;  4DR7 T;  2XHE B;  2XQ8 A;  3ZCI A;  3LBX A;  5AQM B;  3LK3 B;  2BBH A;  3MAC A;  3TLU A;  1KMN A;  2HPJ A;  1FJG T;  2ODR C;  4P72 A;  5L2L A;  4HTE A;  3U3I A;  3BFM A;  2Q9Q C;  1SES A;  1XWM A;  5C2T A;  4ZI7 E; 
#chains in the Genus database with same CATH homology
 2PME A;  1YFR A;  1Z7M A;  4XU3 A;  1NYR A;  4P73 A;  3A5Z A;  4YCU A;  1YB3 A;  4CH4 A;  2ZT6 A;  4P71 A;  3TEG A;  4P3O A;  2Q7E A;  5C52 B;  4YRO A;  4AH6 A;  2P0L A;  4HT4 A;  2ALY B;  2ZGW A;  2I4O A;  1X56 A;  4TVA B;  2C8M A;  1E22 A;  3NEM A;  2Q5H A;  2Q7H A;  3UFG A;  3RKX A;  1NJ1 A;  3QO7 A;  3RL6 A;  1VQZ A;  3A31 A;  4ZTU B;  4PHC A;  1SRY A;  1B70 A;  4H02 A;  3HFZ A;  2ZCE A;  1KOG A;  1B76 A;  3M4P A;  1ASY A;  1NYQ A;  2ZT5 A;  2DZ9 A;  1H4V B;  2EJ9 A;  4LNS A;  1BBU A;  2EWN A;  2NS6 A;  2CGH A;  1X01 A;  4YRL A;  3VBB A;  2PMF A;  4K88 A;  1HTT A;  3L1A A;  2ZIN A;  3V7R A;  4EO4 A;  4HWP A;  1SER A;  2DJZ A;  2EJF A;  3TEH B;  4YRK A;  4WJ4 A;  3TUP A;  2AKW A;  3MF2 A;  4H2S A;  4J15 A;  1HC7 A;  3HXY A;  4RDX A;  4X5O A;  1LYL A;  4RMF A;  1NJ6 A;  3BJU A;  4H2Y A;  1EVK A;  3QO8 A;  1NJ8 A;  1QE0 A;  3EFS A;  2AMC B;  4UP9 A;  1KMM A;  1B70 B;  2Q5I A;  4OP0 A;  3HY1 A;  4YCW A;  2E3C A;  4KQE A;  4YDQ A;  1EOV A;  4Q6G A;  3HRI A;  2CJ9 A;  3HY0 A;  3LC0 A;  3MF1 A;  2ALY A;  4CH6 A;  4TVY A;  1X2H A;  1SET A;  4TVA A;  3V8J A;  3HXZ A;  5ELO A;  3ERR A;  3M4Q A;  2DEQ A;  4HA8 A;  1USY A;  5ELN A;  2ZZF A;  4WJ3 M;  4K87 A;  4YP0 A;  4CH5 A;  4YRF A;  3RAC A;  3V7S A;  3RIR A;  1N9W A;  2DTH A;  1EVL A;  5HGQ A;  2ZIO A;  3A74 A;  3HFV A;  1WU7 A;  4CH3 A;  2I4L A;  1WLE A;  2ZZG A;  4KR3 A;  3FJP A;  4YRT A;  4KR2 A;  3RF1 A;  2E41 A;  4BWA A;  5K1P A;  3TEH A;  1E24 A;  4P74 C;  2CJB A;  4L87 A;  4YPF A;  1L0W A;  3KFU A;  3A5Y A;  1YFT A;  4YRG A;  1X54 A;  2RHS B;  4WF2 A;  3V7C A;  4LVL A;  1G5H A;  4CS2 A;  3QO5 A;  1EFW A;  3RUX A;  2P5I A;  2HNI A;  4OLF A;  2AMC A;  2J3L A;  4TQF A;  1YGB A;  2ODR D;  1WNL A;  1EQR A;  3RKW A;  1X55 A;  4P75 C;  4P72 C;  1BBW A;  2EAY A;  2DU7 A;  4YRI A;  3P8V A;  3QNE A;  4G85 A;  2ZXF A;  2EJG A;  4YRP A;  1RIQ A;  1B7Y B;  4P73 C;  5C51 B;  4YRQ A;  5C53 B;  1Z7N A;  3DSQ A;  2ZZE A;  3E9I A;  2ZNJ A;  4XTZ A;  4P71 C;  3NEN A;  1NJ5 A;  3NEL A;  4TWA A;  3HTZ A;  1BIB A;  3L2Z A;  4YRN A;  4HWO A;  4HWT A;  4BW9 A;  3VQY A;  3MEY A;  1EIY B;  4RQF A;  1WYD A;  3HXX A;  5E3I A;  2DXU A;  4YRR A;  2ZR3 A;  3VQX A;  1WQW A;  4NCX A;  2IY5 A;  3PZC A;  2E64 A;  4LVK A;  3PCO A;  3E9H A;  2RHQ B;  3L4G B;  1E1O A;  4XU2 A;  4XTV A;  3A7A A;  4ZIB A;  2DDZ A;  4XTW A;  4H2U A;  3LSQ A;  1YFS A;  3QTC A;  3IKL A;  4XU0 A;  4P3P A;  1WQ7 A;  2DZC A;  2A8E A;  1W66 A;  2RHS A;  2ZTG A;  3V8L A;  4YRM A;  2E1H A;  3HXV A;  4H2X B;  2ART A;  2DXT A;  1G5I A;  4Q15 A;  5K1X A;  1C0A A;  3ICA A;  2FYK A;  1PYS B;  4PG3 A;  4XTU A;  3MQZ A;  1E1T A;  1X2G A;  2ZR2 A;  4RQE A;  2IY5 B;  4P3N A;  3HRK A;  1B7Y A;  4K86 A;  2DU5 A;  4TVW A;  1GGM A;  2DTO A;  2QHU A;  1H4Q A;  3A7R A;  1NNH A;  3PCO B;  1ASZ A;  4LVM A;  2CIM A;  2DKG A;  1JJC B;  2DVE A;  1FYF A;  3VQW A;  2XGT A;  3RKY A;  1B8A A;  1ADJ A;  4XTY A;  1EIY A;  4H2V A;  3HXW A;  4XTX A;  4CS4 A;  3VQV A;  4YRS A;  3UGQ A;  1ADY A;  4YYE A;  3IAL A;  4H2W A;  4HWS A;  2E65 A;  1USY C;  1HXD A;  2ARS A;  3IKM B;  3HXU A;  5F5W A;  2RHQ A;  3L4G A;  1J5W A;  3IG2 A;  3UH0 A;  4YRC A;  2XTI A;  4DPG A;  3OD1 A;  2ZIM A;  4XEO A;  4DQ2 A;  4YCV A;  4G84 A;  1G51 A;  4E51 A;  2CJA A;  2Q7G A;  4H2T A;  4H2X A;  1NJ2 A;  3I7F A;  4TTV A;  3RGL A;  2I4N A;  5KNN A;  4LVI A;  4XU1 A;  2E5A A;  3P8T A;  3LSS A;  4UP8 A;  1PYS A;  2DTI A;  2ZT8 A;  11AS A;  2J3M A;  3WQZ A;  3REU A;  4EX5 A;  1BIA A;  2QHT A;  3UGT A;  2ARU A;  3G1Z A;  3P8Y A;  2DQ0 A;  1H4S A;  3W3S A;  3R07 A;  2G4C A;  4UP7 A;  2ZT7 A;  3NET A;  4UPA A;  2QHV A;  2DQ3 A;  3HFZ B;  3A7U A;  4WI1 A;  1H4T A;  1JJC A;  4ZTZ B;  2I4M A;  4P74 A;  2ZNI A;  3CMQ A;  3REX A;  2C7I A;  4YRJ A;  3V8K A;  2EL9 A;  3A32 A;  12AS A;  4YRE A;  2QHS A;  4HWR A;  1IL2 A;  4XEM A;  2AKW B;  4TQD A;  4O2D A;  1ATI A;  4CS3 A;  3EFR A;  4LVJ A;  2E10 A;  4HVC A;  1KMN A;  4P75 A;  2ODR C;  1QF6 A;  4P72 A;  1WPY A;  3BFM A;  1SES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...