3DSQA

Structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
278
Chain Sequence
PPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Desulfitobacterium hafniense PylSc, a pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
molecule keywords Pyrrolysyl-tRNA synthetase
total genus 80
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3dsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3dsqA02
3RUXA 1G51A 2ZT5A 2ZCEA 2C7IA 2ZT8A 3QO5A 4LNSA 3HFZB 2CGHA 1O9HA 4P74C 1H4QA 3A31A 4HWSA 3REUA 1HC7A 4KR3A 3VQVA 3E9IA 1GGMA 2CIMA 2ZTGA 4O2DA 4EX5A 1B70A 2QHSA 4P73C 1FYFA 1USYC 4YRCA 4XTUA 1NJ1A 2ARTA 4XEMA 4WJ3M 2Q7HA 2DJZA 4EO4A 3RF1A 1NYRA 4Q6GA 1SRYA 4TQDA 4UP7A 3VQXA 2HEPA 3TEHB 1B7YB 3VBBA 3UGQA 4XU1A 2QHUA 4H2VA 2E3CA 3G1ZA 1LYLA 4H2UA 4YCWA 1NNHA 2IY5A 2DDZA 1YGBA 4PHCA 3NEMA 4ZTUB 1WQWA 3HY0A 4YRQA 4P73A 1USYA 3TUPA 3M4PA 4WI1A 1SETA 2E41A 2QJ1A 3A7RA 4RQEA 2XGTA 4H2TA 4TVYA 2DXTA 1EVKA 1SERA 5C53B 4OP0A 4TTVA 4XTXA 3IALA 4PG3A 1E22A 1PYSA 3A7AA 2DU5A 1WLEA 4DQ2A 1WNLA 3RL6A 3RKYA 3UH0A 3PCOA 4YREA 3V7SA 2ZNIA 3IG2A 3RKWA 4ZIBA 2YI9A 4TVWA 2CJ9A 2DTIA 2Q7EA 3LSQA 1B76A 2ZT7A 2ZT6A 3I7FA 4Q15A 2E1HA 2ZGWA 2RQ6A 3HXUA 3HTZA 2EJ9A 2EL9A 1J5WA 3RGLA 1NYQA 3MEYA 4CH3A 1EOVA 1X2GA 1NJ5A 5C52B 2EAYA 3V8LA 1QE0A 1L0WA 4H2WA 3BFMA 1VQZA 2ZXFA 2ARSA 2J3MA 3NENA 4KQEA 5E3IA 1HXDA 4XU2A 1X54A 2I4OA 3MF2A 4K88A 4P71C 2HNIA 3QTCA 3A74A 4CH4A 2P5IA 3BHPA 1G5HA 3BJUA 2PMEA 2JVDA 3QNEA 3CMQA 3HFZA 2DXUA 3P8VA 1X2HA 1EIYB 3V7CA 1E1TA 1B8AA 2DVEA 2YIBD 4YP0A 1NJ6A 2ZINA 2DTOA 3PCOB 3NELA 1O9GA 3ERRA 1ASZA 3QO8A 4YCUA 3HXXA 2Q7GA 4RQFA 4YYEA 3WQZA 1BIAA 4XTVA 4P71A 2EJGA 4YRRA 4KR2A 1WYDA 2C8MA 4YRJA 4DPGA 4CS2A 2E10A 4CS3A 5C51B 4P72A 2ZNJA 2QHVA 1N9WA 3REXA 1YB3A 2DTHA 2J3LA 1H4SA 4P3NA 3HY1A 4HWOA 1EIYA 3EFSA 4YRTA 2CJAA 4P3OA 2IY5B 1C0AA 3LSSA 4CS4A 1NJ8A 1RIQA 3MF1A 11ASA 5HGQA 1B7YA 3LC0A 4E51A 1E1OA 4UP8A 2ZR3A 4G85A 3RIRA 3UGTA 1G5IA 3A7UA 4XTZA 4YRNA 4H2YA 4P72C 3L4GB 2I4LA 1E24A 2I4NA 2EJFA 5F5WA 3ICAA 1B70B 5K1PA 4HVCA 3HXVA 4WF2A 4YDQA 2CJBA 2I4MA 1W66A 4XEOA 2FYKA 2ZIMA 3RKXA 5ELNA 2E5AA 4OLFA 3L1AA 2DQ3A 2PMFA 3HXZA 4H2SA 2Q5IA 2DEQA 4J15A 4XTYA 3TEHA 4XTWA 2YI8A 3M4QA 4H02A 1BBUA 4X5OA 4YRLA 4TVAB 2DQ0A 2G4CA 1EFWA 2R72A 1PYSB 3HRKA 4AH6A 3HXWA 1HTTA 2AKWB 4YRKA 4UPAA 2DU7A 2YIBA 2AMCB 1Z7MA 2E65A 3KFUA 4HA8A 4XU3A 3HXYA 12ASA 2YIAA 2AKWA 4ZTZB 1EVLA 2RHSA 4CH5A 2Q5HA 1KMNA 1ADJA 2ALYB 4RMFA 4CH6A 2PGGA 1ASYA 2RHQA 4TWAA 4NCXA 4RDXA 4YRFA 1EQRA 3PZCA 2EWNA 4YRGA 5K1XA 3V7RA 3V8JA 1BBWA 1BIBA 4BWAA 4P75C 3RACA 4H2XA 3IKMB 4YRIA 2AMCA 4YPFA 3VQWA 1JJCA 3FJPA 4TQFA 1H4TA 1YFTA 2DZCA 4HWTA 4YCVA 4XU0A 2DKGA 3A32A 3L2ZA 2DZ9A 1X01A 3P8TA 3P8YA 2ZIOA 1YFRA 3NETA 3HRIA 1NJ2A 3E9HA 1G6UA 3EFRA 4L87A 4BW9A 4P75A 1ADYA 4K86A 3HFVA 1H4VB 3OD1A 1WU7A 4YRSA 1IL2A 3R07A 2RJZA 2ZZEA 1WQ7A 3QO7A 2PUSA 3UFGA 3TEGA 4YROA 4YRPA 2E64A 2ODRC 4WJ4A 2RHSB 1YFSA 4G84A 1QF6A 3A5ZA 3ZEDA 2ZZFA 1X55A 3L4GA 4UP9A 1KMMA 4P74A 1JJCB 2P0LA 1KOGA 1Z7NA 4YRMA 1SESA 2ARUA 4H2XB 3V8KA 2R70A 4P3PA 5KNNA 2QHTA 2ZZGA 4K87A 1ATIA 5ELOA 4TVAA 4HWPA 2XTIA 1X56A 4HWRA 2RHQB 3VQYA 2ODRD 3DSQA 3W3SA 2ZR2A 3A5YA 1WPYA 2ALYA 3IKLA
chains in the Genus database with same CATH superfamily
3W7WA 2ZT5A 2ZCEA 2JJ1G 2XNDG 3N2KB 3BEHA 3P32A 5A2QN 4U7NA 2WLLB 4FLZA 5IY5C 3AK1A 1JVMA 1BE3H 3VQVA 3E9IA 1GGMA 2ZTGA 1HWYA 5HFLA 1NI8A 4JI6B 1B70A 2QHSA 4P73C 4LFAB 4CC5A 4DW1A 1IVSA 2ZDIA 3OGCC 5GTHZ 2ARTA 1IBLB 4KXRA 4MTGA 2Q7HA 2DJZA 4EO4A 1H8EG 2YC0A 2LJ2A 3K5NA 2P5OA 4Q6GA 1N33B 1I5YA 4GT1A 4TQDA 4Z1MG 1FXKA 3E8BA 4YJ3B 2HEPA 3VQXA 3CCJV 3TEHB 1B7YB 3TXQA 1BGYH 4O4HB 4DV4B 1MOFA 1V55C 4H2VA 2E3CA 5B1BC 4B7KA 4UCOA 2GSMB 1NNHA 4YCWA 4MVZA 1F4MA 2DDZA 1AP6A 1QQCA 1YGBA 4JYBA 1KP3A 1WQWA 3RYFA 3UKMA 1SETA 2E41A 2QSAA 3BRCA 1L0LH 1TUEB 1GM9A 4BIUA 1SERA 3WB2A 3CCQV 2Y4UA 4J42A 4XTXA 4NXNO 3A7AA 1ZTEA 3RYHB 5LMNO 1B04A 4GKJO 1WLEA 3GVMA 4X1YA 3ZIAG 3K06A 3UH0A 2ZNIA 5EBWC 3RWRD 4I4TA 4AI8A 4DV0O 4EB6A 5IWAB 4FJCC 1OCZB 2YI9A 3IJ4A 3IC7A 2QWNB 1TGOA 5BY1A 4JZGA 1FS0G 1SQPH 2ZT7A 2ZT6A 3I7FA 2ILMA 4YIOA 4Q15A 2F4VB 3AG3B 1QLEB 4ASUG 3STLC 1IXMA 2EJ9A 3BY6A 1KYOF 2BE3A 3FAVB 3HKBA 1QU7A 4DV3O 4GX1A 4DR6O 3L70H 5IT9N 5LP6C 4JI1B 1NJ5A 2EAYA 2PYLA 3V8LA 4G28B 1QE0A 4J41A 3CCVV 2FL4A 1VQZA 3B4SA 1DTOA 5ITZA 4ZHQB 2ARSA 1AJPA 3K59A 3W7TA 4LH6A 4ZHQA 1MZFA 2C2AA 4XU2A 1X54A 5FPOA 1I94O 4UFZA 3FX7A 3SPIA 1WN7A 1Q3EA 5DECA 1NVPB 2Q0AA 1H2SB 3ASNC 3ZX6A 2P5IA 1OV9A 1LUVA 2P4KA 3L9DA 1Y6XA 1SKVA 4KHPB 1WP8A 3FFQA 1EIYB 4B7EA 2KKWA 3ICXA 3CHXA 4DW0A 4X66O 4YP0A 1FXKB 1Q5OA 1Q6HA 2ZINA 1WP7A 4X9QA 3PCOB 3NELA 4FFKA 2CE4A 3E8GA 3SPCA 3QO8A 2QKCA 2VWJA 3BAAA 3AG2C 1N34O 4JAAA 1OCRC 3WQZA 4UVCA 1SQGA 3OE7G 3DGEA 4YRRA 1AILA 4KR2A 1L0NH 1NBMG 4WF9V 4NYKA 4OPAA 3ZHSA 4QJFB 2EJ7A 4JV5O 1XUQA 4YRJA 4DXWA 3SJBC 1HNZB 5JVDA 4B3MO 2VQFO 3VOUA 3F7VC 3JD1A 4P72A 4I0XA 3MD0A 4KL1A 2JRIA 2EINB 3JALB 1YB3A 2J3LA 3K9SA 3Q4HB 3Q4HA 4P3NA 4HWOA 1EIYA 3H9VA 4C7UA 2DMXA 3EFSA 4YRTA 2CJAA 1W0JG 2IY5B 3LDDA 1RIQA 1XNRB 4TSFG 5GW7A 4MVUA 5HGQA 3JSNA 1YJ9V 3OEHG 1G4YB 4E51A 1NJIW 1E1OA 5CB4B 3T4DA 3RIRA 5JH7B 1N8RW 4X1KA 2BCCH 2P22C 1NT2B 4J7KA 2P67A 4YRNA 5IWAO 4J11A 1H2GA 4BW5A 4P72C 4O4JB 1V54C 4MW3A 2I4LA 1UPGA 3BVOA 2I4NA 1IURA 5F5WA 2UUAB 1LR1A 5IJ0B 1B70B 1GM7A 3T4ZA 1CEZA 3CPWU 2L35A 4OGQB 2I4MA 4JPRA 4LFAO 2FYKA 3RKXA 2EIJB 3E35A 4OX9B 3CRCA 5BMVB 3JATA 5KMGB 3M7MX 4NTYA 2PMFA 1JMKC 3HXZA 4DR7O 2DEQA 4BIZA 4JTCB 2QGNA 1BMFG 3ZS8C 5L3BA 1XNQO 3MHHC 1FJGB 3D36A 4JI7B 1RM1B 4TVAB 1HNZO 4DUYB 2R72A 4UV8A 1PYSB 4DUZB 5LOVB 5CA1B 3J7AU 5EBMC 1XILA 1M56B 4UUJC 4FFBB 2EIKB 2AMCB 3CSXA 2YSUB 4GX2A 1Z7MA 3UCSC 3JAMN 3KFUA 3CC4V 2LW7A 1ZX3A 4WFAV 3L72H 3HXYA 3OMIB 1K4CC 4NTWA 3JASA 2EX3A 2JS3A 3ETGA 4MS2A 5D5QA 5DM6V 2YUAA 3ETEA 2Q5HA 1QVFU 1ZUQA 4RMFA 4CH6A 4X65B 5JCOA 3W7UA 4RDXA 1EQRA 4CZZA 3V7RA 1P84F 1Q82W 1F7YA 2DN9A 3JD2A 2WLJA 1BIBA 4BWAA 1HR0O 1JPXA 4ICGA 4RUFA 4IYIA 4WBNA 2VQFB 3RACA 2JGDA 2UXCO 2LGWA 1EZVH 4MTOA 4AQYB 4IGGA 4YPFA 1DF5A 4PD4F 3OEEG 4JYAB 1VQ6V 4DV1O 3ASOB 2EZOA 3K0GA 3FJPA 3O9OA 3X2QB 1Q90D 1YFTA 2GUZB 4GKKO 5L3CA 3ZMUA 2R9RB 4XU0A 5JCOC 1YIJV 3P8YA 2JEXA 4B3TB 3HRIA 3RFRA 1NJ2A 1KECA 1AI6A 1R6KA 2Y69B 3JAWA 3K57A 1YTFB 3EFRA 4MTXA 3R66A 1NTKH 1R1BA 1YHQV 1ADYA 4K86A 1JQ0A 1H4VB 1WU7A 3K5MA 4J10A 5LL6Y 2RJZA 2ZZEA 1Y66A 4YROA 3SDLA 1N0JA 4DV4O 5B3SB 1QF6A 4PA9A 4HZ3A 2QWOB 1DK1A 3T2MA 4G84A 4WFGA 5IYDO 3ML0A 2ZZFA 2IJHA 2E75B 1BHAA 4LP8A 2P0LA 3J80N 1GN4A 1PD3A 1E1RG 2Q5ZA 3JYCA 3C3SA 2Q68A 4N21A 4H2XB 2R70A 3IC9A 2HFEC 5KNNA 2QHTA 1QVGU 1MABG 1ATIA 2YXYA 4MSWC 4TVAA 4B3RO 4U3JA 3K04A 2K1EA 3TXSA 3HR0A 2ODRD 2OCCB 1S72V 2CH7B 4DUYO 1QBZA 4H13B 2W6JG 3CMAV 3CCEV 4JV5B 2ALYA 2YI8A 2KB1A 3ZHRA 3LSUA 4JYAO 3T1HB 4YXWG 1CPYA 1P7BA 3QO5A 3FKSG 4K0KB 1RPOA 4DR1O 1H4QA 3A31A 3PN1A 1VQLV 4UV9A 4R8CA 3REUA 1COWG 1HC7A 4DK0A 1GMGA 4IHJA 4NKGB 1JJOA 1N4CA 2BTQB 3QVNA 2GUZA 3R65A 1KB9F 1FYFA 1USYC 1UJWB 2BOBC 2QTSA 4XTUA 1WA8A 2CDYA 4X66B 1S5JA 4JZ2A 4WJ3M 2ADQB 2OCCC 3D3IA 2WLIB 2IBZH 1NYRA 4RO2A 1SRYA 4O2AA 4RWUA 3CXHF 2XAFA 4FIPC 3KG2A 5BMVA 3HKBB 3UGQA 2P7TC 2XAGA 5KX5A 3G1ZA 4CC6A 5EZYA 1FKAO 2IY5A 4LC1A 4MVMA 2Z5UA 2AHZA 3NEMA 4YHHO 3GWKC 3CCSV 4ZTUB 5FNVA 1D5NA 5L3GA 1USYA 2Y0PA 4WI1A 5LGUA 3OD4A 1D5AA 2XGTA 5JWPA 5IYBO 5CA0A 2XT9A 2W6IG 3QG5A 2KG7A 1EVKA 1WJZA 2N04A 1FPOA 1URFA 3GWOA 4DV2O 1E1QG 5H6QA 5KA6A 1GTOA 3IALA 4PA6A 1PYSA 2WLKA 4K35A 5KHIA 1P4RA 4B3SB 1NTZH 3CRQA 5CMUA 3V7SA 3IG2A 4BAYA 2F93B 3OM3B 3RKWA 4ZIBA 4UCRA 3TJTA 4I0XB 3RYCA 1B76A 2YICA 2VRZA 4XDKA 2VWKA 5JVDB 1KP2A 2E1HA 4JAUA 3JAKA 2RQ6A 2B5UA 3E8HA 3JD4A 3HXUA 1GN3A 4DRXB 3T1HO 3HTZA 1WNSA 1JFFA 2UUCB 1N32B 3RGLA 4O4HA 3K58A 2Q4PA 4BIOA 5C52B 1GM8A 4QGPA 2EINC 2D3OW 5JJNB 5KHGA 5L3EA 2UXXA 4JI8O 4DV6O 3AK3A 3B8NA 4GCZA 3SJAC 2UXNA 4O4LB 4JI3O 3G4SV 2QWQB 1PKXA 1NH2B 2EZPA 3A74A 1S77D 2Y48A 3CRMA 5LYJB 2E5LO 3HKCB 2JVDA 4AILC 1KKCA 2DJVA 1QLEC 3AG1C 5JJEB 3HKEB 3IFXA 2PY5A 2ITCC 5IYZB 3RVZA 1H2LA 4TT3G 4B3RB 2YIBD 1FFXA 2H3OA 3DC6A 1WB7A 4D7TA 1ASZA 2UXDB 4O4LA 5H9CA 1R6TA 1HDJA 4FK5C 4RQFA 1BCCH 4MVQA 4XTVA 5BXZA 3WFVA 4E4EA 1IBMO 2EIMC 2KG7B 1NH2D 2FYUH 4JI5O 2XUMA 4LF9B 3J81N 4DRXA 2E10A 1K97A 3JAKB 3I55V 2QHVA 1R3LC 2CTWA 4X20B 3WG7C 4R50A 1OCZC 1I7FA 2B9ZA 4QE7A 3CD6V 1H4SA 2ZT9B 3CYOA 3A8TA 3HY1A 2UUCO 4P3OA 1C0AA 3LSSA 3ZN1A 4GKKB 1NJ8A 5DEDA 3K5OA 4FLVA 2E74B 5LA6B 3RYHA 4D7SA 1B7YA 1RSOB 2FB5A 1AR4A 1XEQA 1GH6A 3OR7C 4G85A 3UGTA 4HBNA 4I9WA 3P30A 2HJDA 1SZXA 3A7UA 2YIDA 2PF4E 2Q67A 1WA8B 2QWRB 1IXBA 4JI6O 3L4GB 1L8DA 1VARA 1B06A 3SJQC 1IX9A 2XAJA 3ZBHA 1IBLO 3WG7B 1KD1W 2X0LA 4LCUC 1S3JA 5A9GA 3B09A 1EM1A 1ENVA 4TOIA 1EN4A 4PA7A 4L8JA 2B1IA 4XEOA 4OPHA 4FLWA 3G71V 4FLTA 2HKOA 3H1KH 2DQ3A 3HKDA 4WCEV 3DC5A 4OX9O 3ZHTA 4H2SA 3D8CA 1K4DC 4LF4O 2Q5IA 3AG4C 1YCIA 1ZAUA 2Q8VA 3JD0A 4XTYA 5L3FA 3OUSA 1Q7YW 3N2GB 1Z5VA 5B1NA 3P3NA 2X7RB 4JF3A 1BBUA 4H02A 4X5OA 1K73W 4EFEA 3UO3A 2G38A 3HRKA 4AH6A 4Z1VA 1U96A 1AR1B 4P9OA 4YRKA 2HLDG 1CXZB 4UPAA 2DU7A 1SF9A 4YHHB 1S76D 3MHSC 3CB2A 1N36B 4EKWA 3N2KA 1M1KW 1EZJA 1NR7A 4HA8A 2IW5A 4XU3A 3ZMTA 1VEWA 4YY3B 5LMNB 3RYIB 2AKWA 3ZCCA 1FYJA 4UCSA 1R3JC 1N0NA 3S3WA 1FAFA 3OTOO 4CH5A 2QR4A 1AR5A 1PL4A 3CCRV 4TV9B 4MW8A 2ALYB 3IAYA 2PGGA 4KUMA 1ASYA 2VQEB 4TWAA 2UXBO 2ZE8A 4FM1A 1YJWV 1ORQC 5K1XA 1XOUA 2EJRA 4UCVA 4UB8Z 5B5EZ 1IBMB 1K34A 5DN6G 1VQNV 4FZ1A 4YJ3A 4DV7O 1HR0B 1GO3F 2A8EA 4H2XA 2WWWA 4TUYB 5C8YA 1YZBA 4PDLA 1MA1A 3ZRXA 1F51A 2DOSA 4LWSA 1TVKB 1H4TA 1VF6A 1YEWA 3CWBH 5LMUB 1PV0A 2DZCA 3CX5F 5KHKA 1WPBA 2F43G 4LF6B 2DKGA 4DV3B 4WFFA 4LVMA 3SYOA 4P30A 3P8TA 2ZIOA 5LGTA 3TETA 1GKFA 1V55B 2HHHO 3CC2V 3HPLC 5IJ9B 1VQKV 3OW2U 3B40A 2JDIG 2CTQA 2P90A 3CXCU 2IJIA 4X64B 3W7XA 3HFVA 3H1HH 3OD1A 1BL8A 4U3FH 1ROPA 1QLNA 1NS1A 4B3MB 3QO7A 2Q73A 4DR7B 1N34B 4J80A 1H2MA 1YSCA 4PDMA 3LUTB 4JI7O 2HVJC 1YI2V 1X55A 3L4GA 1Y4MA 3H01A 4P74A 3LNNA 2OIEA 1BT8A 1Z7NA 4TV8A 4YRMA 2JS5A 1SESA 1HP8A 3DXRA 4MTFA 4O2BB 4DR3O 2UXBB 2XOKG 4ZOLA 2XHBA 2W0FC 3ZHUA 4K87A 4O4IB 3ABTA 4GUNA 4F6EA 1SS3A 4K8ZA 3UQ8A 3B8MA 2RHQB 2ZDIC 1R6NA 2A3QA 2F23A 4H33A 3SYPA 1KU9A 2YDEA 3W3SA 2ZR2A 4DV2B 3A5YA 4X1IA 1BSMA 4FM0A 4E2LA 3ABLB 1AVMA 1FXKC 2ZD9A 4TV9A 4DR5O 3S3XA 4IIJA 3RUXA 3OAAG 5KMGA 3H1IH 3OGIB 3NR7A 2C7IA 2ZT8A 1NTMH 1OCOB 4WFBV 3DXRB 4LNSA 5KA5A 4P74C 1O9HA 3RYIA 3BPZA 3OUFA 4YY3O 1UFIA 1D2DA 4IL6Z 2OYQA 4KR3A 1T5EA 3B77A 1SZTA 4O2DA 1XNRO 3RVYA 5IYCO 1XMOO 3TK1A 1XHZA 3P3PA 4BR6A 1NJ1A 2RMKB 2YXLA 4X1KB 4JYYA 1SA0A 1AROP 4PDVA 4U7OA 4ZBMA 1NZ6A 5LXTB 4YJ2B 5LP6B 1K8AW 4LF8B 3VBBA 1LUWA 4DUZO 2LP7A 3E2EA 4XU1A 3SPGA 1WPXA 4DV5B 1Q6IA 4H2UA 3CRAA 5LYJA 2FKXA 4GYCB 1H2KA 4KHPO 4PHCA 1HW7A 1DF4A 4Z2WA 2M7WA 2IU0A 4P73A 4LWSB 2Q6AA 3M4PA 4JTAB 4DR4O 5LHIA 4J7ZA 4I7ZB 2IU3A 3WU2Z 3AG2B 1VQ7V 3STZC 2VQEO 1TA8A 4TUYA 1GRJA 5C53B 1JCHA 2JIZG 4OP0A 2DWEC 4G2KA 4TTVA 3CEIA 1SQXH 1M9NA 2Q0OC 5JH7A 4PG3A 4LNUB 2DU5A 4YIPA 2QKSA 4JI5B 4DQ2A 4PJ0Z 1WNLA 3SGIA 3RL6A 3RKYA 3CP1A 3ZRWB 1Y76A 3L73H 3PCOA 4YREA 3U11A 4ZKIA 3ASNB 4LBEC 2D2CB 2Q9LA 5IE9A 3MQZA 3ETDA 2LQTA 1KUQA 3CC7V 4TVWA 4ZI7B 3AG1B 2Q7EA 3IGAC 1Q6UA 4J9YB 2DYSB 2GTSA 2FTKA 4AHCA 3ZMSA 2HP8A 1XMOB 1XL4A 4DR5B 2OCHA 5KHHA 5F2VO 2WSSG 5J2TA 2GTAA 1NYQA 5EIBD 3MEYA 4CH3A 4X8AA 1EOVA 1X2GA 5KLVH 4J9ZB 1FFTB 3UM7A 1L0WA 4H2WA 1PNKA 3APOA 4Q20A 4QE9A 2LW1A 2UUBO 1HXDA 2PTMA 3MF2A 4LFCB 4K88A 5B1AC 1M93A 2P06A 4CBCA 2DYRC 3KCXA 4JI3B 2HVKC 2HNIA 3OMAB 3QTCA 4CH4A 3BHPA 3KCYA 1G5HA 2H94A 3CMQA 3HFZA 2F95B 3P8VA 2E5LB 3V7CA 4EB6B 1RFYA 1B8AA 5LP6A 1JOYA 3OR6C 5B1AB 4ABMA 4X1IB 4YCUA 3HXXA 2Q7GA 5FL7G 4YYEA 4H44B 5ITZB 2AGAA 4N23A 1Q43A 4JI2B 3BABA 1M5IA 3K3WA 4F6RA 3AG3C 1QR8A 3K08A 3ZMVA 3FAVA 2C8MA 4DPGA 2HR3A 1J5EO 1YTFD 4CS2A 1EN6A 4CS3A 3RYFB 2QTOA 4FVMA 3K0DA 2DTHA 2MW2B 1DGSA 4PDRA 5EIBC 3KZIZ 5FNVB 4LVIA 4CS4A 4X65O 3MF1A 3EXAA 5H2FZ 3E86A 1B3QA 1BHBA 1ZWIC 3LC0A 2YXHA 3ABMB 3CMEV 3OFNG 2A06H 2UXCB 4NTXA 4TV8B 3SPHA 2ZXWB 2ZQMA 3F5WC 1QHTA 4H2YA 3C90A 3PJSK 1YVWA 1W2BU 2BSKB 2JJ2G 1X4TA 5HFMA 5J2TB 3UT5B 4FLYA 5K1PA 5EK0A 2KQXA 3LDEA 4WF2A 3NXSA 1GN6A 1W66A 4QIWF 2ZIMA 2XASA 2YEVA 2HG5C 2E5AA 1THZA 3AEIA 4OLFA 1B6QA 1FXHA 2IH3C 1EN5A 3SJCC 3EHBB 4ZI7A 3ZMZA 1XL6A 3E89A 3JARA 1OCRB 4GX0A 1XDCA 4J15A 3TEHA 3FYEB 4LF8O 2K9PA 3M4QA 5EYPA 3D3QA 4LVKA 1J95A 2DQ0A 1EFWA 1TVKA 1NU1H 2R9IA 5CBHA 3HXWA 1AI7A 1K7DA 3U10A 2H8PC 4PV1B 4UVAA 1Y74B 2Y69C 4TWKA 2V4DA 2E65A 1KBHA 3DTUB 4HNAB 1PNMA 1S5LZ 1KMIZ 4WBNB 1N36O 1Q86W 12ASA 4JI0O 1R3IC 4ZTZB 1EVLA 3RYCB 4X88A 1KMNA 3FB7C 5EYPB 3BCCH 1ADJA 4UCUA 4LF7B 1AP5A 2RHQA 3D36C 3RW0A 2UUBB 1Q81W 3ZRWA 2NR5A 2NNUA 3ABKC 3PZCA 5BR8B 4YRFA 3V8JA 5KUMA 2DE0X 3K9AA 4HAMA 2X6AA 5B66Z 3HKDB 2F4VO 1PM9A 5LXTA 3G67A 2QA4V 1I94B 3MAQA 2ZE5A 3IKMB 4YRIA 4X62O 1P7GA 2ODMA 3F7YC 4I55B 4LVJA 2AMCA 2Z0AA 5TISZ 1GAXA 3E22B 2AXTZ 4UVBA 3L71H 4R6ZA 3ZRVA 5LHHA 1HNXO 1BQZA 2EILB 4LVLA 3N27A 2AZ0A 2CGNA 3HB3B 4W4KA 3A32A 5D5PA 3G80A 1ZL8A 4FMTA 2P6JA 1YFRA 3NETA 4DYLA 5J2UA 1G6UA 2ZE7A 4PI2A 1K3EA 4JI8B 1K92A 2A9HA 2LFRA 1RSOA 1RM1C 1OZ0A 3E8FA 3JAWB 3CE2A 5JJJB 2YS8A 4YRSA 1IL2A 3R07A 5EBLC 1WQ7A 1FJGO 2WA4A 4K3AA 5FLXN 2PUSA 3TEGA 3OTFA 3AG7A 1K33A 4YRPA 2E64A 3SR2C 4K8XA 2ODRC 4WJ4A 2RHSB 2O57A 3CCLV 4JGSA 2EILC 1PPJH 1H8HG 3ZEDA 4IHJB 2R9AA 4O2BA 5B1OA 5CN0A 1KMMA 4JI4B 2EBOA 2EIKC 2A0LA 5E1AC 2ARUA 1KKDA 1JJ2U 4P3PA 5CB4A 1W59A 1M4UA 4FFBA 1KC8W 4IIJB 1V54B 2RCVA 2XTIA 1X56A 5LOVA 3L74H 4B08A 4B3SO 3DSQA 2CH7A 2ZM6O 4GZRB 4JI2O 4IYHA 3E83A 2GDSA 2Q69A 3K79A 1WPYA 1US6A 4U3JB 3IKLA 4P2ZA 2P4VA 4O4IA 4DR1B 1G51A 4NXMO 4LFBO 3O65A 1YXBA 2JGUA 1MNGA 5GTIZ 3HFZB 2CGHA 4EEQA 2MK3A 1ZL8B 2NLJC 1Y74A 1JR9A 4K0KO 3K03A 4HWSA 2BSKA 2CIMA 4RAIA 4DV7B 1VMGA 1BQ0A 4MVSA 1VQOV 2QE7G 4EX5A 4NVPA 2M6YA 3ASOC 5CBGA 4YRCA 5CA1A 1VQ4V 2GBOA 4X89A 2FMLA 4I50A 1U97A 2EULA 2WLMA 4UB6Z 2UUAO 2CUGA 4XEMA 3RN4A 3T1YO 3RF1A 2Y4TA 1HNWB 1OCCB 2B1GA 4UP7A 4QPJA 1V9PA 1LNQA 5KAIZ 3RBZA 5H6RA 2DWDC 2QHUA 1LYLA 2AW9A 5GONB 1AI5A 1GN2A 5FPRA 3UT5A 4P9PA 4DK1A 4H0LB 4LF4B 3HY0A 2NN4A 4YRQA 5BZBA 3L75H 5B3SC 4OXSA 3TUPA 2GV9A 1XBLA 4IT5A 4LR3A 1VIBA 1NQTA 2QJ1A 3A7RA 4RQEA 4H2TA 4HNAA 4TVYA 3JALA 5E79Z 2DXTA 1SQBH 2PZSA 4O4JA 3SYCA 1EBOA 4PELA 3JCZA 4F6RB 2QDOA 2HJFC 5JQGA 1E22A 2F66C 2X6CA 3ABMC 2DYRB 4JAVA 2OIGA 2WAMA 4LF9O 2ARHA 3AK2A 4DV0B 2ETNA 3A0BZ 2WPDG 2IH1C 3FB8C 1Z5WA 3N2GA 3OTOB 2L6LA 2CJ9A 2DTIA 1RP3B 5LMUO 2RNBA 3LSQA 4JI4O 1HNXB 1J5EB 2YEVB 2QM4A 5L3DA 3LDCA 1OHHG 4DV1B 3JCUZ 3HKEA 3OT7A 1WAZA 2ZGWA 1GK9A 5EZYB 2OWOA 2ADPA 2Y0IA 4LFBB 4DR6B 1L1FA 3HKCA 2EL9A 2QWPB 2QEXV 1J5WA 1YF2A 3APQA 3WB1A 3JSLA 1X59A 2W0XA 4YJ2A 5BR8O 3RT3C 1XMQB 3A0RA 2CTPA 4FZ0A 3BFRA 2X6BA 3BFMA 3H1JH 2ZXFA 1SA0B 3GB7C 2VS0A 2J3MA 3NENA 4KQEA 1I0HA 5E3IA 4J7JA 2AZ2A 2I4OA 4P71C 4X62B 4XDJA 2E76B 3OMNB 2EIJC 4W4LA 1VQ5V 2JK5C 5LA6A 4KFMA 5IY5B 1KQSU 2CGOA 3BJUA 2PMEA 3QNEA 1IDSA 3U0ZA 1EFRG 4QPKA 1QCEA 1XI1A 2PI4A 2DXUA 1Y67A 4XBFA 3K5LA 1XNQB 1X2HA 3ZHQA 1E1TA 2DVEA 3WB0A 3H1LH 4O2AB 4X20A 1XQ8A 2LFSA 1Z2GA 1PNLA 1NJ6A 5AG2A 2DTOA 1O9GA 3ERRA 1Y76B 5J9PC 1S0VA 3THOA 1VQ9V 2ZXWC 3CS5A 3RGBA 1VP7A 3TGUH 4FM2A 1BIAA 3BA8A 4B3TO 2UXDO 3ETQA 1VQ8V 5JQGB 3UO2A 5CA3A 1P49A 4WFHA 2BTOA 4P71A 2EJGA 4XDLA 4UCTA 2BTQA 5B1BB 2UU9B 5EC1C 5LHGA 1FD9A 1WYDA 4HT4A 2XAQA 2WLHA 3FB5C 4LF5B 2CTRA 1MSDA 5C93A 5C51B 3M8AA 1H2NA 2ZNJA 1FFXB 2F1MA 1N9WA 3REXA 5H5NA 1ZLZA 1VQPV 1AI4A 2DYSC 1XHXA 1DLBA 1XMQO 1E79G 4JYCA 1G1XB 4I4TB 3SPJA 11ASA 1VF5B 3CJHB 5KHJA 1NR1A 3CCMV 3FB6C 1F23A 1TAEA 1AJQA 1IBKO 1K5QA 4X1YB 4WFEA 2ZM6B 4MT8A 4UP8A 2ZR3A 4PA4A 1JA8A 5CBFA 4FLUA 2GHYA 1G5IA 2PYJA 4DR2B 4HYOA 4XTZA 4UXNA 4I50B 4NXMB 3T1CA 3SYAA 1E24A 1S5HC 1YDXA 5IDJA 5IYZA 3I56V 3M99B 2EJFA 3ICAA 5EC2C 1JFFB 3KKYA 1RPRA 2WA3A 4HVCA 4QNHB 3HXVA 2OT5A 1K5SA 1I08A 2OTJV 4YDQA 1OCOC 2CJBA 4F4LA 3MDSA 3ZRSA 5KX5B 4A5UB 5ELNA 2V7QG 1M57B 4RUEA 1M56C 3L1AA 5GONA 4DV5O 5KUKA 1H38A 4JTDB 1PP9H 2PI5A 4NR1A 4XTWA 4KP4A 3QF7A 2LGQA 3CRRA 2LO1A 1YITV 2XTAA 4YRLA 1BS3A 3EFFK 1CP9A 2G4CA 2IJKA 1I5XA 2ZKOA 4LNUA 1OJHA 1QR9A 1HTTA 2AKWB 2A79B 3JD3A 2YIBA 1NVPD 3ZN0A 3W7SA 2AHYA 1SC5B 3LNMB 2QM7A 1M90W 1R73A 2WLLA 2YIAA 2IM9A 2RHSA 1OCCC 4FLXA 1BZKA 1IBKB 4JASA 2BOCC 1VF7A 2QKAA 1F4NA 3CCUV 4NCXA 4FPPA 2EWNA 4DR2O 4MVOA 4PA3A 5IJ9A 2A7WA 1FXVA 3T1YB 4YRGA 1W0KG 4ZOLB 3AG4B 1BBWA 2UU9O 1HNWO 4DV6B 3EVKA 1ZSPA 4AQYO 4P75C 1SQQH 1N32O 3JATB 1AB3A 4LF5O 4GX5A 1MSWD 4PI0A 2JEUA 5CA0B 1R3KC 2Z3YA 3TCUA 3ABKB 1QNMA 3VQWA 1G8MA 1JJCA 4D6TH 3E22A 1XREA 2RDCA 4NB5A 4I9QA 4TQFA 3C3TA 1SQVH 2CAZC 1K9MW 3F5TA 2XAHA 4I55A 1N33O 2RN9A 4LFCO 4HWTA 4YCVA 4G27B 5C8YB 5KAFZ 1NKDA 1TUBA 2ZE6A 1PL0A 3G6EV 3L2ZA 2DZ9A 3ZHVA 1AJNA 4LF6O 1X01A 2EIMB 3E9HA 4X64O 3ABUA 1JX9A 2V1DA 3FYIB 4BW9A 1MMMA 3ABLC 4L87A 5LBQA 4P75A 2HHHB 1Q8IA 2WLIA 1VQMV 5J2UB 3A0HZ 4EFBA 3UFGA 2ITDC 4DO2A 4PHZA 4R7CA 3FD9A 5IJ0A 2WLNA 1TUBB 1YFSA 5LGNA 3G6BA 3A5ZA 1VF6C 1A32A 4DR4B 3BA9A 2IJJA 4UP9A 2CK3G 2OTLV 2JGDB 1JJCB 1IZ3A 4NXNB 2N74A 2N05A 1M57C 1KOGA 4GKJB 2ATKC 3ZJZA 2KSDA 4MVRA 3V8KA 4GLXA 2ZZGA 5ELOA 1SQFA 4DR3B 4HWPA 4HWRA 1WB8A 3I5DA 4I5SA 3VQYA 2QM8A 3CJHA 4JI1O 4H37A 4JI0B 2NS6A 3SYQA 3JARB 1MZEA 1YJNV 3X2QC 3B2EE 3JASB 3A2FA 1MG1A 4LH7A 2DW4A 4LF7O
chains in the Genus database with same CATH topology
4IIJA 4O4IA 4DR1B 5KMGA 1G51A 3RUXA 2ZT5A 2ZCEA 3T1HB 2C7IA 2ZT8A 3N2KB 3QO5A 4K0KB 2JGUA 4LNSA 3HFZB 2CGHA 1O9HA 4EEQA 3RYIA 4P74C 3BPZA 1H4QA 4FLZA 3A31A 4HWSA 3PN1A 2OYQA 3REUA 1HC7A 4KR3A 4DK0A 3VQVA 3E9IA 1GGMA 4IHJA 2CIMA 1T5EA 4DV7B 1JJOA 2BTQB 2ZTGA 4O2DA 4EX5A 1B70A 4JI6B 2QHSA 4P73C 4NVPA 1FYFA 1USYC 4LFAB 4YRCA 1XHZA 5CA1A 4CC5A 4XTUA 1NJ1A 4I50A 4X66B 2ARTA 1S5JA 1IBLB 4XEMA 2YXLA 2Q7HA 4WJ3M 4X1KB 2DJZA 1SA0A 4EO4A 3RF1A 3K5NA 2P5OA 4Q6GA 1HNWB 1NYRA 1N33B 1SRYA 4TQDA 5LXTB 4UP7A 4O2AA 1V9PA 4YJ2B 2HEPA 4YJ3B 3VQXA 5LP6B 3TEHB 4LF8B 1B7YB 3VBBA 5BMVA 3HKBB 4O4HB 3UGQA 4DV4B 5KX5A 4XU1A 2QHUA 4H2VA 2E3CA 4CC6A 3G1ZA 1LYLA 4DV5B 5GONB 4UCOA 4H2UA 4YCWA 1NNHA 5FPRA 5EZYA 2IY5A 5LYJA 4GYCB 3UT5A 2DDZA 1QQCA 1YGBA 4PHCA 4DK1A 3NEMA 4LF4B 4ZTUB 1HW7A 5FNVA 1WQWA 3HY0A 4YRQA 4P73A 3RYFA 1USYA 3TUPA 3M4PA 2GV9A 4LR3A 4WI1A 1SETA 2E41A 2QJ1A 3A7RA 4RQEA 1D5AA 2XGTA 4H2TA 4HNAA 4TVYA 3JALA 5CA0A 2DXTA 2PZSA 4O4JA 1TA8A 3BRCA 4TUYA 3QG5A 1EVKA 4F6RB 1SERA 5C53B 3WB2A 4OP0A 5JQGA 4TTVA 4XTXA 3IALA 4PG3A 5JH7A 4LNUB 1E22A 1PYSA 3A7AA 3RYHB 2DU5A 2F66C 1B04A 1WLEA 4JI5B 4DQ2A 1WNLA 3SGIA 3RL6A 3RKYA 4DV0B 4X1YA 5KHIA 4B3SB 3UH0A 3PCOA 4YREA 1Z5WA 3U11A 3N2GA 3V7SA 2ZNIA 3RWRD 3IG2A 4I4TA 3MQZA 2F93B 4EB6A 3OTOB 4ZIBA 5IWAB 3RKWA 4UCRA 2YI9A 4TVWA 4ZI7B 2CJ9A 2DTIA 2Q7EA 3RYCA 3LSQA 1TGOA 1HNXB 1B76A 1J5EB 5JVDB 4AHCA 2VWKA 2ZT7A 2QM4A 2ZT6A 1XMOB 3I7FA 4DV1B 4Q15A 2F4VB 3HKEA 2E1HA 2ZGWA 4DR5B 3JAKA 2RQ6A 5EZYB 2OWOA 3HXUA 5KHHA 4DRXB 4LFBB 4DR6B 3HTZA 2EJ9A 3HKCA 2EL9A 1WNSA 1J5WA 1JFFA 2UUCB 1N32B 5J2TA 3RGLA 3WB1A 3JSLA 3HKBA 4O4HA 5EIBD 4CH3A 3K58A 1NYQA 3MEYA 1EOVA 5LP6C 4JI1B 1NJ5A 1X2GA 5C52B 4YJ2A 2EAYA 1XMQB 2PYLA 3V8LA 5JJNB 1QE0A 1L0WA 5KHGA 3BFMA 4H2WA 1VQZA 2ZXFA 1SA0B 5ITZA 4ZHQB 2ARSA 3K59A 2J3MA 3NENA 4KQEA 5E3IA 3SJAC 4LH6A 4ZHQA 4O4LB 1HXDA 4XU2A 1X54A 5FPOA 2PTMA 2I4OA 4LFCB 3MF2A 4K88A 4UFZA 4P71C 4X62B 1M93A 1WN7A 1Q3EA 4JI3B 2HNIA 2Q0AA 3QTCA 3A74A 4CH4A 1H2SB 2P5IA 3BHPA 5LA6A 5LYJB 1G5HA 3BJUA 3HKCB 2PMEA 2JVDA 4AILC 3QNEA 3U0ZA 3CMQA 1XI1A 3HFZA 1SKVA 2F95B 4KHPB 2DXUA 3P8VA 2E5LB 5JJEB 3HKEB 3FFQA 3K5LA 1XNQB 2PY5A 1X2HA 1EIYB 3V7CA 2KKWA 3ICXA 5IYZB 4EB6B 1E1TA 1B8AA 3CHXA 2DVEA 4B3RB 5LP6A 3WB0A 2YIBD 4YP0A 4O2AB 1Q5OA 1XQ8A 4X20A 1NJ6A 1FFXA 2ZINA 2DTOA 3PCOB 3NELA 1O9GA 3ERRA 4D7TA 1ASZA 4X1IB 3QO8A 2UXDB 4O4LA 4YCUA 3THOA 2VWJA 3HXXA 3BAAA 3RGBA 2Q7GA 4RQFA 4YYEA 3WQZA 4FM2A 1BIAA 3BA8A 5ITZB 3ETQA 5JQGB 4XTVA 1SQGA 1P49A 1Q43A 2BTOA 4JI2B 4P71A 2EJGA 4UCTA 3BABA 2BTQA 1M5IA 4YRRA 4KR2A 2UU9B 4F6RA 1WYDA 2C8MA 4HT4A 4YRJA 4DPGA 4LF9B 3SJBC 4CS2A 1HNZB 4DRXA 5JVDA 4LF5B 2E10A 4CS3A 3JAKB 5C51B 3RYFB 4P72A 2ZNJA 2QHVA 1FFXB 2F1MA 4KL1A 1N9WA 3REXA 3JALB 4FVMA 4X20B 1YB3A 2DTHA 2J3LA 1I7FA 1H4SA 4P3NA 3HY1A 4HWOA 1EIYA 3EFSA 4YRTA 1DGSA 2CJAA 5EIBC 1XHXA 4P3OA 1C0AA 5FNVB 4LVIA 4GKKB 3LSSA 4CS4A 1NJ8A 2IY5B 3K5OA 1RIQA 4FLVA 4I4TB 1XNRB 3MF1A 11ASA 5LA6B 5KHJA 3RYHA 5HGQA 3JSNA 1TAEA 4D7SA 1B7YA 4X1YB 2ZM6B 3LC0A 4E51A 1E1OA 4UP8A 5CB4B 2ZR3A 4G85A 3RIRA 3UGTA 4HBNA 5JH7B 4FLUA 1G5IA 4X1KA 3A7UA 2PYJA 2UXCB 4TV8B 2P22C 1NT2B 4DR2B 4XTZA 4I50B 1QHTA 4YRNA 4H2YA 4NXMB 4P72C 3L4GB 4O4JB 1L8DA 2I4LA 1E24A 2I4NA 5IYZA 1X4TA 2UUAB 2EJFA 5F5WA 5J2TB 3ICAA 3UT5B 1JFFB 4FLYA 5IJ0B 1B70B 5K1PA 4HVCA 3HXVA 4TOIA 4WF2A 4YDQA 4L8JA 2CJBA 2I4MA 1W66A 5KX5B 4XEOA 2FYKA 2ZIMA 3RKXA 5ELNA 4OX9B 5BMVB 5KMGB 3JATA 4FLWA 2E5AA 4OLFA 4FLTA 3M7MX 3L1AA 5GONA 2DQ3A 3HKDA 2PMFA 1JMKC 3SJCC 3HXZA 4H2SA 4ZI7A 2Q5IA 2DEQA 3JARA 1ZAUA 4J15A 4XTYA 3TEHA 3ZS8C 4XTWA 3N2GB 1Z5VA 3QF7A 1FJGB 2YI8A 4JI7B 3M4QA 4H02A 1BBUA 4X5OA 4YRLA 5EYPA 4TVAB 4DUYB 4LVKA 2DQ0A 4EFEA 2G4CA 1EFWA 2R72A 4LNUA 1PYSB 4DUZB 1TVKA 3HRKA 4AH6A 5LOVB 5CA1B 3HXWA 1HTTA 2AKWB 4YRKA 3U10A 4UPAA 4FFBB 2DU7A 2YIBA 2AMCB 4YHHB 3CB2A 3CSXA 1N36B 2V4DA 1Z7MA 2E65A 3N2KA 3KFUA 4HNAB 4HA8A 4XU3A 1KMIZ 4WBNB 3HXYA 4YY3B 12ASA 2YIAA 5LMNB 3RYIB 2AKWA 2IM9A 4ZTZB 1EVLA 2RHSA 3JASA 3RYCB 2EX3A 4UCSA 4FLXA 1IBKB 5D5QA 4CH5A 2Q5HA 1KMNA 5EYPB 4TV9B 1ADJA 2ALYB 4UCUA 4RMFA 1VF7A 4CH6A 3IAYA 2PGGA 4LF7B 1ASYA 2VQEB 4X65B 2RHQA 4TWAA 5JCOA 4NCXA 2UUBB 4FM1A 4YRFA 1EQRA 3PZCA 5BR8B 2EWNA 5IJ9A 4YRGA 4RDXA 5K1XA 3T1YB 3V7RA 4UCVA 3V8JA 4ZOLB 1BBWA 1IBMB 1BIBA 4BWAA 4DV6B 3HKDB 4YJ3A 4P75C 5LXTA 3JATB 4WBNA 2VQFB 3RACA 1HR0B 1I94B 3MAQA 2A8EA 4H2XA 3IKMB 4AQYB 4YRIA 4TUYB 4PI0A 5C8YA 5CA0B 4I55B 4LVJA 2AMCA 4YPFA 3VQWA 1JJCA 4JYAB 3E22A 3E22B 3FJPA 4I9QA 1TVKB 4TQFA 1H4TA 2CAZC 1YEWA 1YFTA 5LMUB 2DZCA 5KHKA 4HWTA 4I55A 4YCVA 1WPBA 4LVLA 5C8YB 1TUBA 4XU0A 4LF6B 2DKGA 3A32A 5JCOC 4DV3B 3L2ZA 5D5PA 4LVMA 2DZ9A 1X01A 3P8TA 3P8YA 2ZIOA 4B3TB 1YFRA 3NETA 3HRIA 5J2UA 3RFRA 1NJ2A 3E9HA 1G6UA 4PI2A 3K57A 3EFRA 3JAWA 4JI8B 5IJ9B 4L87A 1RSOA 4BW9A 1ADYA 4P75A 4K86A 3JAWB 4X64B 2HHHB 1H4VB 3HFVA 1Q8IA 5JJJB 3OD1A 1WU7A 3K5MA 4YRSA 5J2UB 1IL2A 3R07A 2RJZA 2ZZEA 1WQ7A 4B3MB 3QO7A 2PUSA 4EFBA 3TEGA 3UFGA 3OTFA 4DR7B 4PHZA 5IJ0A 4YROA 4YRPA 2E64A 3SR2C 4K8XA 2ODRC 4WJ4A 2RHSB 1N34B 1TUBB 1YFSA 4G84A 1QF6A 3A5ZA 4DR4B 3BA9A 3ZEDA 4IHJB 2ZZFA 2R9AA 4O2BA 1X55A 3L4GA 4UP9A 1KMMA 4JI4B 4P74A 3LNNA 1JJCB 2P0LA 4NXNB 1KOGA 1Z7NA 4TV8A 4YRMA 2JS5A 1SESA 4GKJB 2ARUA 4H2XB 4O2BB 3V8KA 2R70A 2UXBB 4P3PA 4GLXA 5KNNA 5CB4A 4ZOLA 2QHTA 2XHBA 1M4UA 2ZZGA 4FFBA 4K87A 4IIJB 4O4IB 1ATIA 1SQFA 4TVAA 5ELOA 3IKLA 4DR3B 2XTIA 4HWPA 4U3JA 4K8ZA 1X56A 4HWRA 3UQ8A 5LOVA 2RHQB 3VQYA 4B08A 2ODRD 3DSQA 4JI0B 1KU9A 2NS6A 3W3SA 2ZR2A 4DV2B 3A5YA 3JARB 4X1IA 3B2EE 4FM0A 3JASB 3A2FA 4JV5B 1WPYA 4U3JB 2ALYA 4LH7A 4TV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RUX A;  1G51 A;  2ZT5 A;  2ZCE A;  2C7I A;  2ZT8 A;  3QO5 A;  4LNS A;  3HFZ B;  2CGH A;  1O9H A;  4P74 C;  1H4Q A;  3A31 A;  4HWS A;  3REU A;  1HC7 A;  4KR3 A;  3VQV A;  3E9I A;  1GGM A;  2CIM A;  2ZTG A;  4O2D A;  4EX5 A;  1B70 A;  2QHS A;  4P73 C;  1FYF A;  1USY C;  4YRC A;  4XTU A;  1NJ1 A;  2ART A;  4XEM A;  4WJ3 M;  2Q7H A;  2DJZ A;  4EO4 A;  3RF1 A;  1NYR A;  4Q6G A;  1SRY A;  4TQD A;  4UP7 A;  3VQX A;  2HEP A;  3TEH B;  1B7Y B;  3VBB A;  3UGQ A;  4XU1 A;  2QHU A;  4H2V A;  2E3C A;  3G1Z A;  1LYL A;  4H2U A;  4YCW A;  1NNH A;  2IY5 A;  2DDZ A;  1YGB A;  4PHC A;  3NEM A;  4ZTU B;  1WQW A;  3HY0 A;  4YRQ A;  4P73 A;  1USY A;  3TUP A;  3M4P A;  4WI1 A;  1SET A;  2E41 A;  2QJ1 A;  3A7R A;  4RQE A;  2XGT A;  4H2T A;  4TVY A;  2DXT A;  1EVK A;  1SER A;  5C53 B;  4OP0 A;  4TTV A;  4XTX A;  3IAL A;  4PG3 A;  1E22 A;  1PYS A;  3A7A A;  2DU5 A;  1WLE A;  4DQ2 A;  1WNL A;  3RL6 A;  3RKY A;  3UH0 A;  3PCO A;  4YRE A;  3V7S A;  2ZNI A;  3IG2 A;  3RKW A;  4ZIB A;  2YI9 A;  4TVW A;  2CJ9 A;  2DTI A;  2Q7E A;  3LSQ A;  1B76 A;  2ZT7 A;  2ZT6 A;  3I7F A;  4Q15 A;  2E1H A;  2ZGW A;  2RQ6 A;  3HXU A;  3HTZ A;  2EJ9 A;  2EL9 A;  1J5W A;  3RGL A;  1NYQ A;  3MEY A;  4CH3 A;  1EOV A;  1X2G A;  1NJ5 A;  5C52 B;  2EAY A;  3V8L A;  1QE0 A;  1L0W A;  4H2W A;  3BFM A;  1VQZ A;  2ZXF A;  2ARS A;  2J3M A;  3NEN A;  4KQE A;  5E3I A;  1HXD A;  4XU2 A;  1X54 A;  2I4O A;  3MF2 A;  4K88 A;  4P71 C;  2HNI A;  3QTC A;  3A74 A;  4CH4 A;  2P5I A;  3BHP A;  1G5H A;  3BJU A;  2PME A;  2JVD A;  3QNE A;  3CMQ A;  3HFZ A;  2DXU A;  3P8V A;  1X2H A;  1EIY B;  3V7C A;  1E1T A;  1B8A A;  2DVE A;  2YIB D;  4YP0 A;  1NJ6 A;  2ZIN A;  2DTO A;  3PCO B;  3NEL A;  1O9G A;  3ERR A;  1ASZ A;  3QO8 A;  4YCU A;  3HXX A;  2Q7G A;  4RQF A;  4YYE A;  3WQZ A;  1BIA A;  4XTV A;  4P71 A;  2EJG A;  4YRR A;  4KR2 A;  1WYD A;  2C8M A;  4YRJ A;  4DPG A;  4CS2 A;  2E10 A;  4CS3 A;  5C51 B;  4P72 A;  2ZNJ A;  2QHV A;  1N9W A;  3REX A;  1YB3 A;  2DTH A;  2J3L A;  1H4S A;  4P3N A;  3HY1 A;  4HWO A;  1EIY A;  3EFS A;  4YRT A;  2CJA A;  4P3O A;  2IY5 B;  1C0A A;  3LSS A;  4CS4 A;  1NJ8 A;  1RIQ A;  3MF1 A;  11AS A;  5HGQ A;  1B7Y A;  3LC0 A;  4E51 A;  1E1O A;  4UP8 A;  2ZR3 A;  4G85 A;  3RIR A;  3UGT A;  1G5I A;  3A7U A;  4XTZ A;  4YRN A;  4H2Y A;  4P72 C;  3L4G B;  2I4L A;  1E24 A;  2I4N A;  2EJF A;  5F5W A;  3ICA A;  1B70 B;  5K1P A;  4HVC A;  3HXV A;  4WF2 A;  4YDQ A;  2CJB A;  2I4M A;  1W66 A;  4XEO A;  2FYK A;  2ZIM A;  3RKX A;  5ELN A;  2E5A A;  4OLF A;  3L1A A;  2DQ3 A;  2PMF A;  3HXZ A;  4H2S A;  2Q5I A;  2DEQ A;  4J15 A;  4XTY A;  3TEH A;  4XTW A;  2YI8 A;  3M4Q A;  4H02 A;  1BBU A;  4X5O A;  4YRL A;  4TVA B;  2DQ0 A;  2G4C A;  1EFW A;  2R72 A;  1PYS B;  3HRK A;  4AH6 A;  3HXW A;  1HTT A;  2AKW B;  4YRK A;  4UPA A;  2DU7 A;  2YIB A;  2AMC B;  1Z7M A;  2E65 A;  3KFU A;  4HA8 A;  4XU3 A;  3HXY A;  12AS A;  2YIA A;  2AKW A;  4ZTZ B;  1EVL A;  2RHS A;  4CH5 A;  2Q5H A;  1KMN A;  1ADJ A;  2ALY B;  4RMF A;  4CH6 A;  2PGG A;  1ASY A;  2RHQ A;  4TWA A;  4NCX A;  4RDX A;  4YRF A;  1EQR A;  3PZC A;  2EWN A;  4YRG A;  5K1X A;  3V7R A;  3V8J A;  1BBW A;  1BIB A;  4BWA A;  4P75 C;  3RAC A;  4H2X A;  3IKM B;  4YRI A;  2AMC A;  4YPF A;  3VQW A;  1JJC A;  3FJP A;  4TQF A;  1H4T A;  1YFT A;  2DZC A;  4HWT A;  4YCV A;  4XU0 A;  2DKG A;  3A32 A;  3L2Z A;  2DZ9 A;  1X01 A;  3P8T A;  3P8Y A;  2ZIO A;  1YFR A;  3NET A;  3HRI A;  1NJ2 A;  3E9H A;  1G6U A;  3EFR A;  4L87 A;  4BW9 A;  4P75 A;  1ADY A;  4K86 A;  3HFV A;  1H4V B;  3OD1 A;  1WU7 A;  4YRS A;  1IL2 A;  3R07 A;  2RJZ A;  2ZZE A;  1WQ7 A;  3QO7 A;  2PUS A;  3UFG A;  3TEG A;  4YRO A;  4YRP A;  2E64 A;  2ODR C;  4WJ4 A;  2RHS B;  1YFS A;  4G84 A;  1QF6 A;  3A5Z A;  3ZED A;  2ZZF A;  1X55 A;  3L4G A;  4UP9 A;  1KMM A;  4P74 A;  1JJC B;  2P0L A;  1KOG A;  1Z7N A;  4YRM A;  1SES A;  2ARU A;  4H2X B;  3V8K A;  2R70 A;  4P3P A;  5KNN A;  2QHT A;  2ZZG A;  4K87 A;  1ATI A;  5ELO A;  4TVA A;  4HWP A;  2XTI A;  1X56 A;  4HWR A;  2RHQ B;  3VQY A;  2ODR D;  3DSQ A;  3W3S A;  2ZR2 A;  3A5Y A;  1WPY A;  2ALY A;  3IKL A; 
#chains in the Genus database with same CATH topology
 3W7W A;  2ZT5 A;  2ZCE A;  2JJ1 G;  2XND G;  3N2K B;  3BEH A;  3P32 A;  5A2Q N;  4U7N A;  2WLL B;  4FLZ A;  5IY5 C;  3AK1 A;  1JVM A;  1BE3 H;  3VQV A;  3E9I A;  1GGM A;  2ZTG A;  1HWY A;  5HFL A;  1NI8 A;  4JI6 B;  1B70 A;  2QHS A;  4P73 C;  4LFA B;  4CC5 A;  4DW1 A;  1IVS A;  2ZDI A;  3OGC C;  5GTH Z;  2ART A;  1IBL B;  4KXR A;  4MTG A;  2Q7H A;  2DJZ A;  4EO4 A;  1H8E G;  2YC0 A;  2LJ2 A;  3K5N A;  2P5O A;  4Q6G A;  1N33 B;  1I5Y A;  4GT1 A;  4TQD A;  4Z1M G;  1FXK A;  3E8B A;  4YJ3 B;  2HEP A;  3VQX A;  3CCJ V;  3TEH B;  1B7Y B;  3TXQ A;  1BGY H;  4O4H B;  4DV4 B;  1MOF A;  1V55 C;  4H2V A;  2E3C A;  5B1B C;  4B7K A;  4UCO A;  2GSM B;  1NNH A;  4YCW A;  4MVZ A;  1F4M A;  2DDZ A;  1AP6 A;  1QQC A;  1YGB A;  4JYB A;  1KP3 A;  1WQW A;  3RYF A;  3UKM A;  1SET A;  2E41 A;  2QSA A;  3BRC A;  1L0L H;  1TUE B;  1GM9 A;  4BIU A;  1SER A;  3WB2 A;  3CCQ V;  2Y4U A;  4J42 A;  4XTX A;  4NXN O;  3A7A A;  1ZTE A;  3RYH B;  5LMN O;  1B04 A;  4GKJ O;  1WLE A;  3GVM A;  4X1Y A;  3ZIA G;  3K06 A;  3UH0 A;  2ZNI A;  5EBW C;  3RWR D;  4I4T A;  4AI8 A;  4DV0 O;  4EB6 A;  5IWA B;  4FJC C;  1OCZ B;  2YI9 A;  3IJ4 A;  3IC7 A;  2QWN B;  1TGO A;  5BY1 A;  4JZG A;  1FS0 G;  1SQP H;  2ZT7 A;  2ZT6 A;  3I7F A;  2ILM A;  4YIO A;  4Q15 A;  2F4V B;  3AG3 B;  1QLE B;  4ASU G;  3STL C;  1IXM A;  2EJ9 A;  3BY6 A;  1KYO F;  2BE3 A;  3FAV B;  3HKB A;  1QU7 A;  4DV3 O;  4GX1 A;  4DR6 O;  3L70 H;  5IT9 N;  5LP6 C;  4JI1 B;  1NJ5 A;  2EAY A;  2PYL A;  3V8L A;  4G28 B;  1QE0 A;  4J41 A;  3CCV V;  2FL4 A;  1VQZ A;  3B4S A;  1DTO A;  5ITZ A;  4ZHQ B;  2ARS A;  1AJP A;  3K59 A;  3W7T A;  4LH6 A;  4ZHQ A;  1MZF A;  2C2A A;  4XU2 A;  1X54 A;  5FPO A;  1I94 O;  4UFZ A;  3FX7 A;  3SPI A;  1WN7 A;  1Q3E A;  5DEC A;  1NVP B;  2Q0A A;  1H2S B;  3ASN C;  3ZX6 A;  2P5I A;  1OV9 A;  1LUV A;  2P4K A;  3L9D A;  1Y6X A;  1SKV A;  4KHP B;  1WP8 A;  3FFQ A;  1EIY B;  4B7E A;  2KKW A;  3ICX A;  3CHX A;  4DW0 A;  4X66 O;  4YP0 A;  1FXK B;  1Q5O A;  1Q6H A;  2ZIN A;  1WP7 A;  4X9Q A;  3PCO B;  3NEL A;  4FFK A;  2CE4 A;  3E8G A;  3SPC A;  3QO8 A;  2QKC A;  2VWJ A;  3BAA A;  3AG2 C;  1N34 O;  4JAA A;  1OCR C;  3WQZ A;  4UVC A;  1SQG A;  3OE7 G;  3DGE A;  4YRR A;  1AIL A;  4KR2 A;  1L0N H;  1NBM G;  4WF9 V;  4NYK A;  4OPA A;  3ZHS A;  4QJF B;  2EJ7 A;  4JV5 O;  1XUQ A;  4YRJ A;  4DXW A;  3SJB C;  1HNZ B;  5JVD A;  4B3M O;  2VQF O;  3VOU A;  3F7V C;  3JD1 A;  4P72 A;  4I0X A;  3MD0 A;  4KL1 A;  2JRI A;  2EIN B;  3JAL B;  1YB3 A;  2J3L A;  3K9S A;  3Q4H B;  3Q4H A;  4P3N A;  4HWO A;  1EIY A;  3H9V A;  4C7U A;  2DMX A;  3EFS A;  4YRT A;  2CJA A;  1W0J G;  2IY5 B;  3LDD A;  1RIQ A;  1XNR B;  4TSF G;  5GW7 A;  4MVU A;  5HGQ A;  3JSN A;  1YJ9 V;  3OEH G;  1G4Y B;  4E51 A;  1NJI W;  1E1O A;  5CB4 B;  3T4D A;  3RIR A;  5JH7 B;  1N8R W;  4X1K A;  2BCC H;  2P22 C;  1NT2 B;  4J7K A;  2P67 A;  4YRN A;  5IWA O;  4J11 A;  1H2G A;  4BW5 A;  4P72 C;  4O4J B;  1V54 C;  4MW3 A;  2I4L A;  1UPG A;  3BVO A;  2I4N A;  1IUR A;  5F5W A;  2UUA B;  1LR1 A;  5IJ0 B;  1B70 B;  1GM7 A;  3T4Z A;  1CEZ A;  3CPW U;  2L35 A;  4OGQ B;  2I4M A;  4JPR A;  4LFA O;  2FYK A;  3RKX A;  2EIJ B;  3E35 A;  4OX9 B;  3CRC A;  5BMV B;  3JAT A;  5KMG B;  3M7M X;  4NTY A;  2PMF A;  1JMK C;  3HXZ A;  4DR7 O;  2DEQ A;  4BIZ A;  4JTC B;  2QGN A;  1BMF G;  3ZS8 C;  5L3B A;  1XNQ O;  3MHH C;  1FJG B;  3D36 A;  4JI7 B;  1RM1 B;  4TVA B;  1HNZ O;  4DUY B;  2R72 A;  4UV8 A;  1PYS B;  4DUZ B;  5LOV B;  5CA1 B;  3J7A U;  5EBM C;  1XIL A;  1M56 B;  4UUJ C;  4FFB B;  2EIK B;  2AMC B;  3CSX A;  2YSU B;  4GX2 A;  1Z7M A;  3UCS C;  3JAM N;  3KFU A;  3CC4 V;  2LW7 A;  1ZX3 A;  4WFA V;  3L72 H;  3HXY A;  3OMI B;  1K4C C;  4NTW A;  3JAS A;  2EX3 A;  2JS3 A;  3ETG A;  4MS2 A;  5D5Q A;  5DM6 V;  2YUA A;  3ETE A;  2Q5H A;  1QVF U;  1ZUQ A;  4RMF A;  4CH6 A;  4X65 B;  5JCO A;  3W7U A;  4RDX A;  1EQR A;  4CZZ A;  3V7R A;  1P84 F;  1Q82 W;  1F7Y A;  2DN9 A;  3JD2 A;  2WLJ A;  1BIB A;  4BWA A;  1HR0 O;  1JPX A;  4ICG A;  4RUF A;  4IYI A;  4WBN A;  2VQF B;  3RAC A;  2JGD A;  2UXC O;  2LGW A;  1EZV H;  4MTO A;  4AQY B;  4IGG A;  4YPF A;  1DF5 A;  4PD4 F;  3OEE G;  4JYA B;  1VQ6 V;  4DV1 O;  3ASO B;  2EZO A;  3K0G A;  3FJP A;  3O9O A;  3X2Q B;  1Q90 D;  1YFT A;  2GUZ B;  4GKK O;  5L3C A;  3ZMU A;  2R9R B;  4XU0 A;  5JCO C;  1YIJ V;  3P8Y A;  2JEX A;  4B3T B;  3HRI A;  3RFR A;  1NJ2 A;  1KEC A;  1AI6 A;  1R6K A;  2Y69 B;  3JAW A;  3K57 A;  1YTF B;  3EFR A;  4MTX A;  3R66 A;  1NTK H;  1R1B A;  1YHQ V;  1ADY A;  4K86 A;  1JQ0 A;  1H4V B;  1WU7 A;  3K5M A;  4J10 A;  5LL6 Y;  2RJZ A;  2ZZE A;  1Y66 A;  4YRO A;  3SDL A;  1N0J A;  4DV4 O;  5B3S B;  1QF6 A;  4PA9 A;  4HZ3 A;  2QWO B;  1DK1 A;  3T2M A;  4G84 A;  4WFG A;  5IYD O;  3ML0 A;  2ZZF A;  2IJH A;  2E75 B;  1BHA A;  4LP8 A;  2P0L A;  3J80 N;  1GN4 A;  1PD3 A;  1E1R G;  2Q5Z A;  3JYC A;  3C3S A;  2Q68 A;  4N21 A;  4H2X B;  2R70 A;  3IC9 A;  2HFE C;  5KNN A;  2QHT A;  1QVG U;  1MAB G;  1ATI A;  2YXY A;  4MSW C;  4TVA A;  4B3R O;  4U3J A;  3K04 A;  2K1E A;  3TXS A;  3HR0 A;  2ODR D;  2OCC B;  1S72 V;  2CH7 B;  4DUY O;  1QBZ A;  4H13 B;  2W6J G;  3CMA V;  3CCE V;  4JV5 B;  2ALY A;  2YI8 A;  2KB1 A;  3ZHR A;  3LSU A;  4JYA O;  3T1H B;  4YXW G;  1CPY A;  1P7B A;  3QO5 A;  3FKS G;  4K0K B;  1RPO A;  4DR1 O;  1H4Q A;  3A31 A;  3PN1 A;  1VQL V;  4UV9 A;  4R8C A;  3REU A;  1COW G;  1HC7 A;  4DK0 A;  1GMG A;  4IHJ A;  4NKG B;  1JJO A;  1N4C A;  2BTQ B;  3QVN A;  2GUZ A;  3R65 A;  1KB9 F;  1FYF A;  1USY C;  1UJW B;  2BOB C;  2QTS A;  4XTU A;  1WA8 A;  2CDY A;  4X66 B;  1S5J A;  4JZ2 A;  4WJ3 M;  2ADQ B;  2OCC C;  3D3I A;  2WLI B;  2IBZ H;  1NYR A;  4RO2 A;  1SRY A;  4O2A A;  4RWU A;  3CXH F;  2XAF A;  4FIP C;  3KG2 A;  5BMV A;  3HKB B;  3UGQ A;  2P7T C;  2XAG A;  5KX5 A;  3G1Z A;  4CC6 A;  5EZY A;  1FKA O;  2IY5 A;  4LC1 A;  4MVM A;  2Z5U A;  2AHZ A;  3NEM A;  4YHH O;  3GWK C;  3CCS V;  4ZTU B;  5FNV A;  1D5N A;  5L3G A;  1USY A;  2Y0P A;  4WI1 A;  5LGU A;  3OD4 A;  1D5A A;  2XGT A;  5JWP A;  5IYB O;  5CA0 A;  2XT9 A;  2W6I G;  3QG5 A;  2KG7 A;  1EVK A;  1WJZ A;  2N04 A;  1FPO A;  1URF A;  3GWO A;  4DV2 O;  1E1Q G;  5H6Q A;  5KA6 A;  1GTO A;  3IAL A;  4PA6 A;  1PYS A;  2WLK A;  4K35 A;  5KHI A;  1P4R A;  4B3S B;  1NTZ H;  3CRQ A;  5CMU A;  3V7S A;  3IG2 A;  4BAY A;  2F93 B;  3OM3 B;  3RKW A;  4ZIB A;  4UCR A;  3TJT A;  4I0X B;  3RYC A;  1B76 A;  2YIC A;  2VRZ A;  4XDK A;  2VWK A;  5JVD B;  1KP2 A;  2E1H A;  4JAU A;  3JAK A;  2RQ6 A;  2B5U A;  3E8H A;  3JD4 A;  3HXU A;  1GN3 A;  4DRX B;  3T1H O;  3HTZ A;  1WNS A;  1JFF A;  2UUC B;  1N32 B;  3RGL A;  4O4H A;  3K58 A;  2Q4P A;  4BIO A;  5C52 B;  1GM8 A;  4QGP A;  2EIN C;  2D3O W;  5JJN B;  5KHG A;  5L3E A;  2UXX A;  4JI8 O;  4DV6 O;  3AK3 A;  3B8N A;  4GCZ A;  3SJA C;  2UXN A;  4O4L B;  4JI3 O;  3G4S V;  2QWQ B;  1PKX A;  1NH2 B;  2EZP A;  3A74 A;  1S77 D;  2Y48 A;  3CRM A;  5LYJ B;  2E5L O;  3HKC B;  2JVD A;  4AIL C;  1KKC A;  2DJV A;  1QLE C;  3AG1 C;  5JJE B;  3HKE B;  3IFX A;  2PY5 A;  2ITC C;  5IYZ B;  3RVZ A;  1H2L A;  4TT3 G;  4B3R B;  2YIB D;  1FFX A;  2H3O A;  3DC6 A;  1WB7 A;  4D7T A;  1ASZ A;  2UXD B;  4O4L A;  5H9C A;  1R6T A;  1HDJ A;  4FK5 C;  4RQF A;  1BCC H;  4MVQ A;  4XTV A;  5BXZ A;  3WFV A;  4E4E A;  1IBM O;  2EIM C;  2KG7 B;  1NH2 D;  2FYU H;  4JI5 O;  2XUM A;  4LF9 B;  3J81 N;  4DRX A;  2E10 A;  1K97 A;  3JAK B;  3I55 V;  2QHV A;  1R3L C;  2CTW A;  4X20 B;  3WG7 C;  4R50 A;  1OCZ C;  1I7F A;  2B9Z A;  4QE7 A;  3CD6 V;  1H4S A;  2ZT9 B;  3CYO A;  3A8T A;  3HY1 A;  2UUC O;  4P3O A;  1C0A A;  3LSS A;  3ZN1 A;  4GKK B;  1NJ8 A;  5DED A;  3K5O A;  4FLV A;  2E74 B;  5LA6 B;  3RYH A;  4D7S A;  1B7Y A;  1RSO B;  2FB5 A;  1AR4 A;  1XEQ A;  1GH6 A;  3OR7 C;  4G85 A;  3UGT A;  4HBN A;  4I9W A;  3P30 A;  2HJD A;  1SZX A;  3A7U A;  2YID A;  2PF4 E;  2Q67 A;  1WA8 B;  2QWR B;  1IXB A;  4JI6 O;  3L4G B;  1L8D A;  1VAR A;  1B06 A;  3SJQ C;  1IX9 A;  2XAJ A;  3ZBH A;  1IBL O;  3WG7 B;  1KD1 W;  2X0L A;  4LCU C;  1S3J A;  5A9G A;  3B09 A;  1EM1 A;  1ENV A;  4TOI A;  1EN4 A;  4PA7 A;  4L8J A;  2B1I A;  4XEO A;  4OPH A;  4FLW A;  3G71 V;  4FLT A;  2HKO A;  3H1K H;  2DQ3 A;  3HKD A;  4WCE V;  3DC5 A;  4OX9 O;  3ZHT A;  4H2S A;  3D8C A;  1K4D C;  4LF4 O;  2Q5I A;  3AG4 C;  1YCI A;  1ZAU A;  2Q8V A;  3JD0 A;  4XTY A;  5L3F A;  3OUS A;  1Q7Y W;  3N2G B;  1Z5V A;  5B1N A;  3P3N A;  2X7R B;  4JF3 A;  1BBU A;  4H02 A;  4X5O A;  1K73 W;  4EFE A;  3UO3 A;  2G38 A;  3HRK A;  4AH6 A;  4Z1V A;  1U96 A;  1AR1 B;  4P9O A;  4YRK A;  2HLD G;  1CXZ B;  4UPA A;  2DU7 A;  1SF9 A;  4YHH B;  1S76 D;  3MHS C;  3CB2 A;  1N36 B;  4EKW A;  3N2K A;  1M1K W;  1EZJ A;  1NR7 A;  4HA8 A;  2IW5 A;  4XU3 A;  3ZMT A;  1VEW A;  4YY3 B;  5LMN B;  3RYI B;  2AKW A;  3ZCC A;  1FYJ A;  4UCS A;  1R3J C;  1N0N A;  3S3W A;  1FAF A;  3OTO O;  4CH5 A;  2QR4 A;  1AR5 A;  1PL4 A;  3CCR V;  4TV9 B;  4MW8 A;  2ALY B;  3IAY A;  2PGG A;  4KUM A;  1ASY A;  2VQE B;  4TWA A;  2UXB O;  2ZE8 A;  4FM1 A;  1YJW V;  1ORQ C;  5K1X A;  1XOU A;  2EJR A;  4UCV A;  4UB8 Z;  5B5E Z;  1IBM B;  1K34 A;  5DN6 G;  1VQN V;  4FZ1 A;  4YJ3 A;  4DV7 O;  1HR0 B;  1GO3 F;  2A8E A;  4H2X A;  2WWW A;  4TUY B;  5C8Y A;  1YZB A;  4PDL A;  1MA1 A;  3ZRX A;  1F51 A;  2DOS A;  4LWS A;  1TVK B;  1H4T A;  1VF6 A;  1YEW A;  3CWB H;  5LMU B;  1PV0 A;  2DZC A;  3CX5 F;  5KHK A;  1WPB A;  2F43 G;  4LF6 B;  2DKG A;  4DV3 B;  4WFF A;  4LVM A;  3SYO A;  4P30 A;  3P8T A;  2ZIO A;  5LGT A;  3TET A;  1GKF A;  1V55 B;  2HHH O;  3CC2 V;  3HPL C;  5IJ9 B;  1VQK V;  3OW2 U;  3B40 A;  2JDI G;  2CTQ A;  2P90 A;  3CXC U;  2IJI A;  4X64 B;  3W7X A;  3HFV A;  3H1H H;  3OD1 A;  1BL8 A;  4U3F H;  1ROP A;  1QLN A;  1NS1 A;  4B3M B;  3QO7 A;  2Q73 A;  4DR7 B;  1N34 B;  4J80 A;  1H2M A;  1YSC A;  4PDM A;  3LUT B;  4JI7 O;  2HVJ C;  1YI2 V;  1X55 A;  3L4G A;  1Y4M A;  3H01 A;  4P74 A;  3LNN A;  2OIE A;  1BT8 A;  1Z7N A;  4TV8 A;  4YRM A;  2JS5 A;  1SES A;  1HP8 A;  3DXR A;  4MTF A;  4O2B B;  4DR3 O;  2UXB B;  2XOK G;  4ZOL A;  2XHB A;  2W0F C;  3ZHU A;  4K87 A;  4O4I B;  3ABT A;  4GUN A;  4F6E A;  1SS3 A;  4K8Z A;  3UQ8 A;  3B8M A;  2RHQ B;  2ZDI C;  1R6N A;  2A3Q A;  2F23 A;  4H33 A;  3SYP A;  1KU9 A;  2YDE A;  3W3S A;  2ZR2 A;  4DV2 B;  3A5Y A;  4X1I A;  1BSM A;  4FM0 A;  4E2L A;  3ABL B;  1AVM A;  1FXK C;  2ZD9 A;  4TV9 A;  4DR5 O;  3S3X A;  4IIJ A;  3RUX A;  3OAA G;  5KMG A;  3H1I H;  3OGI B;  3NR7 A;  2C7I A;  2ZT8 A;  1NTM H;  1OCO B;  4WFB V;  3DXR B;  4LNS A;  5KA5 A;  4P74 C;  1O9H A;  3RYI A;  3BPZ A;  3OUF A;  4YY3 O;  1UFI A;  1D2D A;  4IL6 Z;  2OYQ A;  4KR3 A;  1T5E A;  3B77 A;  1SZT A;  4O2D A;  1XNR O;  3RVY A;  5IYC O;  1XMO O;  3TK1 A;  1XHZ A;  3P3P A;  4BR6 A;  1NJ1 A;  2RMK B;  2YXL A;  4X1K B;  4JYY A;  1SA0 A;  1ARO P;  4PDV A;  4U7O A;  4ZBM A;  1NZ6 A;  5LXT B;  4YJ2 B;  5LP6 B;  1K8A W;  4LF8 B;  3VBB A;  1LUW A;  4DUZ O;  2LP7 A;  3E2E A;  4XU1 A;  3SPG A;  1WPX A;  4DV5 B;  1Q6I A;  4H2U A;  3CRA A;  5LYJ A;  2FKX A;  4GYC B;  1H2K A;  4KHP O;  4PHC A;  1HW7 A;  1DF4 A;  4Z2W A;  2M7W A;  2IU0 A;  4P73 A;  4LWS B;  2Q6A A;  3M4P A;  4JTA B;  4DR4 O;  5LHI A;  4J7Z A;  4I7Z B;  2IU3 A;  3WU2 Z;  3AG2 B;  1VQ7 V;  3STZ C;  2VQE O;  1TA8 A;  4TUY A;  1GRJ A;  5C53 B;  1JCH A;  2JIZ G;  4OP0 A;  2DWE C;  4G2K A;  4TTV A;  3CEI A;  1SQX H;  1M9N A;  2Q0O C;  5JH7 A;  4PG3 A;  4LNU B;  2DU5 A;  4YIP A;  2QKS A;  4JI5 B;  4DQ2 A;  4PJ0 Z;  1WNL A;  3SGI A;  3RL6 A;  3RKY A;  3CP1 A;  3ZRW B;  1Y76 A;  3L73 H;  3PCO A;  4YRE A;  3U11 A;  4ZKI A;  3ASN B;  4LBE C;  2D2C B;  2Q9L A;  5IE9 A;  3MQZ A;  3ETD A;  2LQT A;  1KUQ A;  3CC7 V;  4TVW A;  4ZI7 B;  3AG1 B;  2Q7E A;  3IGA C;  1Q6U A;  4J9Y B;  2DYS B;  2GTS A;  2FTK A;  4AHC A;  3ZMS A;  2HP8 A;  1XMO B;  1XL4 A;  4DR5 B;  2OCH A;  5KHH A;  5F2V O;  2WSS G;  5J2T A;  2GTA A;  1NYQ A;  5EIB D;  3MEY A;  4CH3 A;  4X8A A;  1EOV A;  1X2G A;  5KLV H;  4J9Z B;  1FFT B;  3UM7 A;  1L0W A;  4H2W A;  1PNK A;  3APO A;  4Q20 A;  4QE9 A;  2LW1 A;  2UUB O;  1HXD A;  2PTM A;  3MF2 A;  4LFC B;  4K88 A;  5B1A C;  1M93 A;  2P06 A;  4CBC A;  2DYR C;  3KCX A;  4JI3 B;  2HVK C;  2HNI A;  3OMA B;  3QTC A;  4CH4 A;  3BHP A;  3KCY A;  1G5H A;  2H94 A;  3CMQ A;  3HFZ A;  2F95 B;  3P8V A;  2E5L B;  3V7C A;  4EB6 B;  1RFY A;  1B8A A;  5LP6 A;  1JOY A;  3OR6 C;  5B1A B;  4ABM A;  4X1I B;  4YCU A;  3HXX A;  2Q7G A;  5FL7 G;  4YYE A;  4H44 B;  5ITZ B;  2AGA A;  4N23 A;  1Q43 A;  4JI2 B;  3BAB A;  1M5I A;  3K3W A;  4F6R A;  3AG3 C;  1QR8 A;  3K08 A;  3ZMV A;  3FAV A;  2C8M A;  4DPG A;  2HR3 A;  1J5E O;  1YTF D;  4CS2 A;  1EN6 A;  4CS3 A;  3RYF B;  2QTO A;  4FVM A;  3K0D A;  2DTH A;  2MW2 B;  1DGS A;  4PDR A;  5EIB C;  3KZI Z;  5FNV B;  4LVI A;  4CS4 A;  4X65 O;  3MF1 A;  3EXA A;  5H2F Z;  3E86 A;  1B3Q A;  1BHB A;  1ZWI C;  3LC0 A;  2YXH A;  3ABM B;  3CME V;  3OFN G;  2A06 H;  2UXC B;  4NTX A;  4TV8 B;  3SPH A;  2ZXW B;  2ZQM A;  3F5W C;  1QHT A;  4H2Y A;  3C90 A;  3PJS K;  1YVW A;  1W2B U;  2BSK B;  2JJ2 G;  1X4T A;  5HFM A;  5J2T B;  3UT5 B;  4FLY A;  5K1P A;  5EK0 A;  2KQX A;  3LDE A;  4WF2 A;  3NXS A;  1GN6 A;  1W66 A;  4QIW F;  2ZIM A;  2XAS A;  2YEV A;  2HG5 C;  2E5A A;  1THZ A;  3AEI A;  4OLF A;  1B6Q A;  1FXH A;  2IH3 C;  1EN5 A;  3SJC C;  3EHB B;  4ZI7 A;  3ZMZ A;  1XL6 A;  3E89 A;  3JAR A;  1OCR B;  4GX0 A;  1XDC A;  4J15 A;  3TEH A;  3FYE B;  4LF8 O;  2K9P A;  3M4Q A;  5EYP A;  3D3Q A;  4LVK A;  1J95 A;  2DQ0 A;  1EFW A;  1TVK A;  1NU1 H;  2R9I A;  5CBH A;  3HXW A;  1AI7 A;  1K7D A;  3U10 A;  2H8P C;  4PV1 B;  4UVA A;  1Y74 B;  2Y69 C;  4TWK A;  2V4D A;  2E65 A;  1KBH A;  3DTU B;  4HNA B;  1PNM A;  1S5L Z;  1KMI Z;  4WBN B;  1N36 O;  1Q86 W;  12AS A;  4JI0 O;  1R3I C;  4ZTZ B;  1EVL A;  3RYC B;  4X88 A;  1KMN A;  3FB7 C;  5EYP B;  3BCC H;  1ADJ A;  4UCU A;  4LF7 B;  1AP5 A;  2RHQ A;  3D36 C;  3RW0 A;  2UUB B;  1Q81 W;  3ZRW A;  2NR5 A;  2NNU A;  3ABK C;  3PZC A;  5BR8 B;  4YRF A;  3V8J A;  5KUM A;  2DE0 X;  3K9A A;  4HAM A;  2X6A A;  5B66 Z;  3HKD B;  2F4V O;  1PM9 A;  5LXT A;  3G67 A;  2QA4 V;  1I94 B;  3MAQ A;  2ZE5 A;  3IKM B;  4YRI A;  4X62 O;  1P7G A;  2ODM A;  3F7Y C;  4I55 B;  4LVJ A;  2AMC A;  2Z0A A;  5TIS Z;  1GAX A;  3E22 B;  2AXT Z;  4UVB A;  3L71 H;  4R6Z A;  3ZRV A;  5LHH A;  1HNX O;  1BQZ A;  2EIL B;  4LVL A;  3N27 A;  2AZ0 A;  2CGN A;  3HB3 B;  4W4K A;  3A32 A;  5D5P A;  3G80 A;  1ZL8 A;  4FMT A;  2P6J A;  1YFR A;  3NET A;  4DYL A;  5J2U A;  1G6U A;  2ZE7 A;  4PI2 A;  1K3E A;  4JI8 B;  1K92 A;  2A9H A;  2LFR A;  1RSO A;  1RM1 C;  1OZ0 A;  3E8F A;  3JAW B;  3CE2 A;  5JJJ B;  2YS8 A;  4YRS A;  1IL2 A;  3R07 A;  5EBL C;  1WQ7 A;  1FJG O;  2WA4 A;  4K3A A;  5FLX N;  2PUS A;  3TEG A;  3OTF A;  3AG7 A;  1K33 A;  4YRP A;  2E64 A;  3SR2 C;  4K8X A;  2ODR C;  4WJ4 A;  2RHS B;  2O57 A;  3CCL V;  4JGS A;  2EIL C;  1PPJ H;  1H8H G;  3ZED A;  4IHJ B;  2R9A A;  4O2B A;  5B1O A;  5CN0 A;  1KMM A;  4JI4 B;  2EBO A;  2EIK C;  2A0L A;  5E1A C;  2ARU A;  1KKD A;  1JJ2 U;  4P3P A;  5CB4 A;  1W59 A;  1M4U A;  4FFB A;  1KC8 W;  4IIJ B;  1V54 B;  2RCV A;  2XTI A;  1X56 A;  5LOV A;  3L74 H;  4B08 A;  4B3S O;  3DSQ A;  2CH7 A;  2ZM6 O;  4GZR B;  4JI2 O;  4IYH A;  3E83 A;  2GDS A;  2Q69 A;  3K79 A;  1WPY A;  1US6 A;  4U3J B;  3IKL A;  4P2Z A;  2P4V A;  4O4I A;  4DR1 B;  1G51 A;  4NXM O;  4LFB O;  3O65 A;  1YXB A;  2JGU A;  1MNG A;  5GTI Z;  3HFZ B;  2CGH A;  4EEQ A;  2MK3 A;  1ZL8 B;  2NLJ C;  1Y74 A;  1JR9 A;  4K0K O;  3K03 A;  4HWS A;  2BSK A;  2CIM A;  4RAI A;  4DV7 B;  1VMG A;  1BQ0 A;  4MVS A;  1VQO V;  2QE7 G;  4EX5 A;  4NVP A;  2M6Y A;  3ASO C;  5CBG A;  4YRC A;  5CA1 A;  1VQ4 V;  2GBO A;  4X89 A;  2FML A;  4I50 A;  1U97 A;  2EUL A;  2WLM A;  4UB6 Z;  2UUA O;  2CUG A;  4XEM A;  3RN4 A;  3T1Y O;  3RF1 A;  2Y4T A;  1HNW B;  1OCC B;  2B1G A;  4UP7 A;  4QPJ A;  1V9P A;  1LNQ A;  5KAI Z;  3RBZ A;  5H6R A;  2DWD C;  2QHU A;  1LYL A;  2AW9 A;  5GON B;  1AI5 A;  1GN2 A;  5FPR A;  3UT5 A;  4P9P A;  4DK1 A;  4H0L B;  4LF4 B;  3HY0 A;  2NN4 A;  4YRQ A;  5BZB A;  3L75 H;  5B3S C;  4OXS A;  3TUP A;  2GV9 A;  1XBL A;  4IT5 A;  4LR3 A;  1VIB A;  1NQT A;  2QJ1 A;  3A7R A;  4RQE A;  4H2T A;  4HNA A;  4TVY A;  3JAL A;  5E79 Z;  2DXT A;  1SQB H;  2PZS A;  4O4J A;  3SYC A;  1EBO A;  4PEL A;  3JCZ A;  4F6R B;  2QDO A;  2HJF C;  5JQG A;  1E22 A;  2F66 C;  2X6C A;  3ABM C;  2DYR B;  4JAV A;  2OIG A;  2WAM A;  4LF9 O;  2ARH A;  3AK2 A;  4DV0 B;  2ETN A;  3A0B Z;  2WPD G;  2IH1 C;  3FB8 C;  1Z5W A;  3N2G A;  3OTO B;  2L6L A;  2CJ9 A;  2DTI A;  1RP3 B;  5LMU O;  2RNB A;  3LSQ A;  4JI4 O;  1HNX B;  1J5E B;  2YEV B;  2QM4 A;  5L3D A;  3LDC A;  1OHH G;  4DV1 B;  3JCU Z;  3HKE A;  3OT7 A;  1WAZ A;  2ZGW A;  1GK9 A;  5EZY B;  2OWO A;  2ADP A;  2Y0I A;  4LFB B;  4DR6 B;  1L1F A;  3HKC A;  2EL9 A;  2QWP B;  2QEX V;  1J5W A;  1YF2 A;  3APQ A;  3WB1 A;  3JSL A;  1X59 A;  2W0X A;  4YJ2 A;  5BR8 O;  3RT3 C;  1XMQ B;  3A0R A;  2CTP A;  4FZ0 A;  3BFR A;  2X6B A;  3BFM A;  3H1J H;  2ZXF A;  1SA0 B;  3GB7 C;  2VS0 A;  2J3M A;  3NEN A;  4KQE A;  1I0H A;  5E3I A;  4J7J A;  2AZ2 A;  2I4O A;  4P71 C;  4X62 B;  4XDJ A;  2E76 B;  3OMN B;  2EIJ C;  4W4L A;  1VQ5 V;  2JK5 C;  5LA6 A;  4KFM A;  5IY5 B;  1KQS U;  2CGO A;  3BJU A;  2PME A;  3QNE A;  1IDS A;  3U0Z A;  1EFR G;  4QPK A;  1QCE A;  1XI1 A;  2PI4 A;  2DXU A;  1Y67 A;  4XBF A;  3K5L A;  1XNQ B;  1X2H A;  3ZHQ A;  1E1T A;  2DVE A;  3WB0 A;  3H1L H;  4O2A B;  4X20 A;  1XQ8 A;  2LFS A;  1Z2G A;  1PNL A;  1NJ6 A;  5AG2 A;  2DTO A;  1O9G A;  3ERR A;  1Y76 B;  5J9P C;  1S0V A;  3THO A;  1VQ9 V;  2ZXW C;  3CS5 A;  3RGB A;  1VP7 A;  3TGU H;  4FM2 A;  1BIA A;  3BA8 A;  4B3T O;  2UXD O;  3ETQ A;  1VQ8 V;  5JQG B;  3UO2 A;  5CA3 A;  1P49 A;  4WFH A;  2BTO A;  4P71 A;  2EJG A;  4XDL A;  4UCT A;  2BTQ A;  5B1B B;  2UU9 B;  5EC1 C;  5LHG A;  1FD9 A;  1WYD A;  4HT4 A;  2XAQ A;  2WLH A;  3FB5 C;  4LF5 B;  2CTR A;  1MSD A;  5C93 A;  5C51 B;  3M8A A;  1H2N A;  2ZNJ A;  1FFX B;  2F1M A;  1N9W A;  3REX A;  5H5N A;  1ZLZ A;  1VQP V;  1AI4 A;  2DYS C;  1XHX A;  1DLB A;  1XMQ O;  1E79 G;  4JYC A;  1G1X B;  4I4T B;  3SPJ A;  11AS A;  1VF5 B;  3CJH B;  5KHJ A;  1NR1 A;  3CCM V;  3FB6 C;  1F23 A;  1TAE A;  1AJQ A;  1IBK O;  1K5Q A;  4X1Y B;  4WFE A;  2ZM6 B;  4MT8 A;  4UP8 A;  2ZR3 A;  4PA4 A;  1JA8 A;  5CBF A;  4FLU A;  2GHY A;  1G5I A;  2PYJ A;  4DR2 B;  4HYO A;  4XTZ A;  4UXN A;  4I50 B;  4NXM B;  3T1C A;  3SYA A;  1E24 A;  1S5H C;  1YDX A;  5IDJ A;  5IYZ A;  3I56 V;  3M99 B;  2EJF A;  3ICA A;  5EC2 C;  1JFF B;  3KKY A;  1RPR A;  2WA3 A;  4HVC A;  4QNH B;  3HXV A;  2OT5 A;  1K5S A;  1I08 A;  2OTJ V;  4YDQ A;  1OCO C;  2CJB A;  4F4L A;  3MDS A;  3ZRS A;  5KX5 B;  4A5U B;  5ELN A;  2V7Q G;  1M57 B;  4RUE A;  1M56 C;  3L1A A;  5GON A;  4DV5 O;  5KUK A;  1H38 A;  4JTD B;  1PP9 H;  2PI5 A;  4NR1 A;  4XTW A;  4KP4 A;  3QF7 A;  2LGQ A;  3CRR A;  2LO1 A;  1YIT V;  2XTA A;  4YRL A;  1BS3 A;  3EFF K;  1CP9 A;  2G4C A;  2IJK A;  1I5X A;  2ZKO A;  4LNU A;  1OJH A;  1QR9 A;  1HTT A;  2AKW B;  2A79 B;  3JD3 A;  2YIB A;  1NVP D;  3ZN0 A;  3W7S A;  2AHY A;  1SC5 B;  3LNM B;  2QM7 A;  1M90 W;  1R73 A;  2WLL A;  2YIA A;  2IM9 A;  2RHS A;  1OCC C;  4FLX A;  1BZK A;  1IBK B;  4JAS A;  2BOC C;  1VF7 A;  2QKA A;  1F4N A;  3CCU V;  4NCX A;  4FPP A;  2EWN A;  4DR2 O;  4MVO A;  4PA3 A;  5IJ9 A;  2A7W A;  1FXV A;  3T1Y B;  4YRG A;  1W0K G;  4ZOL B;  3AG4 B;  1BBW A;  2UU9 O;  1HNW O;  4DV6 B;  3EVK A;  1ZSP A;  4AQY O;  4P75 C;  1SQQ H;  1N32 O;  3JAT B;  1AB3 A;  4LF5 O;  4GX5 A;  1MSW D;  4PI0 A;  2JEU A;  5CA0 B;  1R3K C;  2Z3Y A;  3TCU A;  3ABK B;  1QNM A;  3VQW A;  1G8M A;  1JJC A;  4D6T H;  3E22 A;  1XRE A;  2RDC A;  4NB5 A;  4I9Q A;  4TQF A;  3C3T A;  1SQV H;  2CAZ C;  1K9M W;  3F5T A;  2XAH A;  4I55 A;  1N33 O;  2RN9 A;  4LFC O;  4HWT A;  4YCV A;  4G27 B;  5C8Y B;  5KAF Z;  1NKD A;  1TUB A;  2ZE6 A;  1PL0 A;  3G6E V;  3L2Z A;  2DZ9 A;  3ZHV A;  1AJN A;  4LF6 O;  1X01 A;  2EIM B;  3E9H A;  4X64 O;  3ABU A;  1JX9 A;  2V1D A;  3FYI B;  4BW9 A;  1MMM A;  3ABL C;  4L87 A;  5LBQ A;  4P75 A;  2HHH B;  1Q8I A;  2WLI A;  1VQM V;  5J2U B;  3A0H Z;  4EFB A;  3UFG A;  2ITD C;  4DO2 A;  4PHZ A;  4R7C A;  3FD9 A;  5IJ0 A;  2WLN A;  1TUB B;  1YFS A;  5LGN A;  3G6B A;  3A5Z A;  1VF6 C;  1A32 A;  4DR4 B;  3BA9 A;  2IJJ A;  4UP9 A;  2CK3 G;  2OTL V;  2JGD B;  1JJC B;  1IZ3 A;  4NXN B;  2N74 A;  2N05 A;  1M57 C;  1KOG A;  4GKJ B;  2ATK C;  3ZJZ A;  2KSD A;  4MVR A;  3V8K A;  4GLX A;  2ZZG A;  5ELO A;  1SQF A;  4DR3 B;  4HWP A;  4HWR A;  1WB8 A;  3I5D A;  4I5S A;  3VQY A;  2QM8 A;  3CJH A;  4JI1 O;  4H37 A;  4JI0 B;  2NS6 A;  3SYQ A;  3JAR B;  1MZE A;  1YJN V;  3X2Q C;  3B2E E;  3JAS B;  3A2F A;  1MG1 A;  4LH7 A;  2DW4 A;  4LF7 O; 
#chains in the Genus database with same CATH homology
 4IIJ A;  4O4I A;  4DR1 B;  5KMG A;  1G51 A;  3RUX A;  2ZT5 A;  2ZCE A;  3T1H B;  2C7I A;  2ZT8 A;  3N2K B;  3QO5 A;  4K0K B;  2JGU A;  4LNS A;  3HFZ B;  2CGH A;  1O9H A;  4EEQ A;  3RYI A;  4P74 C;  3BPZ A;  1H4Q A;  4FLZ A;  3A31 A;  4HWS A;  3PN1 A;  2OYQ A;  3REU A;  1HC7 A;  4KR3 A;  4DK0 A;  3VQV A;  3E9I A;  1GGM A;  4IHJ A;  2CIM A;  1T5E A;  4DV7 B;  1JJO A;  2BTQ B;  2ZTG A;  4O2D A;  4EX5 A;  1B70 A;  4JI6 B;  2QHS A;  4P73 C;  4NVP A;  1FYF A;  1USY C;  4LFA B;  4YRC A;  1XHZ A;  5CA1 A;  4CC5 A;  4XTU A;  1NJ1 A;  4I50 A;  4X66 B;  2ART A;  1S5J A;  1IBL B;  4XEM A;  2YXL A;  2Q7H A;  4WJ3 M;  4X1K B;  2DJZ A;  1SA0 A;  4EO4 A;  3RF1 A;  3K5N A;  2P5O A;  4Q6G A;  1HNW B;  1NYR A;  1N33 B;  1SRY A;  4TQD A;  5LXT B;  4UP7 A;  4O2A A;  1V9P A;  4YJ2 B;  2HEP A;  4YJ3 B;  3VQX A;  5LP6 B;  3TEH B;  4LF8 B;  1B7Y B;  3VBB A;  5BMV A;  3HKB B;  4O4H B;  3UGQ A;  4DV4 B;  5KX5 A;  4XU1 A;  2QHU A;  4H2V A;  2E3C A;  4CC6 A;  3G1Z A;  1LYL A;  4DV5 B;  5GON B;  4UCO A;  4H2U A;  4YCW A;  1NNH A;  5FPR A;  5EZY A;  2IY5 A;  5LYJ A;  4GYC B;  3UT5 A;  2DDZ A;  1QQC A;  1YGB A;  4PHC A;  4DK1 A;  3NEM A;  4LF4 B;  4ZTU B;  1HW7 A;  5FNV A;  1WQW A;  3HY0 A;  4YRQ A;  4P73 A;  3RYF A;  1USY A;  3TUP A;  3M4P A;  2GV9 A;  4LR3 A;  4WI1 A;  1SET A;  2E41 A;  2QJ1 A;  3A7R A;  4RQE A;  1D5A A;  2XGT A;  4H2T A;  4HNA A;  4TVY A;  3JAL A;  5CA0 A;  2DXT A;  2PZS A;  4O4J A;  1TA8 A;  3BRC A;  4TUY A;  3QG5 A;  1EVK A;  4F6R B;  1SER A;  5C53 B;  3WB2 A;  4OP0 A;  5JQG A;  4TTV A;  4XTX A;  3IAL A;  4PG3 A;  5JH7 A;  4LNU B;  1E22 A;  1PYS A;  3A7A A;  3RYH B;  2DU5 A;  2F66 C;  1B04 A;  1WLE A;  4JI5 B;  4DQ2 A;  1WNL A;  3SGI A;  3RL6 A;  3RKY A;  4DV0 B;  4X1Y A;  5KHI A;  4B3S B;  3UH0 A;  3PCO A;  4YRE A;  1Z5W A;  3U11 A;  3N2G A;  3V7S A;  2ZNI A;  3RWR D;  3IG2 A;  4I4T A;  3MQZ A;  2F93 B;  4EB6 A;  3OTO B;  4ZIB A;  5IWA B;  3RKW A;  4UCR A;  2YI9 A;  4TVW A;  4ZI7 B;  2CJ9 A;  2DTI A;  2Q7E A;  3RYC A;  3LSQ A;  1TGO A;  1HNX B;  1B76 A;  1J5E B;  5JVD B;  4AHC A;  2VWK A;  2ZT7 A;  2QM4 A;  2ZT6 A;  1XMO B;  3I7F A;  4DV1 B;  4Q15 A;  2F4V B;  3HKE A;  2E1H A;  2ZGW A;  4DR5 B;  3JAK A;  2RQ6 A;  5EZY B;  2OWO A;  3HXU A;  5KHH A;  4DRX B;  4LFB B;  4DR6 B;  3HTZ A;  2EJ9 A;  3HKC A;  2EL9 A;  1WNS A;  1J5W A;  1JFF A;  2UUC B;  1N32 B;  5J2T A;  3RGL A;  3WB1 A;  3JSL A;  3HKB A;  4O4H A;  5EIB D;  4CH3 A;  3K58 A;  1NYQ A;  3MEY A;  1EOV A;  5LP6 C;  4JI1 B;  1NJ5 A;  1X2G A;  5C52 B;  4YJ2 A;  2EAY A;  1XMQ B;  2PYL A;  3V8L A;  5JJN B;  1QE0 A;  1L0W A;  5KHG A;  3BFM A;  4H2W A;  1VQZ A;  2ZXF A;  1SA0 B;  5ITZ A;  4ZHQ B;  2ARS A;  3K59 A;  2J3M A;  3NEN A;  4KQE A;  5E3I A;  3SJA C;  4LH6 A;  4ZHQ A;  4O4L B;  1HXD A;  4XU2 A;  1X54 A;  5FPO A;  2PTM A;  2I4O A;  4LFC B;  3MF2 A;  4K88 A;  4UFZ A;  4P71 C;  4X62 B;  1M93 A;  1WN7 A;  1Q3E A;  4JI3 B;  2HNI A;  2Q0A A;  3QTC A;  3A74 A;  4CH4 A;  1H2S B;  2P5I A;  3BHP A;  5LA6 A;  5LYJ B;  1G5H A;  3BJU A;  3HKC B;  2PME A;  2JVD A;  4AIL C;  3QNE A;  3U0Z A;  3CMQ A;  1XI1 A;  3HFZ A;  1SKV A;  2F95 B;  4KHP B;  2DXU A;  3P8V A;  2E5L B;  5JJE B;  3HKE B;  3FFQ A;  3K5L A;  1XNQ B;  2PY5 A;  1X2H A;  1EIY B;  3V7C A;  2KKW A;  3ICX A;  5IYZ B;  4EB6 B;  1E1T A;  1B8A A;  3CHX A;  2DVE A;  4B3R B;  5LP6 A;  3WB0 A;  2YIB D;  4YP0 A;  4O2A B;  1Q5O A;  1XQ8 A;  4X20 A;  1NJ6 A;  1FFX A;  2ZIN A;  2DTO A;  3PCO B;  3NEL A;  1O9G A;  3ERR A;  4D7T A;  1ASZ A;  4X1I B;  3QO8 A;  2UXD B;  4O4L A;  4YCU A;  3THO A;  2VWJ A;  3HXX A;  3BAA A;  3RGB A;  2Q7G A;  4RQF A;  4YYE A;  3WQZ A;  4FM2 A;  1BIA A;  3BA8 A;  5ITZ B;  3ETQ A;  5JQG B;  4XTV A;  1SQG A;  1P49 A;  1Q43 A;  2BTO A;  4JI2 B;  4P71 A;  2EJG A;  4UCT A;  3BAB A;  2BTQ A;  1M5I A;  4YRR A;  4KR2 A;  2UU9 B;  4F6R A;  1WYD A;  2C8M A;  4HT4 A;  4YRJ A;  4DPG A;  4LF9 B;  3SJB C;  4CS2 A;  1HNZ B;  4DRX A;  5JVD A;  4LF5 B;  2E10 A;  4CS3 A;  3JAK B;  5C51 B;  3RYF B;  4P72 A;  2ZNJ A;  2QHV A;  1FFX B;  2F1M A;  4KL1 A;  1N9W A;  3REX A;  3JAL B;  4FVM A;  4X20 B;  1YB3 A;  2DTH A;  2J3L A;  1I7F A;  1H4S A;  4P3N A;  3HY1 A;  4HWO A;  1EIY A;  3EFS A;  4YRT A;  1DGS A;  2CJA A;  5EIB C;  1XHX A;  4P3O A;  1C0A A;  5FNV B;  4LVI A;  4GKK B;  3LSS A;  4CS4 A;  1NJ8 A;  2IY5 B;  3K5O A;  1RIQ A;  4FLV A;  4I4T B;  1XNR B;  3MF1 A;  11AS A;  5LA6 B;  5KHJ A;  3RYH A;  5HGQ A;  3JSN A;  1TAE A;  4D7S A;  1B7Y A;  4X1Y B;  2ZM6 B;  3LC0 A;  4E51 A;  1E1O A;  4UP8 A;  5CB4 B;  2ZR3 A;  4G85 A;  3RIR A;  3UGT A;  4HBN A;  5JH7 B;  4FLU A;  1G5I A;  4X1K A;  3A7U A;  2PYJ A;  2UXC B;  4TV8 B;  2P22 C;  1NT2 B;  4DR2 B;  4XTZ A;  4I50 B;  1QHT A;  4YRN A;  4H2Y A;  4NXM B;  4P72 C;  3L4G B;  4O4J B;  1L8D A;  2I4L A;  1E24 A;  2I4N A;  5IYZ A;  1X4T A;  2UUA B;  2EJF A;  5F5W A;  5J2T B;  3ICA A;  3UT5 B;  1JFF B;  4FLY A;  5IJ0 B;  1B70 B;  5K1P A;  4HVC A;  3HXV A;  4TOI A;  4WF2 A;  4YDQ A;  4L8J A;  2CJB A;  2I4M A;  1W66 A;  5KX5 B;  4XEO A;  2FYK A;  2ZIM A;  3RKX A;  5ELN A;  4OX9 B;  5BMV B;  5KMG B;  3JAT A;  4FLW A;  2E5A A;  4OLF A;  4FLT A;  3M7M X;  3L1A A;  5GON A;  2DQ3 A;  3HKD A;  2PMF A;  1JMK C;  3SJC C;  3HXZ A;  4H2S A;  4ZI7 A;  2Q5I A;  2DEQ A;  3JAR A;  1ZAU A;  4J15 A;  4XTY A;  3TEH A;  3ZS8 C;  4XTW A;  3N2G B;  1Z5V A;  3QF7 A;  1FJG B;  2YI8 A;  4JI7 B;  3M4Q A;  4H02 A;  1BBU A;  4X5O A;  4YRL A;  5EYP A;  4TVA B;  4DUY B;  4LVK A;  2DQ0 A;  4EFE A;  2G4C A;  1EFW A;  2R72 A;  4LNU A;  1PYS B;  4DUZ B;  1TVK A;  3HRK A;  4AH6 A;  5LOV B;  5CA1 B;  3HXW A;  1HTT A;  2AKW B;  4YRK A;  3U10 A;  4UPA A;  4FFB B;  2DU7 A;  2YIB A;  2AMC B;  4YHH B;  3CB2 A;  3CSX A;  1N36 B;  2V4D A;  1Z7M A;  2E65 A;  3N2K A;  3KFU A;  4HNA B;  4HA8 A;  4XU3 A;  1KMI Z;  4WBN B;  3HXY A;  4YY3 B;  12AS A;  2YIA A;  5LMN B;  3RYI B;  2AKW A;  2IM9 A;  4ZTZ B;  1EVL A;  2RHS A;  3JAS A;  3RYC B;  2EX3 A;  4UCS A;  4FLX A;  1IBK B;  5D5Q A;  4CH5 A;  2Q5H A;  1KMN A;  5EYP B;  4TV9 B;  1ADJ A;  2ALY B;  4UCU A;  4RMF A;  1VF7 A;  4CH6 A;  3IAY A;  2PGG A;  4LF7 B;  1ASY A;  2VQE B;  4X65 B;  2RHQ A;  4TWA A;  5JCO A;  4NCX A;  2UUB B;  4FM1 A;  4YRF A;  1EQR A;  3PZC A;  5BR8 B;  2EWN A;  5IJ9 A;  4YRG A;  4RDX A;  5K1X A;  3T1Y B;  3V7R A;  4UCV A;  3V8J A;  4ZOL B;  1BBW A;  1IBM B;  1BIB A;  4BWA A;  4DV6 B;  3HKD B;  4YJ3 A;  4P75 C;  5LXT A;  3JAT B;  4WBN A;  2VQF B;  3RAC A;  1HR0 B;  1I94 B;  3MAQ A;  2A8E A;  4H2X A;  3IKM B;  4AQY B;  4YRI A;  4TUY B;  4PI0 A;  5C8Y A;  5CA0 B;  4I55 B;  4LVJ A;  2AMC A;  4YPF A;  3VQW A;  1JJC A;  4JYA B;  3E22 A;  3E22 B;  3FJP A;  4I9Q A;  1TVK B;  4TQF A;  1H4T A;  2CAZ C;  1YEW A;  1YFT A;  5LMU B;  2DZC A;  5KHK A;  4HWT A;  4I55 A;  4YCV A;  1WPB A;  4LVL A;  5C8Y B;  1TUB A;  4XU0 A;  4LF6 B;  2DKG A;  3A32 A;  5JCO C;  4DV3 B;  3L2Z A;  5D5P A;  4LVM A;  2DZ9 A;  1X01 A;  3P8T A;  3P8Y A;  2ZIO A;  4B3T B;  1YFR A;  3NET A;  3HRI A;  5J2U A;  3RFR A;  1NJ2 A;  3E9H A;  1G6U A;  4PI2 A;  3K57 A;  3EFR A;  3JAW A;  4JI8 B;  5IJ9 B;  4L87 A;  1RSO A;  4BW9 A;  1ADY A;  4P75 A;  4K86 A;  3JAW B;  4X64 B;  2HHH B;  1H4V B;  3HFV A;  1Q8I A;  5JJJ B;  3OD1 A;  1WU7 A;  3K5M A;  4YRS A;  5J2U B;  1IL2 A;  3R07 A;  2RJZ A;  2ZZE A;  1WQ7 A;  4B3M B;  3QO7 A;  2PUS A;  4EFB A;  3TEG A;  3UFG A;  3OTF A;  4DR7 B;  4PHZ A;  5IJ0 A;  4YRO A;  4YRP A;  2E64 A;  3SR2 C;  4K8X A;  2ODR C;  4WJ4 A;  2RHS B;  1N34 B;  1TUB B;  1YFS A;  4G84 A;  1QF6 A;  3A5Z A;  4DR4 B;  3BA9 A;  3ZED A;  4IHJ B;  2ZZF A;  2R9A A;  4O2B A;  1X55 A;  3L4G A;  4UP9 A;  1KMM A;  4JI4 B;  4P74 A;  3LNN A;  1JJC B;  2P0L A;  4NXN B;  1KOG A;  1Z7N A;  4TV8 A;  4YRM A;  2JS5 A;  1SES A;  4GKJ B;  2ARU A;  4H2X B;  4O2B B;  3V8K A;  2R70 A;  2UXB B;  4P3P A;  4GLX A;  5KNN A;  5CB4 A;  4ZOL A;  2QHT A;  2XHB A;  1M4U A;  2ZZG A;  4FFB A;  4K87 A;  4IIJ B;  4O4I B;  1ATI A;  1SQF A;  4TVA A;  5ELO A;  3IKL A;  4DR3 B;  2XTI A;  4HWP A;  4U3J A;  4K8Z A;  1X56 A;  4HWR A;  3UQ8 A;  5LOV A;  2RHQ B;  3VQY A;  4B08 A;  2ODR D;  3DSQ A;  4JI0 B;  1KU9 A;  2NS6 A;  3W3S A;  2ZR2 A;  4DV2 B;  3A5Y A;  3JAR B;  4X1I A;  3B2E E;  4FM0 A;  3JAS B;  3A2F A;  4JV5 B;  1WPY A;  4U3J B;  2ALY A;  4LH7 A;  4TV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...