3DSQA

Structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
278
Chain Sequence
PPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Desulfitobacterium hafniense PylSc, a pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
molecule keywords Pyrrolysyl-tRNA synthetase
total genus 80
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3dsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3dsqA02
1WNLA 1EQRA 4G84A 2E10A 1KOGA 4YRSA 4YRNA 3QO7A 4ZTZB 2AKWA 1N9WA 4KR2A 4YRQA 1G6UA 1RIQA 2ZT8A 1B70A 2ZR2A 4UPAA 1USYC 1ATIA 2CJ9A 2EAYA 2ALYB 3NEMA 3HFZB 2DKGA 4XTYA 2ZZEA 4YRIA 4H2VA 5C52B 3P8YA 1L0WA 2Q7HA 4CH6A 3UFGA 4H2YA 3NELA 2DU7A 3HXVA 2ZNIA 4K86A 2QHUA 4RQEA 4WI1A 3A7UA 2DZ9A 1O9GA 3A74A 2ARTA 1E1OA 2ZCEA 1C0AA 1IL2A 1HXDA 2ZR3A 2DJZA 4YPFA 4UP7A 1JJCB 2ODRC 4CH3A 4ZTUB 4OLFA 4X5OA 3VQYA 3ICAA 2G4CA 1NJ2A 2DDZA 3M4PA 4HVCA 2DXUA 4XU3A 3RL6A 4YRTA 3UGTA 4CH4A 1E24A 3RF1A 4TVYA 1EIYA 1X2HA 4TWAA 4TQDA 1H4VB 4P72A 1HC7A 2YI9A 3L2ZA 4HA8A 1X54A 2HEPA 3REXA 5E3IA 3A5YA 2ZT6A 2ARSA 4G85A 1G51A 1B70B 4XU1A 4HWRA 3HFZA 2CJBA 3IG2A 2XTIA 4P72C 1BBWA 4YCUA 5F5WA 3KFUA 3RKXA 3HY0A 4CS2A 1YGBA 4YRKA 4H2XA 3RIRA 3A32A 3HRIA 4TVAB 4YROA 2P5IA 4YRGA 2QHVA 3DSQA 4DQ2A 4RQFA 2P0LA 3L1AA 4BW9A 2AMCB 3BFMA 4P74A 3IALA 4XTZA 2RHSA 3W3SA 2EL9A 3RGLA 3G1ZA 2E3CA 1G5IA 2DZCA 1E22A 4HWOA 3TEGA 3NENA 2I4MA 3A31A 3HRKA 3L4GB 3RKYA 4WF2A 3RUXA 2ODRD 3VQXA 1NJ5A 2CJAA 3REUA 4AH6A 4K87A 3A5ZA 1KMMA 4XEOA 3PZCA 2JVDA 4TQFA 5ELNA 4Q15A 1ADJA 1SETA 3PCOA 5K1PA 3UGQA 2IY5A 2ZIOA 2ZGWA 4YRMA 1LYLA 4EO4A 3A7RA 3EFRA 2DXTA 2RHQA 4H2UA 1NNHA 4CH5A 2ZXFA 1EOVA 4XEMA 1GGMA 4NCXA 3VQVA 1NJ6A 3QTCA 12ASA 4CS3A 1H4SA 1VQZA 1NJ1A 3HFVA 1O9HA 2EJFA 4ZIBA 4P3NA 3HXYA 3V8LA 2ZNJA 4UP8A 1ASYA 3E9IA 4XTXA 1EIYB 3ZEDA 2E64A 4WJ4A 2ZINA 4YREA 3UH0A 1EFWA 2J3MA 1YB3A 3TEHA 2QJ1A 4YDQA 4YCVA 1ASZA 2I4NA 1X55A 2ZIMA 3A7AA 1QF6A 2DVEA 2EWNA 2Q5HA 3V7SA 4K88A 2AMCA 2E5AA 3M4QA 2RHSB 2R72A 4YRCA 2I4LA 4KR3A 3QO5A 2ARUA 1WU7A 2Q5IA 2ZTGA 3EFSA 2EJGA 2ZT7A 4YP0A 4P71C 3PCOB 1W66A 4TVAA 3ERRA 1G5HA 4LNSA 3V7RA 1WQWA 3HXUA 1X56A 1EVKA 1Z7MA 4YYEA 4Q6GA 1J5WA 4H02A 1HTTA 3LSSA 3LSQA 2YIAA 1X2GA 4HWTA 2FYKA 2E41A 3L4GA 1B7YB 3QO8A 4P73C 4PHCA 5C51B 2HNIA 1PYSB 4YRFA 4EX5A 1EVLA 1B76A 2E1HA 3OD1A 11ASA 4XU0A 1Z7NA 4H2TA 2Q7GA 4RDXA 3FJPA 4HWPA 1E1TA 4XTWA 3V8KA 5ELOA 3IKLA 1NJ8A 2IY5B 4J15A 1X01A 2YIBA 2CGHA 1YFRA 2ZZFA 2C8MA 1BIAA 3E9HA 4XU2A 2AKWB 3I7FA 1YFTA 4YRPA 3V8JA 3IKMB 4P75A 4OP0A 1NYRA 4TVWA 4P3PA 5HGQA 3TUPA 4P75C 2DTHA 2XGTA 3LC0A 1SESA 4TTVA 2RHQB 3VBBA 1WYDA 3MF1A 4L87A 3P8VA 2PMEA 2RQ6A 2R70A 4CS4A 2DU5A 3BJUA 4YCWA 2YIBD 3HXWA 4PG3A 2QHSA 1BBUA 5K1XA 3HXXA 3MF2A 3R07A 4YRLA 1QE0A 1B7YA 3HTZA 4HWSA 4YRJA 4XTVA 3TEHB 2I4OA 3VQWA 3QNEA 1WPYA 4XTUA 2ALYA 4P74C 1NYQA 2CIMA 4DPGA 1ADYA 3MEYA 5KNNA 2PMFA 1H4TA 4BWAA 2ZZGA 3CMQA 2DTOA 1WLEA 2DQ0A 1BIBA 2RJZA 2C7IA 3P8TA 4P71A 3V7CA 2ZT5A 3HXZA 1KMNA 1B8AA 4P73A 4WJ3M 4E51A 4P3OA 1WQ7A 2Q7EA 4H2WA 1JJCA 1SRYA 1PYSA 2DQ3A 2EJ9A 1YFSA 3HY1A 4KQEA 2PUSA 5C53B 1USYA 3NETA 4H2XB 4RMFA 4YRRA 3RACA 2QHTA 3RKWA 1H4QA 3BHPA 2DEQA 3WQZA 2E65A 1FYFA 4H2SA 2DTIA 2YI8A 4O2DA 1SERA 2J3LA 4UP9A 2PGGA
chains in the Genus database with same CATH superfamily
3SYQA 2WPDG 4LF9O 2UXXA 3P32A 3C3SA 1BCCH 3LSUA 3CC4V 1FPOA 3AEIA 1KOGA 1JFFB 4YRSA 4LR3A 4PA4A 4TV8A 1YCIA 4WFGA 4KR2A 5JH7B 4YRQA 1G6UA 3K03A 4GT1A 2DMXA 1YHQV 1GN6A 3CXHF 2UXDB 1Z5VA 1GM7A 4MTGA 4UPAA 1MA1A 2A06H 1NH2D 1QNMA 1XI1A 3LDDA 5ITZA 4JI8O 1I5YA 4FK5C 4NR1A 1RP3B 1IBKB 3N2KB 2ILMA 3P8YA 2Q7HA 2YSUB 1XMQO 3SR2C 2CE4A 3UFGA 2CH7A 1QVFU 4O2BB 1V55B 3NELA 2DU7A 4J41A 3N2GA 2QHUA 4RQEA 4WI1A 3A7UA 5CA0A 3A74A 2ODMA 2BSKA 4DR5B 1XL4A 2ZKOA 1E1OA 2E76B 4YHHB 3ZX6A 4UP7A 1KP3A 1JJCB 4TUYA 4YIOA 2ODRC 4ZTUB 1XNQO 4X5OA 3VQYA 1XBLA 4HNAB 1NJ2A 3OUSA 1G4YB 2EIKB 2X0LA 4MTOA 3M4PA 4X66B 5LMNB 2LP7A 2VQFB 3IGAC 1N36B 4PI2A 4TVYA 4KFMA 4CBCA 4LF5B 3CEIA 4DRXB 5CBGA 1YTFB 4UB8Z 1Y76B 3JALB 5KMGA 4O4JA 1KKCA 4P72A 1HC7A 3L2ZA 4HA8A 3L72H 1X54A 3REXA 3A0RA 1BZKA 2FL4A 1AJQA 4KP4A 1G51A 1B70B 3JD2A 4JAUA 3X2QB 4P9OA 2WSSG 1S3JA 1XHZA 3JCUZ 4DV6O 2Q68A 4JGSA 1MG1A 4X64O 1NI8A 1NT2B 4YY3O 5DN6G 2BTQA 2R9AA 5JVDA 4P30A 2ZXWB 5LXTB 2ADQB 2JIZG 4NXNO 1TAEA 1RSOA 3AG2B 4R50A 3CPWU 2QHVA 2LW1A 5GTHZ 1SQQH 2EJRA 4RQFA 4DV4O 2P0LA 2AMCB 2XOKG 1IXMA 3IALA 5JH7A 3G1ZA 5CBFA 4DV0O 1VQKV 3W7TA 2DZCA 3P3NA 4HWOA 4EFEA 1K5SA 1QHTA 2GDSA 5EBWC 5LYJA 2I4MA 4MW8A 5EIBD 3HRKA 3RKYA 2KB1A 3K04A 2ODRD 1NJ5A 4AH6A 2ITCC 3M8AA 1KMMA 1AP5A 4XEOA 1TVKB 1R1BA 3OMIB 1OCRB 4F6RA 1Z2GA 2EIMB 3M7MX 4TQFA 1HNXO 1N34B 1XREA 2JGDB 1SETA 3UGQA 3N2GB 3RFRA 1VIBA 1YDXA 2ZGWA 2E75B 2GHYA 1LR1A 3WFVA 4EO4A 3ETQA 3N2KA 2RHQA 3CC7V 4HT4A 4XEMA 4NCXA 4DR5O 5H5NA 3ZRWB 1FJGO 1GRJA 5H2FZ 2A8EA 4MVUA 2BSKB 1VF5B 4J9YB 2OIEA 1KECA 2EIKC 2ZNJA 4UVBA 4B3MB 3UQ8A 2H94A 1NQTA 1IVSA 3W7UA 4X88A 1Y76A 2VQFO 3RYHB 2E64A 1F7YA 1FS0G 2ZDIC 3UH0A 3IFXA 2VWJA 1W0KG 1YB3A 3TEHA 3ZS8C 2OTJV 4LH6A 5JCOC 3BEHA 2NR5A 5LHHA 1H2LA 2GV9A 1AJNA 3HKEB 2E5AA 4DR7B 3SYOA 1AI7A 1SC5B 4YRCA 2I4LA 4KR3A 3AG4B 4TV9B 5KUKA 4DR2B 1F23A 5KUMA 2UU9O 1NZ6A 3DXRB 1L0LH 4UUJC 3K59A 1PM9A 4CZZA 2EZOA 1BQ0A 3PCOB 1EBOA 3ABLB 1W66A 1G1XB 1Q8IA 3J80N 1GO3F 2YC0A 4LNSA 1FFXB 3L75H 3E22B 3K0GA 5C8YA 5B3SC 1EVKA 4LF7B 3L71H 1FXVA 2CTRA 3K5NA 1XQ8A 1JJOA 5FL7G 5LXTA 3JD1A 3OTOB 1HTTA 3U11A 1RFYA 2JJ2G 3AG1C 2HKOA 2IJIA 4DV0B 3QO8A 1Y6XA 2F43G 3P30A 2HNIA 1MMMA 3CRQA 4YRFA 1P84F 4EX5A 1TVKA 3JARA 5KLVH 1EVLA 1M56C 4RO2A 3OD1A 3H1LH 3F7YC 4KHPB 4XU0A 3CRAA 2OYQA 4RDXA 1ZX3A 1R6KA 3D3QA 1BMFG 1M57B 4F6EA 4J7KA 4JV5O 4K8ZA 2YIBA 2W0FC 3K5OA 4PJ0Z 1YFRA 3ZCCA 1WP7A 1HWYA 4W4LA 4F6RB 5LP6C 1OHHG 4FPPA 3ML0A 3WB2A 2JGDA 5IT9N 1NS1A 4OP0A 4L8JA 4EB6B 4ZHQA 4K0KB 4JYCA 2YDEA 4H0LB 4P75C 2O57A 2UUBB 4TTVA 1YITV 2RHQB 5EC2C 4PHZA 3JD3A 3GWKC 4WCEV 2EILB 1PKXA 4L87A 1DLBA 3D8CA 3ZRWA 1HNZB 2A9HA 2PMEA 3I56V 4NVPA 4CS4A 5EYPA 2DU5A 1VF6C 2W6IG 3R66A 3BJUA 3N27A 4JTCB 1KU9A 3TJTA 3HXWA 4PG3A 2RMKB 1B7YA 3S3XA 4HWSA 1L1FA 4UXNA 2QM8A 3JSLA 3MQZA 1FXHA 1JVMA 3RW0A 3TEHB 3G67A 2N05A 2W6JG 3CMEV 4ZI7B 2N04A 3DXRA 3BFRA 5HFMA 3OM3B 1OJHA 1GK9A 4D6TH 4DR2O 3IC9A 3UO3A 3BAAA 4DUYO 4KXRA 4LFCO 4JZ2A 1ADYA 2CIMA 3MEYA 2PMFA 3SPHA 5H6QA 3SJAC 2NNUA 1A32A 4TV9A 4DR3O 4NTWA 4JI6O 1WLEA 1J5EO 1Q81W 4PA6A 4B08A 5KHGA 1JJ2U 1B8AA 1S76D 1FFXA 4E51A 5E1AC 4I7ZB 2DYSB 2OTLV 3WB1A 1BHBA 4IHJA 2DQ3A 5IY5C 1WPXA 2EJ9A 4KQEA 4FLXA 4UCUA 4GKJB 2P90A 3NETA 4E2LA 3LDCA 3Q4HB 3E2EA 2DEQA 3J7AU 4KHPO 2Q67A 2A7WA 2BCCH 2VQEB 1N33B 2UXDO 2UXBB 2XT9A 4QJFB 4O4LA 4X1KB 5FNVA 2HG5C 5CBHA 4NTXA 1BT8A 1P4RA 4UP9A 5IYDO 2JS5A 4DV2B 1K8AW 1WNLA 2UXCB 2QWNB 1QCEA 3T4DA 2E10A 3T1HB 1TA8A 3CJHA 4FZ0A 3E86A 3UM7A 3RVYA 2WLMA 1E1QG 4LNUA 2JRIA 3RBZA 4JTAB 2L35A 1GAXA 4YHHO 1OCRC 3TETA 3KCYA 2CJ9A 3HFZB 1XNQB 5EYPB 3FB7C 4KL1A 4LCUC 4J80A 4ABMA 4YRIA 3D36C 1D5AA 1RM1C 3CCMV 1NR1A 4CH6A 1V54C 1YSCA 4FFKA 3QVNA 2OCCC 3F5WC 3OR7C 2PTMA 2ZNIA 3ASNC 2DZ9A 2WLJA 1AR4A 2V4DA 4G2KA 3ZJZA 1SQVH 2DJZA 3WU2Z 2X6BA 1WJZA 4PA3A 3B2EE 4OLFA 1B06A 1L0NH 1ZL8A 5KX5A 4FLUA 2EX3A 3A0HZ 4HVCA 4XU3A 4LF4O 3BCCH 3TXSA 2BOCC 5EK0A 5FPOA 1QVGU 1NH2B 1Q82W 4BIUA 2WA3A 3W7XA 1PPJH 2ZM6O 5F2VO 2CAZC 1IBLB 3OEHG 2HEPA 4LVLA 5B1OA 4PI0A 3DC5A 1N32B 1OCCC 1Y67A 4TV8B 3OMAB 2JEXA 2XTIA 1K73W 2EIMC 4BW5A 1Z5WA 5AG2A 4RUFA 3CC2V 5LA6A 1TGOA 1V55C 5KA5A 2ZQMA 3RKXA 2EULA 4LC1A 3QG5A 2HHHO 2JEUA 4JI0O 4WFBV 3RIRA 5ITZB 4F4LA 3CYOA 3ABKB 4TVAB 2WLNA 4P2ZA 3DSQA 3CCQV 5DM6V 3CJHB 2X7RB 4BW9A 4CC6A 4O4LB 4X1KA 5FNVB 4UCOA 2QTOA 4XTZA 1Y74B 2CTPA 4JYYA 3ZRSA 5KHIA 4LVJA 3HKDA 1G5IA 2LQTA 4X20A 1QLEC 1XMOB 3AK3A 2A0LA 3NR7A 4X62O 2CJAA 3I55V 1EZVH 2NS6A 3RVZA 3A5ZA 2YICA 2JVDA 4I4TA 1R6TA 3AK2A 2DYRC 3FD9A 1OZ0A 3PJSK 2P4VA 2QR4A 1TUEB 5IYZA 4Q15A 1ADJA 5K1PA 1K3EA 2IY5A 2ZIOA 2UUAO 1H2NA 3FB5C 2E5LO 4W4KA 5LMUB 4X8AA 4DRXA 4A5UB 4DV1O 4AQYO 3C3TA 3MHSC 4AI8A 5LP6B 4I50A 1U96A 3K3WA 1GGMA 4UCSA 4H33A 1VMGA 1H8EG 3E35A 1QU7A 1K5QA 1KQSU 1R3IC 3B8NA 1H4SA 3SYPA 1EFRG 3D3IA 3HFVA 2Y0PA 4J10A 2EJFA 4OPHA 2DYSC 2XTAA 3BRCA 1DK1A 3RYFA 4X9QA 5C93A 2ITDC 5A9GA 3WB0A 4ZOLB 1DF4A 4MT8A 3ZMUA 2M7WA 4X1IB 3ABTA 4QNHB 2ZINA 2BTQB 1HR0O 1EFWA 1TUBA 4IL6Z 1NBMG 5JJEB 5LBQA 1LUVA 1RSOB 3H9VA 5B1BB 1ZTEA 2IJKA 3RN4A 5EBLC 2F95B 2ZIMA 3M99B 1J95A 2AHZA 4LF7O 4MVOA 3B40A 2AMCA 3M4QA 5FLXN 3OT7A 1AROP 3WG7B 1AB3A 3UT5A 4Z2WA 1GN3A 4XDLA 3QO5A 3CCLV 1I0HA 1EN5A 2QM4A 2F4VB 1KB9F 4YP0A 3H1JH 2WLLA 4TVAA 2IW5A 1RPOA 2IJJA 3ERRA 1HDJA 5LL6Y 3FYEB 4GX5A 5BZBA 3QF7A 2L6LA 2RDCA 1WA8B 5B3SB 1QLEB 4DV7B 2WA4A 3HB3B 4JI8B 5B1AC 4DXWA 1ZSPA 3ABUA 4X20B 2GSMB 5J2TB 1Q5OA 5TISZ 1H2GA 4HWTA 1ENVA 1ROPA 4U7OA 2K9PA 1PNKA 3T4ZA 2Q0OC 3CD6V 3HKDB 2BTOA 1N0JA 4I55A 4MSWC 3JAWA 4LFAB 4X62B 3FJPA 4XTWA 5ELOA 5EBMC 4DYLA 1NJ8A 2OWOA 2QWQB 5B1BC 2IY5B 4NB5A 4PDLA 4DR1O 1D5NA 5J2UB 2AZ0A 1FYJA 1BIAA 1Y4MA 1OCOB 3RGBA 2PF4E 5LMNO 4JI1B 3O65A 1VEWA 4I5SA 2QE7G 5IYZB 4MTXA 4IIJB 2VRZA 1MABG 1Y66A 2OCHA 2H3OA 4YRPA 3V8JA 1M5IA 3ZN1A 4YJ3B 4BIZA 4TVWA 5LGNA 4FLWA 2XGTA 5LP6A 4LF6B 4I50B 1FD9A 1KMIZ 1SKVA 2G38A 3D36A 4QE7A 4MVRA 3CS5A 3P8VA 1R3KC 1FAFA 4X1YA 2RQ6A 3UO2A 3L9DA 1GMGA 2R70A 4D7TA 4AILC 4DV6B 3EFFK 3MD0A 1R3JC 4U3FH 4YCWA 4J7ZA 3E22A 2YIBD 4JI6B 2YUAA 3MF2A 1WP8A 3HTZA 4U3JB 3W7SA 1P7GA 1FXKB 1VQLV 3SJCC 2YS8A 2Q0AA 2OCCB 4YRJA 5GONB 3TGUH 1XNRB 1K7DA 2P22C 3ABKC 3KCXA 1B04A 3OGCC 3QNEA 3OGIB 4DUZB 4UCRA 2ALYA 1ZWIC 4LVIA 2WLLB 4NXMB 2QKCA 4LFBO 1F51A 1ORQC 1GM8A 4BWAA 4GKJO 2AXTZ 2QGNA 1PNLA 3KZIZ 5CA1A 2Z3YA 3CMQA 2DTOA 1BIBA 3F7VC 1X4TA 3B8MA 5KAFZ 4FZ1A 2YEVB 2DWDC 2QEXV 3FKSG 2UXBO 3V7CA 1AI4A 4DV7O 3HXZA 3SDLA 3L74H 2W0XA 5IYBO 4MTFA 2Q7EA 3SYCA 4H2WA 3W7WA 5KA6A 1SRYA 3VOUA 4FIPC 1YFSA 1U97A 2PUSA 5C53B 4MW3A 1IBKO 3E83A 5LOVB 3RYIB 2QSAA 4I55B 4FLYA 3JAWB 1USYA 1CPYA 5CA0B 4RMFA 1M4UA 3RACA 2IH1C 4DO2A 3RKWA 2Z5UA 1H4QA 2DJVA 4MVSA 2E65A 2ZD9A 1M1KW 4O2DA 2J3LA 3FAVA 1WAZA 3JD4A 5LGUA 2AZ2A 1GN4A 2XHBA 4G84A 1JA8A 1EM1A 2IM9A 4B3TB 4JI1O 2ETNA 1XOUA 3CRMA 5KMGB 4X65B 4ZTZB 1N36O 2WLIA 1SQFA 1RIQA 2ATKC 4B3SB 1SS3A 4LWSB 1SQBH 4YJ2A 4LF6O 3K57A 2ZR2A 3CCEV 1B70A 2ZT8A 4DW1A 2EAYA 1ATIA 2VWKA 3NEMA 4JI7O 4XTYA 5IWAB 2WLHA 2YIDA 2DOSA 5IYCO 3B09A 1XUQA 3TXQA 3JATB 4DK0A 4H2VA 2XAGA 3AG2C 3HPLC 1P7BA 1Q90D 1L0WA 4DR4B 4JASA 1FXKA 5JVDB 5IJ0B 3A0BZ 3HXVA 4K86A 2LFRA 1Q6HA 1UPGA 3ZHTA 4JI3O 4GKKO 1O9GA 4JYAB 1KYOF 3CMAV 2ARTA 1C0AA 1IL2A 1HXDA 2EIJB 1BS3A 3HR0A 4YPFA 3SGIA 4E4EA 4BR6A 2G4CA 5GONA 4XBFA 4DV4B 1BGYH 4FFBB 1F4MA 4DR6O 4BAYA 4YRTA 3ASOC 3Q4HA 3UGTA 3C90A 3DTUB 1URFA 1E24A 3H1KH 5L3BA 1NVPB 3H01A 5BXZA 2KSDA 1H4VB 1GKFA 4UV9A 2IH3C 1HNWB 2HVKC 1VQMV 1IBMB 2JK5C 4N21A 3CCVV 4J11A 1CEZA 3CRRA 5D5QA 5E3IA 1IZ3A 2YEVA 2ZT6A 3HKBA 3FX7A 3RYIA 4D7SA 3CHXA 2ARSA 4G85A 5EIBC 4XU1A 3FYIB 1XL6A 4HWRA 2ADPA 3E8HA 2EZPA 1M9NA 1N34O 2ZE5A 4YCUA 1H2SB 4LNUB 3B77A 1YJWV 2FB5A 4Z1MG 3KKYA 5B1AB 3R65A 1OCZB 1K97A 3K5MA 3FAVB 3JASA 1DF5A 2QKSA 3HY0A 4CS2A 1YVWA 2Y69B 4O2BA 3A32A 3HRIA 5JWPA 2P5IA 4YRGA 3LDEA 2DYRB 2XUMA 3BFMA 1RPRA 5L3FA 4P74A 3AG1B 4TUYB 1B6QA 1VQ9V 2RHSA 2C2AA 2UUAB 4R7CA 1I7FA 1KD1W 2E3CA 3U10A 3HKCA 5EC1C 4RUEA 4YJ2B 4LF5O 2F66C 4OXSA 3NENA 3ZHRA 3L4GB 2MK3A 4WF2A 3STLC 4B3SO 1MSDA 3RUXA 5E79Z 4NYKA 3VQXA 3JATA 3REUA 5CA3A 4K87A 3JALA 3PZCA 4G27B 4JI7B 4UV8A 1KP2A 4DR7O 2JS3A 2QM7A 4IYIA 5ELNA 4DUYB 4PELA 1VF7A 4R6ZA 1VQ8V 2UXNA 2B5UA 3PCOA 1HP8A 2X6AA 1AP6A 2CTQA 4X64B 1WN7A 4YRMA 3A7RA 4GX1A 5B1NA 2DXTA 4H2UA 3T1YO 1BSMA 3BPZA 4CH5A 1EOVA 4JI3B 4GKKB 3BA9A 3VQVA 4JYAO 1NJ6A 12ASA 3CCRV 1OCCB 1NJ1A 1VQZA 2Y4TA 3L70H 2GUZB 3K08A 1O9HA 4LP8A 1I08A 5KHKA 3HXYA 4P3NA 3V8LA 1LUWA 1ASYA 3E9IA 1SF9A 1YJNV 2CDYA 2P5OA 2LO1A 3ZEDA 2PZSA 4DR6B 2JGUA 4J9ZB 3JARB 4WJ4A 2IU0A 5KAIZ 4YREA 3EHBB 2CUGA 4YDQA 1SA0B 1ASZA 1MSWD 3RYCA 1X55A 2Q73A 2KQXA 1T5EA 4H37A 1HNWO 1JR9A 3IC7A 4PA7A 3A7AA 2MW2B 4K35A 2DVEA 2EWNA 1QF6A 2D2CB 5CMUA 1K34A 1LNQA 3G71V 1Q3EA 2UXCO 1AR5A 1BHAA 1Y74A 4JV5B 4UFZA 1R6NA 2B9ZA 3FFQA 4O4HB 2ARUA 2Q5IA 4FM2A 3JASB 3TK1A 1WB7A 3CSXA 4EB6A 4ZHQB 5B5EZ 4QPKA 1AR1B 3JAKB 5L3EA 5KHHA 3J81N 4JI2O 3V7RA 4LFAO 1S5LZ 1V54B 3OEEG 5JJNB 4K0KO 3HXUA 5EZYB 1FJGB 3ZN0A 1Z7MA 3CRCA 4Q6GA 1SQGA 1VP7A 3GVMA 3JD0A 3T2MA 4WFHA 3ABLC 1PL4A 3HKCB 1EN6A 2AHYA 3LSSA 3LSQA 2P7TC 4PV1B 2YXLA 2YIAA 5JJJB 3JSNA 2HP8A 4OX9B 1X2GA 4XDKA 2FYKA 4WFAV 1VQNV 2E41A 3L4GA 3OAAG 4X66O 1B7YB 2NLJC 3ICXA 4PHCA 3ZHVA 1PYSB 3L73H 3RYHA 1B76A 2Q5ZA 4FLVA 2HR3A 5H6RA 1Z7NA 3G80A 1KUQA 5L3CA 3MHHC 5LGTA 3V8KA 1E1TA 1MOFA 1EN4A 3IKLA 3OMNB 1VF6A 3DC6A 1H8HG 4IYHA 4TT3G 3O9OA 4WF9V 2C8MA 5FPRA 3ZHSA 3ASOB 3X2QC 3E9HA 4XU2A 1KC8W 2AKWB 2DWEC 2V7QG 3B4SA 3I7FA 1YFTA 4JPRA 1TUBB 2WWWA 1K9MW 1YJ9V 3SPGA 2HJFC 4PDRA 3IKMB 3LNMB 4P75A 1OCOC 1ZAUA 2QWOB 4YY3B 3T1YB 2ZM6B 2A79B 1NYRA 2JDIG 4P3PA 5HGQA 2D3OW 2DTHA 4DK1A 1PV0A 4X89A 1SESA 4LVKA 3UT5B 3SYAA 3OTOO 1JPXA 1JCHA 3MF1A 2XAQA 4JI4O 3E8GA 1US6A 3TCUA 1I5XA 2GUZA 4XDJA 1SA0A 4J7JA 4R8CA 1PL0A 3K58A 3THOA 3ETGA 4BIOA 1BBUA 3R07A 1WA8A 4YRLA 4LVMA 2QA4V 2Y4UA 2N74A 3ASNB 4DV3O 4MVQA 1NJIW 1JMKC 1AI5A 1I94B 3CXCU 3VQWA 2XASA 1WPYA 1VARA 3K0DA 4DV2O 3G4SV 3A8TA 3JAMN 3OW2U 2LW7A 4P74C 3F5TA 4IGGA 5BR8O 1R3LC 4DPGA 5KNNA 1AI6A 4G28B 2R9IA 1H4TA 2YXHA 1JQ0A 3UKMA 2ZZGA 4PDMA 2UUCB 2DQ0A 2VS0A 3MDSA 4JI2B 2C7IA 2CGNA 1FKAO 4P71A 2XAJA 4N23A 2ZE6A 2PYLA 1SQPH 3JAKA 2ZT5A 2HVJC 4YXWG 4WJ3M 2ZDIA 3I5DA 2M6YA 1BL8A 5J2UA 1WPBA 1JJCA 1PP9H 1XHXA 1NR7A 1PYSA 1KKDA 4B3MO 4OX9O 3SJQC 4JI5O 3LUTB 5JQGB 2ZT9B 2B1GA 4TOIA 4H2XB 4LF8B 2JJ1G 4PA9A 3BHPA 3CCUV 4K3AA 3WQZA 4H2SA 1FYFA 1K33A 4O4IB 2DTIA 1X59A 4B3RB 3ZHUA 1XDCA 3APOA 4J42A 1MZEA 2YI8A 1SERA 1ZL8B 5KX5B 1W2BU 2PY5A 2H8PC 1BQZA 4DV5O 4EEQA 5L3GA 4I0XA 4X1YB 1EQRA 4ZI7A 4CC5A 1VQ4V 1NTZH 3G6BA 3STZC 4DR4O 4DR3B 1KBHA 4Z1VA 3APQA 4YRNA 1W0JG 3EXAA 3QO7A 2AKWA 2QKAA 1N9WA 1J5EB 4YIPA 2FYUH 3UCSC 1GN2A 4QE9A 3S3WA 2EBOA 4JZGA 2ARHA 3P3PA 2Q69A 4GUNA 4NKGB 5BMVA 1USYC 1IBLO 2ALYB 1IX9A 2DKGA 1UJWB 1S77D 2ZE7A 3CWBH 2ZZEA 3EVKA 4JF3A 1VQ5V 1XILA 1PNMA 5C52B 2P6JA 3WG7C 1S72V 4HAMA 2Y69C 4GCZA 1R73A 3T1CA 5DECA 3ZMTA 3ZMZA 4H2YA 4I9QA 4TSFG 3E89A 2HJDA 2RNBA 4DV3B 2R9RB 2VQEO 1N33O 2XAHA 1Q43A 1D2DA 4B7KA 2EINB 5LYJB 2ZCEA 1IBMO 2ZR3A 4JAVA 1K4CC 4MS2A 4CH3A 3U0ZA 1N0NA 2LJ2A 3ICAA 2DDZA 5LOVA 1Q6UA 2DXUA 2FTKA 1F4NA 3RL6A 2V1DA 4CH4A 1YXBA 1B3QA 1XMQB 2KKWA 4JTDB 4UCTA 3RF1A 2WAMA 4UB6Z 1EIYA 4WFFA 1X2HA 4TWAA 4TQDA 3G6EV 4I4TB 1YZBA 2YI9A 2BOBC 2Q6AA 2UUBO 3AG3B 2YXYA 3A5YA 5JQGA 3DGEA 4QIWF 3K5LA 2P4KA 3HFZA 1L8DA 3LNNA 1GM9A 2CJBA 4JI5B 3IG2A 2EJ7A 4P72C 2K1EA 4WFEA 1BBWA 5F5WA 2WLIB 4LF8O 1M90W 3KFUA 4DV1B 1JX9A 4LWSA 4AQYB 1Q6IA 4I0XB 2WLKA 3MAQA 3ZRXA 4B3RO 1YGBA 4YRKA 4GLXA 4H2XA 5DEDA 4Q20A 4YROA 1SQXH 3PN1A 2QWRB 3RYFB 2EIJC 3NXSA 4O4IA 4DQ2A 3ZMVA 3HKEA 2LFSA 3L1AA 1DGSA 1NTMH 4X1IA 1CP9A 4FLZA 3CCSV 3W3SA 4LF4B 2EL9A 3RGLA 4LFCB 3ABMB 5CB4B 2FKXA 1E22A 3CX5F 4ZKIA 3TEGA 3A31A 3AK1A 1OV9A 2Y48A 1Q7YW 2X6CA 4WBNA 1VQ7V 3E8BA 5IE9A 4HYOA 3BVOA 4IT5A 1MNGA 4NXNB 1N4CA 1YF2A 5C8YB 4DUZO 2E74B 4FFBA 4GZRB 4HZ3A 1QR8A 1VQOV 1AJPA 5BMVB 4LH7A 3ZBHA 2Q8VA 2IU3A 5GW7A 1N8RW 2F4VO 2ZE8A 1SZTA 4ICGA 4FMTA 1LYLA 1W59A 4JAAA 3EFRA 1AILA 1NNHA 2ZXFA 4JI0B 1FFTB 2GTAA 3QTCA 5LA6B 2DW4A 4CS3A 1QLNA 2KG7A 3HKBB 2XAFA 5BY1A 5J9PC 4ZIBA 2QWPB 3RWRD 2NN4A 1HNXB 5IJ9A 4QPJA 3IJ4A 4PDVA 4UP8A 1NKDA 1GH6A 4XTXA 1EIYB 1HW7A 4EKWA 4LBEC 3T1HO 4O2AA 1ZLZA 2J3MA 2QJ1A 4P9PA 5IY5B 4YCVA 2RN9A 2I4NA 4PD4F 1YTFD 3K9SA 4UCVA 1NU1H 2Q5HA 5A2QN 3V7SA 1SZXA 2CTWA 4K88A 4NTYA 4K8XA 2F1MA 1RM1B 4FVMA 2RHSB 2R72A 4H13B 4B3TO 1WU7A 5B66Z 3FB6C 2ZTGA 3EFSA 2EJGA 1UFIA 2ZT7A 2AGAA 4P71C 3SPIA 4X65O 1E79G 2FMLA 1G5HA 4DW0A 1H38A 3SJBC 1WQWA 1X56A 2PYJA 3ZMSA 4YYEA 2F93B 4MVMA 3IAYA 1J5WA 3GB7C 1QQCA 2HLDG 4H02A 3SPCA 2Q4PA 2Q9LA 1EZJA 1NVPD 5CB4A 3E8FA 1IDSA 2DE0X 2QTSA 2UU9B 1JOYA 1ZUQA 1HR0B 4FJCC 4I9WA 1M93A 2LGWA 4P73C 1S0VA 5C51B 4ZOLA 2PI5A 1DTOA 2QDOA 4H44B 3CCJV 4RWUA 5IDJA 2ZXWC 2E1HA 4ZBMA 1K4DC 4FLTA 3AG7A 11ASA 4GYCB 1YEWA 4H2TA 2Q7GA 5KHJA 3FB8C 4HWPA 2GBOA 3BY6A 1S5JA 2CGOA 4J15A 1G8MA 4WBNB 1JFFA 1X01A 4LF9B 4JI4B 2CGHA 2ZZFA 1VQPV 3ETDA 1YI2V 1N32O 4UVAA 5CA1B 3GWOA 4NXMO 4LFBB 4C7UA 4IHJB 3AG3C 3ETEA 3RYCB 1BE3H 3OE7G 4ASUG 1XEQA 4TWKA 1PD3A 2B1IA 4GX0A 5LHGA 3TUPA 1MZFA 4B7EA 2HHHB 3LC0A 1I94O 3BA8A 1M57C 2XNDG 3VBBA 4GX2A 4O4HA 5H9CA 3SPJA 3ZIAG 3JCZA 1WYDA 4RAIA 2IBZH 2KG7B 3CP1A 4O2AB 4AHCA 1E1RG 5BR8B 4QGPA 1K92A 5IJ9B 3K9AA 3CB2A 5J2TA 4U7NA 3OTFA 4OGQB 4OPAA 1IURA 1YIJV 5K1XA 2UUCO 2OIGA 2EINC 2QHSA 3HXXA 5EZYA 1H2KA 1QE0A 1FXKC 3K79A 3H1HH 1Q86W 1XMOO 3ZHQA 1THZA 5CN0A 2P06A 2CH7B 4KUMA 4XTVA 1NTKH 2I4OA 4DR1B 2RCVA 1WNSA 5LHIA 2CK3G 1AVMA 4XTUA 1VQ6V 2OT5A 5HFLA 3ABMC 1HNZO 1NYQA 1S5HC 1OCZC 3K06A 2AW9A 4HNAA 2HFEC 2E5LB 2DN9A 4O4JB 1WB8A 5LMUO 4UVCA 4FM0A 3JYCA 3A2FA 5GTIZ 2LGQA 4EFBA 3AG4C 2RJZA 4IIJA 4HBNA 3ZRVA 3P8TA 2F23A 5JCOA 3OD4A 4JYBA 3RT3C 3OR6C 1GTOA 1QBZA 1QR9A 1KMNA 4YJ3A 4P73A 4DV5B 4P3OA 1WQ7A 1COWG 2EILC 2Y0IA 5IWAO 3BABA 3HY1A 5L3DA 2IJHA 5IJ0A 2BE3A 2PI4A 1H2MA 1P49A 2A3QA 2Z0AA 3OFNG 3KG2A 4YRRA 2QHTA 1CXZB 3H1IH 5D5PA 1V9PA 2GTSA 1M56B 2P67A 3CE2A 3OUFA 4FM1A 1XNRO 4U3JA 4MVZA 1IXBA 2PGGA
chains in the Genus database with same CATH topology
4X1YB 1WNLA 2UXCB 1EQRA 4ZI7A 4CC5A 2XHBA 4G84A 2IM9A 4B3TB 2E10A 1KOGA 3T1HB 1TA8A 1JFFB 4YRSA 4LR3A 4DR3B 4YRNA 4TV8A 3QO7A 5KMGB 4X65B 4ZTZB 2AKWA 1N9WA 1J5EB 4KR2A 5JH7B 4YRQA 1SQFA 1G6UA 4LNUA 1RIQA 4B3SB 4YJ2A 2UXDB 1Z5VA 3K57A 1B70A 2ZR2A 2ZT8A 4UPAA 5BMVA 1USYC 1ATIA 2VWKA 2CJ9A 2ALYB 2EAYA 3HFZB 2DKGA 1XNQB 3NEMA 4XTYA 1XI1A 5EYPB 5ITZA 5IWAB 4KL1A 2ZZEA 3JATB 4DK0A 4YRIA 4H2VA 1D5AA 5C52B 1IBKB 3N2KB 3P8YA 1L0WA 2Q7HA 4CH6A 4DR4B 3SR2C 3UFGA 5JVDB 4I9QA 5IJ0B 4H2YA 4O2BB 3NELA 2DU7A 2PTMA 3HXVA 3N2GA 2ZNIA 4K86A 2QHUA 4DV3B 4WI1A 4RQEA 3A7UA 5CA0A 1Q43A 2DZ9A 1O9GA 4JYAB 2V4DA 2ARTA 4DR5B 3A74A 5LYJB 1E1OA 2ZCEA 1C0AA 1IL2A 1HXDA 4YHHB 2ZR3A 2DJZA 4YPFA 3SGIA 4UP7A 1JJCB 4TUYA 2ODRC 3B2EE 4CH3A 3U0ZA 4OLFA 4X5OA 4ZTUB 3VQYA 3ICAA 2G4CA 4HNAB 5KX5A 4FLUA 5GONA 1NJ2A 2DDZA 5LOVA 4DV4B 2EX3A 4FFBB 3M4PA 4X66B 4HVCA 2DXUA 5LMNB 4XU3A 2VQFB 3RL6A 4YRTA 3UGTA 4CH4A 1XMQB 2KKWA 1E24A 1N36B 4PI2A 5FPOA 4UCTA 3RF1A 4TVYA 1EIYA 4LF5B 1X2HA 4DRXB 4TWAA 4TQDA 1H4VB 3JALB 5KMGA 4O4JA 1HNWB 4I4TB 4P72A 2CAZC 1IBMB 1HC7A 2YI9A 1IBLB 3L2ZA 4HA8A 1X54A 2HEPA 3REXA 5D5QA 5E3IA 4LVLA 3A5YA 5JQGA 2ZT6A 3HKBA 4PI0A 3K5LA 3RYIA 4D7SA 2ARSA 3CHXA 4G85A 1G51A 5EIBC 1B70B 4XU1A 4HWRA 1N32B 3HFZA 1XHZA 1L8DA 3LNNA 2CJBA 4TV8B 4JI5B 3IG2A 2XTIA 4P72C 1Z5WA 1BBWA 4YCUA 5F5WA 1H2SB 4LNUB 3KFUA 1NT2B 1TGOA 5LA6A 4DV1B 3K5MA 4AQYB 2BTQA 3JASA 3RKXA 2R9AA 3HY0A 5JVDA 3MAQA 4CS2A 3QG5A 4O2BA 5LXTB 1YGBA 4YRKA 4GLXA 4H2XA 3RIRA 1TAEA 1RSOA 5ITZB 3A32A 3HRIA 4TVAB 4YROA 3PN1A 2P5IA 4YRGA 2QHVA 3DSQA 3RYFB 4O4IA 4DQ2A 4RQFA 3HKEA 2P0LA 3L1AA 4BW9A 4CC6A 2AMCB 4O4LB 4X1KA 5FNVB 1DGSA 3BFMA 4P74A 4X1IA 4TUYB 3IALA 4UCOA 4XTZA 4FLZA 2RHSA 2UUAB 3W3SA 1I7FA 4LF4B 2EL9A 5JH7A 3RGLA 3G1ZA 2E3CA 4LFCB 5KHIA 3U10A 4LVJA 3HKDA 1G5IA 3HKCA 5CB4B 2DZCA 1E22A 4X20A 4YJ2B 4HWOA 4EFEA 2F66C 3TEGA 1QHTA 1XMOB 5LYJA 3NENA 2I4MA 3A31A 5EIBD 3HRKA 3L4GB 3RKYA 4WF2A 4WBNA 3RUXA 2ODRD 3VQXA 1NJ5A 2CJAA 3JATA 3REUA 4AH6A 2NS6A 4K87A 3A5ZA 4NXNB 1KMMA 4XEOA 1TVKB 3JALA 3PZCA 5C8YB 4JI7B 4F6RA 2JVDA 4I4TA 3M7MX 4FFBA 4TQFA 5IYZA 1N34B 5ELNA 4Q15A 1ADJA 4DUYB 1VF7A 5BMVB 1SETA 3PCOA 5K1PA 3UGQA 2IY5A 2ZIOA 3N2GB 4LH7A 3RFRA 4X64B 1WN7A 2ZGWA 5LMUB 4DRXA 4YRMA 1LYLA 4EO4A 5LP6B 3ETQA 3N2KA 4I50A 2DXTA 2RHQA 3A7RA 3EFRA 4H2UA 3BPZA 1NNHA 4CH5A 2ZXFA 1EOVA 4HT4A 4JI0B 4JI3B 4GKKB 4UCSA 3BA9A 3VQVA 1GGMA 1NJ6A 4NCXA 5LA6B 3QTCA 12ASA 4CS3A 3HKBB 1H4SA 1VQZA 1NJ1A 4XEMA 3HFVA 2A8EA 1O9HA 2EJFA 5KHKA 4ZIBA 3HXYA 4P3NA 3RWRD 1HNXB 3V8LA 5IJ9A 2ZNJA 4UP8A 3BRCA 1ASYA 3RYFA 3E9IA 4B3MB 3UQ8A 3WB0A 4ZOLB 4XTXA 1EIYB 2P5OA 1HW7A 4DR6B 3ZEDA 2PZSA 2E64A 2JGUA 3RYHB 4X1IB 3JARB 4WJ4A 2ZINA 4O2AA 2BTQB 4YREA 3UH0A 1EFWA 2J3MA 1TUBA 2VWJA 5JJEB 1YB3A 3TEHA 2QJ1A 3ZS8C 4YDQA 1SA0B 4YCVA 1ASZA 4LH6A 5JCOC 3RYCA 1X55A 2F95B 2I4NA 1T5EA 2ZIMA 3A7AA 1QF6A 2DVEA 4UCVA 2EWNA 2GV9A 2Q5HA 3V7SA 3HKEB 4K88A 2AMCA 2E5AA 3M4QA 4DR7B 4K8XA 2F1MA 1Q3EA 4FVMA 2RHSB 2R72A 3UT5A 4JV5B 4YRCA 4UFZA 2I4LA 4KR3A 3FFQA 4O4HB 3QO5A 4TV9B 2ARUA 1WU7A 4DR2B 2Q5IA 4FM2A 2ZTGA 2QM4A 3EFSA 2EJGA 3JASB 2F4VB 3CSXA 4EB6A 4ZHQB 3K59A 2ZT7A 4P71C 4YP0A 3PCOB 1W66A 3JAKB 1Q8IA 4TVAA 5KHHA 3ERRA 1G5HA 4LNSA 1FFXB 3V7RA 3QF7A 3E22B 3SJBC 1WQWA 5JJNB 3HXUA 1X56A 5C8YA 5EZYB 1FJGB 2PYJA 1EVKA 4DV7B 1Z7MA 4YYEA 2F93B 4Q6GA 4LF7B 3IAYA 1J5WA 1SQGA 1QQCA 3K5NA 1XQ8A 4H02A 4JI8B 1JJOA 5LXTA 3OTOB 1HTTA 3U11A 3HKCB 5CB4A 3LSSA 4X20B 3LSQA 5JJJB 2YXLA 2YIAA 5J2TB 3JSNA 1Q5OA 4OX9B 1X2GA 4HWTA 2UU9B 2FYKA 2E41A 3L4GA 1HR0B 4DV0B 1B7YB 3QO8A 1M93A 4P73C 3ICXA 4PHCA 5C51B 4ZOLA 2HNIA 1PYSB 4YRFA 4EX5A 1TVKA 3RYHA 3JARA 1B76A 1EVLA 2E1HA 4FLVA 3OD1A 3HKDB 2BTOA 4FLTA 4KHPB 4I55A 11ASA 3JAWA 2OYQA 4GYCB 4LFAB 1Z7NA 1YEWA 4H2TA 4XU0A 4X62B 2Q7GA 5KHJA 3FJPA 4RDXA 4HWPA 1E1TA 4XTWA 3V8KA 5ELOA 3IKLA 1NJ8A 2OWOA 1S5JA 2IY5B 4J15A 4WBNB 1JFFA 1X01A 4K8ZA 2YIBA 4LF9B 3K5OA 4JI4B 2CGHA 1YFRA 2ZZFA 5J2UB 2C8MA 5FPRA 1BIAA 3E9HA 4XU2A 5CA1B 2AKWB 3RGBA 4F6RB 3I7FA 5LP6C 4JI1B 4LFBB 1YFTA 1TUBB 4IHJB 5IYZB 4IIJB 4YRPA 3V8JA 3WB2A 3IKMB 4P75A 3RYCB 4OP0A 4L8JA 1M5IA 1ZAUA 4ZHQA 4EB6B 4K0KB 4YY3B 3T1YB 2ZM6B 4YJ3B 1NYRA 4TVWA 4P3PA 5HGQA 3TUPA 4P75C 2DTHA 4FLWA 2HHHB 2XGTA 4DK1A 5LP6A 2UUBB 4LF6B 3LC0A 4I50B 1SESA 4TTVA 1KMIZ 3UT5B 2RHQB 1SKVA 4PHZA 4LVKA 3BA8A 3VBBA 4O4HA 1WYDA 3MF1A 4L87A 3P8VA 4AHCA 4O2AB 5BR8B 1HNZB 2PMEA 4X1YA 2RQ6A 4NVPA 2R70A 4D7TA 4AILC 4DV6B 4CS4A 1SA0A 5EYPA 2DU5A 5IJ9B 3CB2A 3BJUA 5J2TA 3K58A 4YCWA 1KU9A 3OTFA 3THOA 3E22A 2YIBD 4JI6B 3HXWA 2QHSA 5K1XA 1BBUA 3HXXA 3MF2A 4PG3A 3R07A 5EZYA 1QE0A 1B7YA 3HTZA 4YRLA 4HWSA 4LVMA 4U3JB 3JSLA 3MQZA 1JMKC 3SJCC 2Q0AA 4YRJA 4XTVA 5GONB 3TEHB 2I4OA 4ZI7B 1XNRB 2P22C 1B04A 1I94B 4DR1B 3VQWA 3QNEA 1WPYA 4DUZB 1WNSA 4XTUA 4UCRA 2ALYA 4P74C 4LVIA 4NXMB 1NYQA 3BAAA 2CIMA 4DPGA 1ADYA 3MEYA 5KNNA 2PMFA 3SJAC 1H4TA 4BWAA 4HNAA 2E5LB 5CA1A 4O4JB 4TV9A 2ZZGA 3CMQA 4FM0A 2DTOA 1WLEA 3A2FA 2UUCB 2DQ0A 4EFBA 1BIBA 2JS5A 1X4TA 2RJZA 4IIJA 4HBNA 4JI2B 2C7IA 3P8TA 5JCOA 4P71A 4B08A 2PYLA 3V7CA 5KHGA 3JAKA 2ZT5A 1KMNA 3HXZA 1B8AA 4YJ3A 4P73A 4WJ3M 4DV5B 1FFXA 4P3OA 4E51A 5J2UA 1WQ7A 1WPBA 2Q7EA 4H2WA 3WB1A 1XHXA 1JJCA 1SRYA 1PYSA 4IHJA 2DQ3A 3BABA 1YFSA 2EJ9A 3HY1A 2PUSA 4FLXA 4KQEA 5C53B 5IJ0A 5JQGB 5LOVB 3RYIB 4I55B 4UCUA 4FLYA 3JAWB 4GKJB 1USYA 1P49A 3NETA 4TOIA 4H2XB 4LF8B 5CA0B 4RMFA 1M4UA 4YRRA 3RACA 2QHTA 3RKWA 1H4QA 3BHPA 2DEQA 3WQZA 2E65A 1FYFA 4H2SA 5D5PA 1V9PA 4O4IB 2DTIA 4FM1A 4B3RB 2VQEB 1N33B 2UXBB 2YI8A 4O4LA 4X1KB 5FNVA 4O2DA 1SERA 2J3LA 4U3JA 5KX5B 4UP9A 2PY5A 4EEQA 2PGGA 4DV2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WNL A;  1EQR A;  4G84 A;  2E10 A;  1KOG A;  4YRS A;  4YRN A;  3QO7 A;  4ZTZ B;  2AKW A;  1N9W A;  4KR2 A;  4YRQ A;  1G6U A;  1RIQ A;  2ZT8 A;  1B70 A;  2ZR2 A;  4UPA A;  1USY C;  1ATI A;  2CJ9 A;  2EAY A;  2ALY B;  3NEM A;  3HFZ B;  2DKG A;  4XTY A;  2ZZE A;  4YRI A;  4H2V A;  5C52 B;  3P8Y A;  1L0W A;  2Q7H A;  4CH6 A;  3UFG A;  4H2Y A;  3NEL A;  2DU7 A;  3HXV A;  2ZNI A;  4K86 A;  2QHU A;  4RQE A;  4WI1 A;  3A7U A;  2DZ9 A;  1O9G A;  3A74 A;  2ART A;  1E1O A;  2ZCE A;  1C0A A;  1IL2 A;  1HXD A;  2ZR3 A;  2DJZ A;  4YPF A;  4UP7 A;  1JJC B;  2ODR C;  4CH3 A;  4ZTU B;  4OLF A;  4X5O A;  3VQY A;  3ICA A;  2G4C A;  1NJ2 A;  2DDZ A;  3M4P A;  4HVC A;  2DXU A;  4XU3 A;  3RL6 A;  4YRT A;  3UGT A;  4CH4 A;  1E24 A;  3RF1 A;  4TVY A;  1EIY A;  1X2H A;  4TWA A;  4TQD A;  1H4V B;  4P72 A;  1HC7 A;  2YI9 A;  3L2Z A;  4HA8 A;  1X54 A;  2HEP A;  3REX A;  5E3I A;  3A5Y A;  2ZT6 A;  2ARS A;  4G85 A;  1G51 A;  1B70 B;  4XU1 A;  4HWR A;  3HFZ A;  2CJB A;  3IG2 A;  2XTI A;  4P72 C;  1BBW A;  4YCU A;  5F5W A;  3KFU A;  3RKX A;  3HY0 A;  4CS2 A;  1YGB A;  4YRK A;  4H2X A;  3RIR A;  3A32 A;  3HRI A;  4TVA B;  4YRO A;  2P5I A;  4YRG A;  2QHV A;  3DSQ A;  4DQ2 A;  4RQF A;  2P0L A;  3L1A A;  4BW9 A;  2AMC B;  3BFM A;  4P74 A;  3IAL A;  4XTZ A;  2RHS A;  3W3S A;  2EL9 A;  3RGL A;  3G1Z A;  2E3C A;  1G5I A;  2DZC A;  1E22 A;  4HWO A;  3TEG A;  3NEN A;  2I4M A;  3A31 A;  3HRK A;  3L4G B;  3RKY A;  4WF2 A;  3RUX A;  2ODR D;  3VQX A;  1NJ5 A;  2CJA A;  3REU A;  4AH6 A;  4K87 A;  3A5Z A;  1KMM A;  4XEO A;  3PZC A;  2JVD A;  4TQF A;  5ELN A;  4Q15 A;  1ADJ A;  1SET A;  3PCO A;  5K1P A;  3UGQ A;  2IY5 A;  2ZIO A;  2ZGW A;  4YRM A;  1LYL A;  4EO4 A;  3A7R A;  3EFR A;  2DXT A;  2RHQ A;  4H2U A;  1NNH A;  4CH5 A;  2ZXF A;  1EOV A;  4XEM A;  1GGM A;  4NCX A;  3VQV A;  1NJ6 A;  3QTC A;  12AS A;  4CS3 A;  1H4S A;  1VQZ A;  1NJ1 A;  3HFV A;  1O9H A;  2EJF A;  4ZIB A;  4P3N A;  3HXY A;  3V8L A;  2ZNJ A;  4UP8 A;  1ASY A;  3E9I A;  4XTX A;  1EIY B;  3ZED A;  2E64 A;  4WJ4 A;  2ZIN A;  4YRE A;  3UH0 A;  1EFW A;  2J3M A;  1YB3 A;  3TEH A;  2QJ1 A;  4YDQ A;  4YCV A;  1ASZ A;  2I4N A;  1X55 A;  2ZIM A;  3A7A A;  1QF6 A;  2DVE A;  2EWN A;  2Q5H A;  3V7S A;  4K88 A;  2AMC A;  2E5A A;  3M4Q A;  2RHS B;  2R72 A;  4YRC A;  2I4L A;  4KR3 A;  3QO5 A;  2ARU A;  1WU7 A;  2Q5I A;  2ZTG A;  3EFS A;  2EJG A;  2ZT7 A;  4YP0 A;  4P71 C;  3PCO B;  1W66 A;  4TVA A;  3ERR A;  1G5H A;  4LNS A;  3V7R A;  1WQW A;  3HXU A;  1X56 A;  1EVK A;  1Z7M A;  4YYE A;  4Q6G A;  1J5W A;  4H02 A;  1HTT A;  3LSS A;  3LSQ A;  2YIA A;  1X2G A;  4HWT A;  2FYK A;  2E41 A;  3L4G A;  1B7Y B;  3QO8 A;  4P73 C;  4PHC A;  5C51 B;  2HNI A;  1PYS B;  4YRF A;  4EX5 A;  1EVL A;  1B76 A;  2E1H A;  3OD1 A;  11AS A;  4XU0 A;  1Z7N A;  4H2T A;  2Q7G A;  4RDX A;  3FJP A;  4HWP A;  1E1T A;  4XTW A;  3V8K A;  5ELO A;  3IKL A;  1NJ8 A;  2IY5 B;  4J15 A;  1X01 A;  2YIB A;  2CGH A;  1YFR A;  2ZZF A;  2C8M A;  1BIA A;  3E9H A;  4XU2 A;  2AKW B;  3I7F A;  1YFT A;  4YRP A;  3V8J A;  3IKM B;  4P75 A;  4OP0 A;  1NYR A;  4TVW A;  4P3P A;  5HGQ A;  3TUP A;  4P75 C;  2DTH A;  2XGT A;  3LC0 A;  1SES A;  4TTV A;  2RHQ B;  3VBB A;  1WYD A;  3MF1 A;  4L87 A;  3P8V A;  2PME A;  2RQ6 A;  2R70 A;  4CS4 A;  2DU5 A;  3BJU A;  4YCW A;  2YIB D;  3HXW A;  4PG3 A;  2QHS A;  1BBU A;  5K1X A;  3HXX A;  3MF2 A;  3R07 A;  4YRL A;  1QE0 A;  1B7Y A;  3HTZ A;  4HWS A;  4YRJ A;  4XTV A;  3TEH B;  2I4O A;  3VQW A;  3QNE A;  1WPY A;  4XTU A;  2ALY A;  4P74 C;  1NYQ A;  2CIM A;  4DPG A;  1ADY A;  3MEY A;  5KNN A;  2PMF A;  1H4T A;  4BWA A;  2ZZG A;  3CMQ A;  2DTO A;  1WLE A;  2DQ0 A;  1BIB A;  2RJZ A;  2C7I A;  3P8T A;  4P71 A;  3V7C A;  2ZT5 A;  3HXZ A;  1KMN A;  1B8A A;  4P73 A;  4WJ3 M;  4E51 A;  4P3O A;  1WQ7 A;  2Q7E A;  4H2W A;  1JJC A;  1SRY A;  1PYS A;  2DQ3 A;  2EJ9 A;  1YFS A;  3HY1 A;  4KQE A;  2PUS A;  5C53 B;  1USY A;  3NET A;  4H2X B;  4RMF A;  4YRR A;  3RAC A;  2QHT A;  3RKW A;  1H4Q A;  3BHP A;  2DEQ A;  3WQZ A;  2E65 A;  1FYF A;  4H2S A;  2DTI A;  2YI8 A;  4O2D A;  1SER A;  2J3L A;  4UP9 A;  2PGG A; 
#chains in the Genus database with same CATH topology
 3SYQ A;  2WPD G;  4LF9 O;  2UXX A;  3P32 A;  3C3S A;  1BCC H;  3LSU A;  3CC4 V;  1FPO A;  3AEI A;  1KOG A;  1JFF B;  4YRS A;  4LR3 A;  4PA4 A;  4TV8 A;  1YCI A;  4WFG A;  4KR2 A;  5JH7 B;  4YRQ A;  1G6U A;  3K03 A;  4GT1 A;  2DMX A;  1YHQ V;  1GN6 A;  3CXH F;  2UXD B;  1Z5V A;  1GM7 A;  4MTG A;  4UPA A;  1MA1 A;  2A06 H;  1NH2 D;  1QNM A;  1XI1 A;  3LDD A;  5ITZ A;  4JI8 O;  1I5Y A;  4FK5 C;  4NR1 A;  1RP3 B;  1IBK B;  3N2K B;  2ILM A;  3P8Y A;  2Q7H A;  2YSU B;  1XMQ O;  3SR2 C;  2CE4 A;  3UFG A;  2CH7 A;  1QVF U;  4O2B B;  1V55 B;  3NEL A;  2DU7 A;  4J41 A;  3N2G A;  2QHU A;  4RQE A;  4WI1 A;  3A7U A;  5CA0 A;  3A74 A;  2ODM A;  2BSK A;  4DR5 B;  1XL4 A;  2ZKO A;  1E1O A;  2E76 B;  4YHH B;  3ZX6 A;  4UP7 A;  1KP3 A;  1JJC B;  4TUY A;  4YIO A;  2ODR C;  4ZTU B;  1XNQ O;  4X5O A;  3VQY A;  1XBL A;  4HNA B;  1NJ2 A;  3OUS A;  1G4Y B;  2EIK B;  2X0L A;  4MTO A;  3M4P A;  4X66 B;  5LMN B;  2LP7 A;  2VQF B;  3IGA C;  1N36 B;  4PI2 A;  4TVY A;  4KFM A;  4CBC A;  4LF5 B;  3CEI A;  4DRX B;  5CBG A;  1YTF B;  4UB8 Z;  1Y76 B;  3JAL B;  5KMG A;  4O4J A;  1KKC A;  4P72 A;  1HC7 A;  3L2Z A;  4HA8 A;  3L72 H;  1X54 A;  3REX A;  3A0R A;  1BZK A;  2FL4 A;  1AJQ A;  4KP4 A;  1G51 A;  1B70 B;  3JD2 A;  4JAU A;  3X2Q B;  4P9O A;  2WSS G;  1S3J A;  1XHZ A;  3JCU Z;  4DV6 O;  2Q68 A;  4JGS A;  1MG1 A;  4X64 O;  1NI8 A;  1NT2 B;  4YY3 O;  5DN6 G;  2BTQ A;  2R9A A;  5JVD A;  4P30 A;  2ZXW B;  5LXT B;  2ADQ B;  2JIZ G;  4NXN O;  1TAE A;  1RSO A;  3AG2 B;  4R50 A;  3CPW U;  2QHV A;  2LW1 A;  5GTH Z;  1SQQ H;  2EJR A;  4RQF A;  4DV4 O;  2P0L A;  2AMC B;  2XOK G;  1IXM A;  3IAL A;  5JH7 A;  3G1Z A;  5CBF A;  4DV0 O;  1VQK V;  3W7T A;  2DZC A;  3P3N A;  4HWO A;  4EFE A;  1K5S A;  1QHT A;  2GDS A;  5EBW C;  5LYJ A;  2I4M A;  4MW8 A;  5EIB D;  3HRK A;  3RKY A;  2KB1 A;  3K04 A;  2ODR D;  1NJ5 A;  4AH6 A;  2ITC C;  3M8A A;  1KMM A;  1AP5 A;  4XEO A;  1TVK B;  1R1B A;  3OMI B;  1OCR B;  4F6R A;  1Z2G A;  2EIM B;  3M7M X;  4TQF A;  1HNX O;  1N34 B;  1XRE A;  2JGD B;  1SET A;  3UGQ A;  3N2G B;  3RFR A;  1VIB A;  1YDX A;  2ZGW A;  2E75 B;  2GHY A;  1LR1 A;  3WFV A;  4EO4 A;  3ETQ A;  3N2K A;  2RHQ A;  3CC7 V;  4HT4 A;  4XEM A;  4NCX A;  4DR5 O;  5H5N A;  3ZRW B;  1FJG O;  1GRJ A;  5H2F Z;  2A8E A;  4MVU A;  2BSK B;  1VF5 B;  4J9Y B;  2OIE A;  1KEC A;  2EIK C;  2ZNJ A;  4UVB A;  4B3M B;  3UQ8 A;  2H94 A;  1NQT A;  1IVS A;  3W7U A;  4X88 A;  1Y76 A;  2VQF O;  3RYH B;  2E64 A;  1F7Y A;  1FS0 G;  2ZDI C;  3UH0 A;  3IFX A;  2VWJ A;  1W0K G;  1YB3 A;  3TEH A;  3ZS8 C;  2OTJ V;  4LH6 A;  5JCO C;  3BEH A;  2NR5 A;  5LHH A;  1H2L A;  2GV9 A;  1AJN A;  3HKE B;  2E5A A;  4DR7 B;  3SYO A;  1AI7 A;  1SC5 B;  4YRC A;  2I4L A;  4KR3 A;  3AG4 B;  4TV9 B;  5KUK A;  4DR2 B;  1F23 A;  5KUM A;  2UU9 O;  1NZ6 A;  3DXR B;  1L0L H;  4UUJ C;  3K59 A;  1PM9 A;  4CZZ A;  2EZO A;  1BQ0 A;  3PCO B;  1EBO A;  3ABL B;  1W66 A;  1G1X B;  1Q8I A;  3J80 N;  1GO3 F;  2YC0 A;  4LNS A;  1FFX B;  3L75 H;  3E22 B;  3K0G A;  5C8Y A;  5B3S C;  1EVK A;  4LF7 B;  3L71 H;  1FXV A;  2CTR A;  3K5N A;  1XQ8 A;  1JJO A;  5FL7 G;  5LXT A;  3JD1 A;  3OTO B;  1HTT A;  3U11 A;  1RFY A;  2JJ2 G;  3AG1 C;  2HKO A;  2IJI A;  4DV0 B;  3QO8 A;  1Y6X A;  2F43 G;  3P30 A;  2HNI A;  1MMM A;  3CRQ A;  4YRF A;  1P84 F;  4EX5 A;  1TVK A;  3JAR A;  5KLV H;  1EVL A;  1M56 C;  4RO2 A;  3OD1 A;  3H1L H;  3F7Y C;  4KHP B;  4XU0 A;  3CRA A;  2OYQ A;  4RDX A;  1ZX3 A;  1R6K A;  3D3Q A;  1BMF G;  1M57 B;  4F6E A;  4J7K A;  4JV5 O;  4K8Z A;  2YIB A;  2W0F C;  3K5O A;  4PJ0 Z;  1YFR A;  3ZCC A;  1WP7 A;  1HWY A;  4W4L A;  4F6R B;  5LP6 C;  1OHH G;  4FPP A;  3ML0 A;  3WB2 A;  2JGD A;  5IT9 N;  1NS1 A;  4OP0 A;  4L8J A;  4EB6 B;  4ZHQ A;  4K0K B;  4JYC A;  2YDE A;  4H0L B;  4P75 C;  2O57 A;  2UUB B;  4TTV A;  1YIT V;  2RHQ B;  5EC2 C;  4PHZ A;  3JD3 A;  3GWK C;  4WCE V;  2EIL B;  1PKX A;  4L87 A;  1DLB A;  3D8C A;  3ZRW A;  1HNZ B;  2A9H A;  2PME A;  3I56 V;  4NVP A;  4CS4 A;  5EYP A;  2DU5 A;  1VF6 C;  2W6I G;  3R66 A;  3BJU A;  3N27 A;  4JTC B;  1KU9 A;  3TJT A;  3HXW A;  4PG3 A;  2RMK B;  1B7Y A;  3S3X A;  4HWS A;  1L1F A;  4UXN A;  2QM8 A;  3JSL A;  3MQZ A;  1FXH A;  1JVM A;  3RW0 A;  3TEH B;  3G67 A;  2N05 A;  2W6J G;  3CME V;  4ZI7 B;  2N04 A;  3DXR A;  3BFR A;  5HFM A;  3OM3 B;  1OJH A;  1GK9 A;  4D6T H;  4DR2 O;  3IC9 A;  3UO3 A;  3BAA A;  4DUY O;  4KXR A;  4LFC O;  4JZ2 A;  1ADY A;  2CIM A;  3MEY A;  2PMF A;  3SPH A;  5H6Q A;  3SJA C;  2NNU A;  1A32 A;  4TV9 A;  4DR3 O;  4NTW A;  4JI6 O;  1WLE A;  1J5E O;  1Q81 W;  4PA6 A;  4B08 A;  5KHG A;  1JJ2 U;  1B8A A;  1S76 D;  1FFX A;  4E51 A;  5E1A C;  4I7Z B;  2DYS B;  2OTL V;  3WB1 A;  1BHB A;  4IHJ A;  2DQ3 A;  5IY5 C;  1WPX A;  2EJ9 A;  4KQE A;  4FLX A;  4UCU A;  4GKJ B;  2P90 A;  3NET A;  4E2L A;  3LDC A;  3Q4H B;  3E2E A;  2DEQ A;  3J7A U;  4KHP O;  2Q67 A;  2A7W A;  2BCC H;  2VQE B;  1N33 B;  2UXD O;  2UXB B;  2XT9 A;  4QJF B;  4O4L A;  4X1K B;  5FNV A;  2HG5 C;  5CBH A;  4NTX A;  1BT8 A;  1P4R A;  4UP9 A;  5IYD O;  2JS5 A;  4DV2 B;  1K8A W;  1WNL A;  2UXC B;  2QWN B;  1QCE A;  3T4D A;  2E10 A;  3T1H B;  1TA8 A;  3CJH A;  4FZ0 A;  3E86 A;  3UM7 A;  3RVY A;  2WLM A;  1E1Q G;  4LNU A;  2JRI A;  3RBZ A;  4JTA B;  2L35 A;  1GAX A;  4YHH O;  1OCR C;  3TET A;  3KCY A;  2CJ9 A;  3HFZ B;  1XNQ B;  5EYP B;  3FB7 C;  4KL1 A;  4LCU C;  4J80 A;  4ABM A;  4YRI A;  3D36 C;  1D5A A;  1RM1 C;  3CCM V;  1NR1 A;  4CH6 A;  1V54 C;  1YSC A;  4FFK A;  3QVN A;  2OCC C;  3F5W C;  3OR7 C;  2PTM A;  2ZNI A;  3ASN C;  2DZ9 A;  2WLJ A;  1AR4 A;  2V4D A;  4G2K A;  3ZJZ A;  1SQV H;  2DJZ A;  3WU2 Z;  2X6B A;  1WJZ A;  4PA3 A;  3B2E E;  4OLF A;  1B06 A;  1L0N H;  1ZL8 A;  5KX5 A;  4FLU A;  2EX3 A;  3A0H Z;  4HVC A;  4XU3 A;  4LF4 O;  3BCC H;  3TXS A;  2BOC C;  5EK0 A;  5FPO A;  1QVG U;  1NH2 B;  1Q82 W;  4BIU A;  2WA3 A;  3W7X A;  1PPJ H;  2ZM6 O;  5F2V O;  2CAZ C;  1IBL B;  3OEH G;  2HEP A;  4LVL A;  5B1O A;  4PI0 A;  3DC5 A;  1N32 B;  1OCC C;  1Y67 A;  4TV8 B;  3OMA B;  2JEX A;  2XTI A;  1K73 W;  2EIM C;  4BW5 A;  1Z5W A;  5AG2 A;  4RUF A;  3CC2 V;  5LA6 A;  1TGO A;  1V55 C;  5KA5 A;  2ZQM A;  3RKX A;  2EUL A;  4LC1 A;  3QG5 A;  2HHH O;  2JEU A;  4JI0 O;  4WFB V;  3RIR A;  5ITZ B;  4F4L A;  3CYO A;  3ABK B;  4TVA B;  2WLN A;  4P2Z A;  3DSQ A;  3CCQ V;  5DM6 V;  3CJH B;  2X7R B;  4BW9 A;  4CC6 A;  4O4L B;  4X1K A;  5FNV B;  4UCO A;  2QTO A;  4XTZ A;  1Y74 B;  2CTP A;  4JYY A;  3ZRS A;  5KHI A;  4LVJ A;  3HKD A;  1G5I A;  2LQT A;  4X20 A;  1QLE C;  1XMO B;  3AK3 A;  2A0L A;  3NR7 A;  4X62 O;  2CJA A;  3I55 V;  1EZV H;  2NS6 A;  3RVZ A;  3A5Z A;  2YIC A;  2JVD A;  4I4T A;  1R6T A;  3AK2 A;  2DYR C;  3FD9 A;  1OZ0 A;  3PJS K;  2P4V A;  2QR4 A;  1TUE B;  5IYZ A;  4Q15 A;  1ADJ A;  5K1P A;  1K3E A;  2IY5 A;  2ZIO A;  2UUA O;  1H2N A;  3FB5 C;  2E5L O;  4W4K A;  5LMU B;  4X8A A;  4DRX A;  4A5U B;  4DV1 O;  4AQY O;  3C3T A;  3MHS C;  4AI8 A;  5LP6 B;  4I50 A;  1U96 A;  3K3W A;  1GGM A;  4UCS A;  4H33 A;  1VMG A;  1H8E G;  3E35 A;  1QU7 A;  1K5Q A;  1KQS U;  1R3I C;  3B8N A;  1H4S A;  3SYP A;  1EFR G;  3D3I A;  3HFV A;  2Y0P A;  4J10 A;  2EJF A;  4OPH A;  2DYS C;  2XTA A;  3BRC A;  1DK1 A;  3RYF A;  4X9Q A;  5C93 A;  2ITD C;  5A9G A;  3WB0 A;  4ZOL B;  1DF4 A;  4MT8 A;  3ZMU A;  2M7W A;  4X1I B;  3ABT A;  4QNH B;  2ZIN A;  2BTQ B;  1HR0 O;  1EFW A;  1TUB A;  4IL6 Z;  1NBM G;  5JJE B;  5LBQ A;  1LUV A;  1RSO B;  3H9V A;  5B1B B;  1ZTE A;  2IJK A;  3RN4 A;  5EBL C;  2F95 B;  2ZIM A;  3M99 B;  1J95 A;  2AHZ A;  4LF7 O;  4MVO A;  3B40 A;  2AMC A;  3M4Q A;  5FLX N;  3OT7 A;  1ARO P;  3WG7 B;  1AB3 A;  3UT5 A;  4Z2W A;  1GN3 A;  4XDL A;  3QO5 A;  3CCL V;  1I0H A;  1EN5 A;  2QM4 A;  2F4V B;  1KB9 F;  4YP0 A;  3H1J H;  2WLL A;  4TVA A;  2IW5 A;  1RPO A;  2IJJ A;  3ERR A;  1HDJ A;  5LL6 Y;  3FYE B;  4GX5 A;  5BZB A;  3QF7 A;  2L6L A;  2RDC A;  1WA8 B;  5B3S B;  1QLE B;  4DV7 B;  2WA4 A;  3HB3 B;  4JI8 B;  5B1A C;  4DXW A;  1ZSP A;  3ABU A;  4X20 B;  2GSM B;  5J2T B;  1Q5O A;  5TIS Z;  1H2G A;  4HWT A;  1ENV A;  1ROP A;  4U7O A;  2K9P A;  1PNK A;  3T4Z A;  2Q0O C;  3CD6 V;  3HKD B;  2BTO A;  1N0J A;  4I55 A;  4MSW C;  3JAW A;  4LFA B;  4X62 B;  3FJP A;  4XTW A;  5ELO A;  5EBM C;  4DYL A;  1NJ8 A;  2OWO A;  2QWQ B;  5B1B C;  2IY5 B;  4NB5 A;  4PDL A;  4DR1 O;  1D5N A;  5J2U B;  2AZ0 A;  1FYJ A;  1BIA A;  1Y4M A;  1OCO B;  3RGB A;  2PF4 E;  5LMN O;  4JI1 B;  3O65 A;  1VEW A;  4I5S A;  2QE7 G;  5IYZ B;  4MTX A;  4IIJ B;  2VRZ A;  1MAB G;  1Y66 A;  2OCH A;  2H3O A;  4YRP A;  3V8J A;  1M5I A;  3ZN1 A;  4YJ3 B;  4BIZ A;  4TVW A;  5LGN A;  4FLW A;  2XGT A;  5LP6 A;  4LF6 B;  4I50 B;  1FD9 A;  1KMI Z;  1SKV A;  2G38 A;  3D36 A;  4QE7 A;  4MVR A;  3CS5 A;  3P8V A;  1R3K C;  1FAF A;  4X1Y A;  2RQ6 A;  3UO2 A;  3L9D A;  1GMG A;  2R70 A;  4D7T A;  4AIL C;  4DV6 B;  3EFF K;  3MD0 A;  1R3J C;  4U3F H;  4YCW A;  4J7Z A;  3E22 A;  2YIB D;  4JI6 B;  2YUA A;  3MF2 A;  1WP8 A;  3HTZ A;  4U3J B;  3W7S A;  1P7G A;  1FXK B;  1VQL V;  3SJC C;  2YS8 A;  2Q0A A;  2OCC B;  4YRJ A;  5GON B;  3TGU H;  1XNR B;  1K7D A;  2P22 C;  3ABK C;  3KCX A;  1B04 A;  3OGC C;  3QNE A;  3OGI B;  4DUZ B;  4UCR A;  2ALY A;  1ZWI C;  4LVI A;  2WLL B;  4NXM B;  2QKC A;  4LFB O;  1F51 A;  1ORQ C;  1GM8 A;  4BWA A;  4GKJ O;  2AXT Z;  2QGN A;  1PNL A;  3KZI Z;  5CA1 A;  2Z3Y A;  3CMQ A;  2DTO A;  1BIB A;  3F7V C;  1X4T A;  3B8M A;  5KAF Z;  4FZ1 A;  2YEV B;  2DWD C;  2QEX V;  3FKS G;  2UXB O;  3V7C A;  1AI4 A;  4DV7 O;  3HXZ A;  3SDL A;  3L74 H;  2W0X A;  5IYB O;  4MTF A;  2Q7E A;  3SYC A;  4H2W A;  3W7W A;  5KA6 A;  1SRY A;  3VOU A;  4FIP C;  1YFS A;  1U97 A;  2PUS A;  5C53 B;  4MW3 A;  1IBK O;  3E83 A;  5LOV B;  3RYI B;  2QSA A;  4I55 B;  4FLY A;  3JAW B;  1USY A;  1CPY A;  5CA0 B;  4RMF A;  1M4U A;  3RAC A;  2IH1 C;  4DO2 A;  3RKW A;  2Z5U A;  1H4Q A;  2DJV A;  4MVS A;  2E65 A;  2ZD9 A;  1M1K W;  4O2D A;  2J3L A;  3FAV A;  1WAZ A;  3JD4 A;  5LGU A;  2AZ2 A;  1GN4 A;  2XHB A;  4G84 A;  1JA8 A;  1EM1 A;  2IM9 A;  4B3T B;  4JI1 O;  2ETN A;  1XOU A;  3CRM A;  5KMG B;  4X65 B;  4ZTZ B;  1N36 O;  2WLI A;  1SQF A;  1RIQ A;  2ATK C;  4B3S B;  1SS3 A;  4LWS B;  1SQB H;  4YJ2 A;  4LF6 O;  3K57 A;  2ZR2 A;  3CCE V;  1B70 A;  2ZT8 A;  4DW1 A;  2EAY A;  1ATI A;  2VWK A;  3NEM A;  4JI7 O;  4XTY A;  5IWA B;  2WLH A;  2YID A;  2DOS A;  5IYC O;  3B09 A;  1XUQ A;  3TXQ A;  3JAT B;  4DK0 A;  4H2V A;  2XAG A;  3AG2 C;  3HPL C;  1P7B A;  1Q90 D;  1L0W A;  4DR4 B;  4JAS A;  1FXK A;  5JVD B;  5IJ0 B;  3A0B Z;  3HXV A;  4K86 A;  2LFR A;  1Q6H A;  1UPG A;  3ZHT A;  4JI3 O;  4GKK O;  1O9G A;  4JYA B;  1KYO F;  3CMA V;  2ART A;  1C0A A;  1IL2 A;  1HXD A;  2EIJ B;  1BS3 A;  3HR0 A;  4YPF A;  3SGI A;  4E4E A;  4BR6 A;  2G4C A;  5GON A;  4XBF A;  4DV4 B;  1BGY H;  4FFB B;  1F4M A;  4DR6 O;  4BAY A;  4YRT A;  3ASO C;  3Q4H A;  3UGT A;  3C90 A;  3DTU B;  1URF A;  1E24 A;  3H1K H;  5L3B A;  1NVP B;  3H01 A;  5BXZ A;  2KSD A;  1H4V B;  1GKF A;  4UV9 A;  2IH3 C;  1HNW B;  2HVK C;  1VQM V;  1IBM B;  2JK5 C;  4N21 A;  3CCV V;  4J11 A;  1CEZ A;  3CRR A;  5D5Q A;  5E3I A;  1IZ3 A;  2YEV A;  2ZT6 A;  3HKB A;  3FX7 A;  3RYI A;  4D7S A;  3CHX A;  2ARS A;  4G85 A;  5EIB C;  4XU1 A;  3FYI B;  1XL6 A;  4HWR A;  2ADP A;  3E8H A;  2EZP A;  1M9N A;  1N34 O;  2ZE5 A;  4YCU A;  1H2S B;  4LNU B;  3B77 A;  1YJW V;  2FB5 A;  4Z1M G;  3KKY A;  5B1A B;  3R65 A;  1OCZ B;  1K97 A;  3K5M A;  3FAV B;  3JAS A;  1DF5 A;  2QKS A;  3HY0 A;  4CS2 A;  1YVW A;  2Y69 B;  4O2B A;  3A32 A;  3HRI A;  5JWP A;  2P5I A;  4YRG A;  3LDE A;  2DYR B;  2XUM A;  3BFM A;  1RPR A;  5L3F A;  4P74 A;  3AG1 B;  4TUY B;  1B6Q A;  1VQ9 V;  2RHS A;  2C2A A;  2UUA B;  4R7C A;  1I7F A;  1KD1 W;  2E3C A;  3U10 A;  3HKC A;  5EC1 C;  4RUE A;  4YJ2 B;  4LF5 O;  2F66 C;  4OXS A;  3NEN A;  3ZHR A;  3L4G B;  2MK3 A;  4WF2 A;  3STL C;  4B3S O;  1MSD A;  3RUX A;  5E79 Z;  4NYK A;  3VQX A;  3JAT A;  3REU A;  5CA3 A;  4K87 A;  3JAL A;  3PZC A;  4G27 B;  4JI7 B;  4UV8 A;  1KP2 A;  4DR7 O;  2JS3 A;  2QM7 A;  4IYI A;  5ELN A;  4DUY B;  4PEL A;  1VF7 A;  4R6Z A;  1VQ8 V;  2UXN A;  2B5U A;  3PCO A;  1HP8 A;  2X6A A;  1AP6 A;  2CTQ A;  4X64 B;  1WN7 A;  4YRM A;  3A7R A;  4GX1 A;  5B1N A;  2DXT A;  4H2U A;  3T1Y O;  1BSM A;  3BPZ A;  4CH5 A;  1EOV A;  4JI3 B;  4GKK B;  3BA9 A;  3VQV A;  4JYA O;  1NJ6 A;  12AS A;  3CCR V;  1OCC B;  1NJ1 A;  1VQZ A;  2Y4T A;  3L70 H;  2GUZ B;  3K08 A;  1O9H A;  4LP8 A;  1I08 A;  5KHK A;  3HXY A;  4P3N A;  3V8L A;  1LUW A;  1ASY A;  3E9I A;  1SF9 A;  1YJN V;  2CDY A;  2P5O A;  2LO1 A;  3ZED A;  2PZS A;  4DR6 B;  2JGU A;  4J9Z B;  3JAR B;  4WJ4 A;  2IU0 A;  5KAI Z;  4YRE A;  3EHB B;  2CUG A;  4YDQ A;  1SA0 B;  1ASZ A;  1MSW D;  3RYC A;  1X55 A;  2Q73 A;  2KQX A;  1T5E A;  4H37 A;  1HNW O;  1JR9 A;  3IC7 A;  4PA7 A;  3A7A A;  2MW2 B;  4K35 A;  2DVE A;  2EWN A;  1QF6 A;  2D2C B;  5CMU A;  1K34 A;  1LNQ A;  3G71 V;  1Q3E A;  2UXC O;  1AR5 A;  1BHA A;  1Y74 A;  4JV5 B;  4UFZ A;  1R6N A;  2B9Z A;  3FFQ A;  4O4H B;  2ARU A;  2Q5I A;  4FM2 A;  3JAS B;  3TK1 A;  1WB7 A;  3CSX A;  4EB6 A;  4ZHQ B;  5B5E Z;  4QPK A;  1AR1 B;  3JAK B;  5L3E A;  5KHH A;  3J81 N;  4JI2 O;  3V7R A;  4LFA O;  1S5L Z;  1V54 B;  3OEE G;  5JJN B;  4K0K O;  3HXU A;  5EZY B;  1FJG B;  3ZN0 A;  1Z7M A;  3CRC A;  4Q6G A;  1SQG A;  1VP7 A;  3GVM A;  3JD0 A;  3T2M A;  4WFH A;  3ABL C;  1PL4 A;  3HKC B;  1EN6 A;  2AHY A;  3LSS A;  3LSQ A;  2P7T C;  4PV1 B;  2YXL A;  2YIA A;  5JJJ B;  3JSN A;  2HP8 A;  4OX9 B;  1X2G A;  4XDK A;  2FYK A;  4WFA V;  1VQN V;  2E41 A;  3L4G A;  3OAA G;  4X66 O;  1B7Y B;  2NLJ C;  3ICX A;  4PHC A;  3ZHV A;  1PYS B;  3L73 H;  3RYH A;  1B76 A;  2Q5Z A;  4FLV A;  2HR3 A;  5H6R A;  1Z7N A;  3G80 A;  1KUQ A;  5L3C A;  3MHH C;  5LGT A;  3V8K A;  1E1T A;  1MOF A;  1EN4 A;  3IKL A;  3OMN B;  1VF6 A;  3DC6 A;  1H8H G;  4IYH A;  4TT3 G;  3O9O A;  4WF9 V;  2C8M A;  5FPR A;  3ZHS A;  3ASO B;  3X2Q C;  3E9H A;  4XU2 A;  1KC8 W;  2AKW B;  2DWE C;  2V7Q G;  3B4S A;  3I7F A;  1YFT A;  4JPR A;  1TUB B;  2WWW A;  1K9M W;  1YJ9 V;  3SPG A;  2HJF C;  4PDR A;  3IKM B;  3LNM B;  4P75 A;  1OCO C;  1ZAU A;  2QWO B;  4YY3 B;  3T1Y B;  2ZM6 B;  2A79 B;  1NYR A;  2JDI G;  4P3P A;  5HGQ A;  2D3O W;  2DTH A;  4DK1 A;  1PV0 A;  4X89 A;  1SES A;  4LVK A;  3UT5 B;  3SYA A;  3OTO O;  1JPX A;  1JCH A;  3MF1 A;  2XAQ A;  4JI4 O;  3E8G A;  1US6 A;  3TCU A;  1I5X A;  2GUZ A;  4XDJ A;  1SA0 A;  4J7J A;  4R8C A;  1PL0 A;  3K58 A;  3THO A;  3ETG A;  4BIO A;  1BBU A;  3R07 A;  1WA8 A;  4YRL A;  4LVM A;  2QA4 V;  2Y4U A;  2N74 A;  3ASN B;  4DV3 O;  4MVQ A;  1NJI W;  1JMK C;  1AI5 A;  1I94 B;  3CXC U;  3VQW A;  2XAS A;  1WPY A;  1VAR A;  3K0D A;  4DV2 O;  3G4S V;  3A8T A;  3JAM N;  3OW2 U;  2LW7 A;  4P74 C;  3F5T A;  4IGG A;  5BR8 O;  1R3L C;  4DPG A;  5KNN A;  1AI6 A;  4G28 B;  2R9I A;  1H4T A;  2YXH A;  1JQ0 A;  3UKM A;  2ZZG A;  4PDM A;  2UUC B;  2DQ0 A;  2VS0 A;  3MDS A;  4JI2 B;  2C7I A;  2CGN A;  1FKA O;  4P71 A;  2XAJ A;  4N23 A;  2ZE6 A;  2PYL A;  1SQP H;  3JAK A;  2ZT5 A;  2HVJ C;  4YXW G;  4WJ3 M;  2ZDI A;  3I5D A;  2M6Y A;  1BL8 A;  5J2U A;  1WPB A;  1JJC A;  1PP9 H;  1XHX A;  1NR7 A;  1PYS A;  1KKD A;  4B3M O;  4OX9 O;  3SJQ C;  4JI5 O;  3LUT B;  5JQG B;  2ZT9 B;  2B1G A;  4TOI A;  4H2X B;  4LF8 B;  2JJ1 G;  4PA9 A;  3BHP A;  3CCU V;  4K3A A;  3WQZ A;  4H2S A;  1FYF A;  1K33 A;  4O4I B;  2DTI A;  1X59 A;  4B3R B;  3ZHU A;  1XDC A;  3APO A;  4J42 A;  1MZE A;  2YI8 A;  1SER A;  1ZL8 B;  5KX5 B;  1W2B U;  2PY5 A;  2H8P C;  1BQZ A;  4DV5 O;  4EEQ A;  5L3G A;  4I0X A;  4X1Y B;  1EQR A;  4ZI7 A;  4CC5 A;  1VQ4 V;  1NTZ H;  3G6B A;  3STZ C;  4DR4 O;  4DR3 B;  1KBH A;  4Z1V A;  3APQ A;  4YRN A;  1W0J G;  3EXA A;  3QO7 A;  2AKW A;  2QKA A;  1N9W A;  1J5E B;  4YIP A;  2FYU H;  3UCS C;  1GN2 A;  4QE9 A;  3S3W A;  2EBO A;  4JZG A;  2ARH A;  3P3P A;  2Q69 A;  4GUN A;  4NKG B;  5BMV A;  1USY C;  1IBL O;  2ALY B;  1IX9 A;  2DKG A;  1UJW B;  1S77 D;  2ZE7 A;  3CWB H;  2ZZE A;  3EVK A;  4JF3 A;  1VQ5 V;  1XIL A;  1PNM A;  5C52 B;  2P6J A;  3WG7 C;  1S72 V;  4HAM A;  2Y69 C;  4GCZ A;  1R73 A;  3T1C A;  5DEC A;  3ZMT A;  3ZMZ A;  4H2Y A;  4I9Q A;  4TSF G;  3E89 A;  2HJD A;  2RNB A;  4DV3 B;  2R9R B;  2VQE O;  1N33 O;  2XAH A;  1Q43 A;  1D2D A;  4B7K A;  2EIN B;  5LYJ B;  2ZCE A;  1IBM O;  2ZR3 A;  4JAV A;  1K4C C;  4MS2 A;  4CH3 A;  3U0Z A;  1N0N A;  2LJ2 A;  3ICA A;  2DDZ A;  5LOV A;  1Q6U A;  2DXU A;  2FTK A;  1F4N A;  3RL6 A;  2V1D A;  4CH4 A;  1YXB A;  1B3Q A;  1XMQ B;  2KKW A;  4JTD B;  4UCT A;  3RF1 A;  2WAM A;  4UB6 Z;  1EIY A;  4WFF A;  1X2H A;  4TWA A;  4TQD A;  3G6E V;  4I4T B;  1YZB A;  2YI9 A;  2BOB C;  2Q6A A;  2UUB O;  3AG3 B;  2YXY A;  3A5Y A;  5JQG A;  3DGE A;  4QIW F;  3K5L A;  2P4K A;  3HFZ A;  1L8D A;  3LNN A;  1GM9 A;  2CJB A;  4JI5 B;  3IG2 A;  2EJ7 A;  4P72 C;  2K1E A;  4WFE A;  1BBW A;  5F5W A;  2WLI B;  4LF8 O;  1M90 W;  3KFU A;  4DV1 B;  1JX9 A;  4LWS A;  4AQY B;  1Q6I A;  4I0X B;  2WLK A;  3MAQ A;  3ZRX A;  4B3R O;  1YGB A;  4YRK A;  4GLX A;  4H2X A;  5DED A;  4Q20 A;  4YRO A;  1SQX H;  3PN1 A;  2QWR B;  3RYF B;  2EIJ C;  3NXS A;  4O4I A;  4DQ2 A;  3ZMV A;  3HKE A;  2LFS A;  3L1A A;  1DGS A;  1NTM H;  4X1I A;  1CP9 A;  4FLZ A;  3CCS V;  3W3S A;  4LF4 B;  2EL9 A;  3RGL A;  4LFC B;  3ABM B;  5CB4 B;  2FKX A;  1E22 A;  3CX5 F;  4ZKI A;  3TEG A;  3A31 A;  3AK1 A;  1OV9 A;  2Y48 A;  1Q7Y W;  2X6C A;  4WBN A;  1VQ7 V;  3E8B A;  5IE9 A;  4HYO A;  3BVO A;  4IT5 A;  1MNG A;  4NXN B;  1N4C A;  1YF2 A;  5C8Y B;  4DUZ O;  2E74 B;  4FFB A;  4GZR B;  4HZ3 A;  1QR8 A;  1VQO V;  1AJP A;  5BMV B;  4LH7 A;  3ZBH A;  2Q8V A;  2IU3 A;  5GW7 A;  1N8R W;  2F4V O;  2ZE8 A;  1SZT A;  4ICG A;  4FMT A;  1LYL A;  1W59 A;  4JAA A;  3EFR A;  1AIL A;  1NNH A;  2ZXF A;  4JI0 B;  1FFT B;  2GTA A;  3QTC A;  5LA6 B;  2DW4 A;  4CS3 A;  1QLN A;  2KG7 A;  3HKB B;  2XAF A;  5BY1 A;  5J9P C;  4ZIB A;  2QWP B;  3RWR D;  2NN4 A;  1HNX B;  5IJ9 A;  4QPJ A;  3IJ4 A;  4PDV A;  4UP8 A;  1NKD A;  1GH6 A;  4XTX A;  1EIY B;  1HW7 A;  4EKW A;  4LBE C;  3T1H O;  4O2A A;  1ZLZ A;  2J3M A;  2QJ1 A;  4P9P A;  5IY5 B;  4YCV A;  2RN9 A;  2I4N A;  4PD4 F;  1YTF D;  3K9S A;  4UCV A;  1NU1 H;  2Q5H A;  5A2Q N;  3V7S A;  1SZX A;  2CTW A;  4K88 A;  4NTY A;  4K8X A;  2F1M A;  1RM1 B;  4FVM A;  2RHS B;  2R72 A;  4H13 B;  4B3T O;  1WU7 A;  5B66 Z;  3FB6 C;  2ZTG A;  3EFS A;  2EJG A;  1UFI A;  2ZT7 A;  2AGA A;  4P71 C;  3SPI A;  4X65 O;  1E79 G;  2FML A;  1G5H A;  4DW0 A;  1H38 A;  3SJB C;  1WQW A;  1X56 A;  2PYJ A;  3ZMS A;  4YYE A;  2F93 B;  4MVM A;  3IAY A;  1J5W A;  3GB7 C;  1QQC A;  2HLD G;  4H02 A;  3SPC A;  2Q4P A;  2Q9L A;  1EZJ A;  1NVP D;  5CB4 A;  3E8F A;  1IDS A;  2DE0 X;  2QTS A;  2UU9 B;  1JOY A;  1ZUQ A;  1HR0 B;  4FJC C;  4I9W A;  1M93 A;  2LGW A;  4P73 C;  1S0V A;  5C51 B;  4ZOL A;  2PI5 A;  1DTO A;  2QDO A;  4H44 B;  3CCJ V;  4RWU A;  5IDJ A;  2ZXW C;  2E1H A;  4ZBM A;  1K4D C;  4FLT A;  3AG7 A;  11AS A;  4GYC B;  1YEW A;  4H2T A;  2Q7G A;  5KHJ A;  3FB8 C;  4HWP A;  2GBO A;  3BY6 A;  1S5J A;  2CGO A;  4J15 A;  1G8M A;  4WBN B;  1JFF A;  1X01 A;  4LF9 B;  4JI4 B;  2CGH A;  2ZZF A;  1VQP V;  3ETD A;  1YI2 V;  1N32 O;  4UVA A;  5CA1 B;  3GWO A;  4NXM O;  4LFB B;  4C7U A;  4IHJ B;  3AG3 C;  3ETE A;  3RYC B;  1BE3 H;  3OE7 G;  4ASU G;  1XEQ A;  4TWK A;  1PD3 A;  2B1I A;  4GX0 A;  5LHG A;  3TUP A;  1MZF A;  4B7E A;  2HHH B;  3LC0 A;  1I94 O;  3BA8 A;  1M57 C;  2XND G;  3VBB A;  4GX2 A;  4O4H A;  5H9C A;  3SPJ A;  3ZIA G;  3JCZ A;  1WYD A;  4RAI A;  2IBZ H;  2KG7 B;  3CP1 A;  4O2A B;  4AHC A;  1E1R G;  5BR8 B;  4QGP A;  1K92 A;  5IJ9 B;  3K9A A;  3CB2 A;  5J2T A;  4U7N A;  3OTF A;  4OGQ B;  4OPA A;  1IUR A;  1YIJ V;  5K1X A;  2UUC O;  2OIG A;  2EIN C;  2QHS A;  3HXX A;  5EZY A;  1H2K A;  1QE0 A;  1FXK C;  3K79 A;  3H1H H;  1Q86 W;  1XMO O;  3ZHQ A;  1THZ A;  5CN0 A;  2P06 A;  2CH7 B;  4KUM A;  4XTV A;  1NTK H;  2I4O A;  4DR1 B;  2RCV A;  1WNS A;  5LHI A;  2CK3 G;  1AVM A;  4XTU A;  1VQ6 V;  2OT5 A;  5HFL A;  3ABM C;  1HNZ O;  1NYQ A;  1S5H C;  1OCZ C;  3K06 A;  2AW9 A;  4HNA A;  2HFE C;  2E5L B;  2DN9 A;  4O4J B;  1WB8 A;  5LMU O;  4UVC A;  4FM0 A;  3JYC A;  3A2F A;  5GTI Z;  2LGQ A;  4EFB A;  3AG4 C;  2RJZ A;  4IIJ A;  4HBN A;  3ZRV A;  3P8T A;  2F23 A;  5JCO A;  3OD4 A;  4JYB A;  3RT3 C;  3OR6 C;  1GTO A;  1QBZ A;  1QR9 A;  1KMN A;  4YJ3 A;  4P73 A;  4DV5 B;  4P3O A;  1WQ7 A;  1COW G;  2EIL C;  2Y0I A;  5IWA O;  3BAB A;  3HY1 A;  5L3D A;  2IJH A;  5IJ0 A;  2BE3 A;  2PI4 A;  1H2M A;  1P49 A;  2A3Q A;  2Z0A A;  3OFN G;  3KG2 A;  4YRR A;  2QHT A;  1CXZ B;  3H1I H;  5D5P A;  1V9P A;  2GTS A;  1M56 B;  2P67 A;  3CE2 A;  3OUF A;  4FM1 A;  1XNR O;  4U3J A;  4MVZ A;  1IXB A;  2PGG A; 
#chains in the Genus database with same CATH homology
 4X1Y B;  1WNL A;  2UXC B;  1EQR A;  4ZI7 A;  4CC5 A;  2XHB A;  4G84 A;  2IM9 A;  4B3T B;  2E10 A;  1KOG A;  3T1H B;  1TA8 A;  1JFF B;  4YRS A;  4LR3 A;  4DR3 B;  4YRN A;  4TV8 A;  3QO7 A;  5KMG B;  4X65 B;  4ZTZ B;  2AKW A;  1N9W A;  1J5E B;  4KR2 A;  5JH7 B;  4YRQ A;  1SQF A;  1G6U A;  4LNU A;  1RIQ A;  4B3S B;  4YJ2 A;  2UXD B;  1Z5V A;  3K57 A;  1B70 A;  2ZR2 A;  2ZT8 A;  4UPA A;  5BMV A;  1USY C;  1ATI A;  2VWK A;  2CJ9 A;  2ALY B;  2EAY A;  3HFZ B;  2DKG A;  1XNQ B;  3NEM A;  4XTY A;  1XI1 A;  5EYP B;  5ITZ A;  5IWA B;  4KL1 A;  2ZZE A;  3JAT B;  4DK0 A;  4YRI A;  4H2V A;  1D5A A;  5C52 B;  1IBK B;  3N2K B;  3P8Y A;  1L0W A;  2Q7H A;  4CH6 A;  4DR4 B;  3SR2 C;  3UFG A;  5JVD B;  4I9Q A;  5IJ0 B;  4H2Y A;  4O2B B;  3NEL A;  2DU7 A;  2PTM A;  3HXV A;  3N2G A;  2ZNI A;  4K86 A;  2QHU A;  4DV3 B;  4WI1 A;  4RQE A;  3A7U A;  5CA0 A;  1Q43 A;  2DZ9 A;  1O9G A;  4JYA B;  2V4D A;  2ART A;  4DR5 B;  3A74 A;  5LYJ B;  1E1O A;  2ZCE A;  1C0A A;  1IL2 A;  1HXD A;  4YHH B;  2ZR3 A;  2DJZ A;  4YPF A;  3SGI A;  4UP7 A;  1JJC B;  4TUY A;  2ODR C;  3B2E E;  4CH3 A;  3U0Z A;  4OLF A;  4X5O A;  4ZTU B;  3VQY A;  3ICA A;  2G4C A;  4HNA B;  5KX5 A;  4FLU A;  5GON A;  1NJ2 A;  2DDZ A;  5LOV A;  4DV4 B;  2EX3 A;  4FFB B;  3M4P A;  4X66 B;  4HVC A;  2DXU A;  5LMN B;  4XU3 A;  2VQF B;  3RL6 A;  4YRT A;  3UGT A;  4CH4 A;  1XMQ B;  2KKW A;  1E24 A;  1N36 B;  4PI2 A;  5FPO A;  4UCT A;  3RF1 A;  4TVY A;  1EIY A;  4LF5 B;  1X2H A;  4DRX B;  4TWA A;  4TQD A;  1H4V B;  3JAL B;  5KMG A;  4O4J A;  1HNW B;  4I4T B;  4P72 A;  2CAZ C;  1IBM B;  1HC7 A;  2YI9 A;  1IBL B;  3L2Z A;  4HA8 A;  1X54 A;  2HEP A;  3REX A;  5D5Q A;  5E3I A;  4LVL A;  3A5Y A;  5JQG A;  2ZT6 A;  3HKB A;  4PI0 A;  3K5L A;  3RYI A;  4D7S A;  2ARS A;  3CHX A;  4G85 A;  1G51 A;  5EIB C;  1B70 B;  4XU1 A;  4HWR A;  1N32 B;  3HFZ A;  1XHZ A;  1L8D A;  3LNN A;  2CJB A;  4TV8 B;  4JI5 B;  3IG2 A;  2XTI A;  4P72 C;  1Z5W A;  1BBW A;  4YCU A;  5F5W A;  1H2S B;  4LNU B;  3KFU A;  1NT2 B;  1TGO A;  5LA6 A;  4DV1 B;  3K5M A;  4AQY B;  2BTQ A;  3JAS A;  3RKX A;  2R9A A;  3HY0 A;  5JVD A;  3MAQ A;  4CS2 A;  3QG5 A;  4O2B A;  5LXT B;  1YGB A;  4YRK A;  4GLX A;  4H2X A;  3RIR A;  1TAE A;  1RSO A;  5ITZ B;  3A32 A;  3HRI A;  4TVA B;  4YRO A;  3PN1 A;  2P5I A;  4YRG A;  2QHV A;  3DSQ A;  3RYF B;  4O4I A;  4DQ2 A;  4RQF A;  3HKE A;  2P0L A;  3L1A A;  4BW9 A;  4CC6 A;  2AMC B;  4O4L B;  4X1K A;  5FNV B;  1DGS A;  3BFM A;  4P74 A;  4X1I A;  4TUY B;  3IAL A;  4UCO A;  4XTZ A;  4FLZ A;  2RHS A;  2UUA B;  3W3S A;  1I7F A;  4LF4 B;  2EL9 A;  5JH7 A;  3RGL A;  3G1Z A;  2E3C A;  4LFC B;  5KHI A;  3U10 A;  4LVJ A;  3HKD A;  1G5I A;  3HKC A;  5CB4 B;  2DZC A;  1E22 A;  4X20 A;  4YJ2 B;  4HWO A;  4EFE A;  2F66 C;  3TEG A;  1QHT A;  1XMO B;  5LYJ A;  3NEN A;  2I4M A;  3A31 A;  5EIB D;  3HRK A;  3L4G B;  3RKY A;  4WF2 A;  4WBN A;  3RUX A;  2ODR D;  3VQX A;  1NJ5 A;  2CJA A;  3JAT A;  3REU A;  4AH6 A;  2NS6 A;  4K87 A;  3A5Z A;  4NXN B;  1KMM A;  4XEO A;  1TVK B;  3JAL A;  3PZC A;  5C8Y B;  4JI7 B;  4F6R A;  2JVD A;  4I4T A;  3M7M X;  4FFB A;  4TQF A;  5IYZ A;  1N34 B;  5ELN A;  4Q15 A;  1ADJ A;  4DUY B;  1VF7 A;  5BMV B;  1SET A;  3PCO A;  5K1P A;  3UGQ A;  2IY5 A;  2ZIO A;  3N2G B;  4LH7 A;  3RFR A;  4X64 B;  1WN7 A;  2ZGW A;  5LMU B;  4DRX A;  4YRM A;  1LYL A;  4EO4 A;  5LP6 B;  3ETQ A;  3N2K A;  4I50 A;  2DXT A;  2RHQ A;  3A7R A;  3EFR A;  4H2U A;  3BPZ A;  1NNH A;  4CH5 A;  2ZXF A;  1EOV A;  4HT4 A;  4JI0 B;  4JI3 B;  4GKK B;  4UCS A;  3BA9 A;  3VQV A;  1GGM A;  1NJ6 A;  4NCX A;  5LA6 B;  3QTC A;  12AS A;  4CS3 A;  3HKB B;  1H4S A;  1VQZ A;  1NJ1 A;  4XEM A;  3HFV A;  2A8E A;  1O9H A;  2EJF A;  5KHK A;  4ZIB A;  3HXY A;  4P3N A;  3RWR D;  1HNX B;  3V8L A;  5IJ9 A;  2ZNJ A;  4UP8 A;  3BRC A;  1ASY A;  3RYF A;  3E9I A;  4B3M B;  3UQ8 A;  3WB0 A;  4ZOL B;  4XTX A;  1EIY B;  2P5O A;  1HW7 A;  4DR6 B;  3ZED A;  2PZS A;  2E64 A;  2JGU A;  3RYH B;  4X1I B;  3JAR B;  4WJ4 A;  2ZIN A;  4O2A A;  2BTQ B;  4YRE A;  3UH0 A;  1EFW A;  2J3M A;  1TUB A;  2VWJ A;  5JJE B;  1YB3 A;  3TEH A;  2QJ1 A;  3ZS8 C;  4YDQ A;  1SA0 B;  4YCV A;  1ASZ A;  4LH6 A;  5JCO C;  3RYC A;  1X55 A;  2F95 B;  2I4N A;  1T5E A;  2ZIM A;  3A7A A;  1QF6 A;  2DVE A;  4UCV A;  2EWN A;  2GV9 A;  2Q5H A;  3V7S A;  3HKE B;  4K88 A;  2AMC A;  2E5A A;  3M4Q A;  4DR7 B;  4K8X A;  2F1M A;  1Q3E A;  4FVM A;  2RHS B;  2R72 A;  3UT5 A;  4JV5 B;  4YRC A;  4UFZ A;  2I4L A;  4KR3 A;  3FFQ A;  4O4H B;  3QO5 A;  4TV9 B;  2ARU A;  1WU7 A;  4DR2 B;  2Q5I A;  4FM2 A;  2ZTG A;  2QM4 A;  3EFS A;  2EJG A;  3JAS B;  2F4V B;  3CSX A;  4EB6 A;  4ZHQ B;  3K59 A;  2ZT7 A;  4P71 C;  4YP0 A;  3PCO B;  1W66 A;  3JAK B;  1Q8I A;  4TVA A;  5KHH A;  3ERR A;  1G5H A;  4LNS A;  1FFX B;  3V7R A;  3QF7 A;  3E22 B;  3SJB C;  1WQW A;  5JJN B;  3HXU A;  1X56 A;  5C8Y A;  5EZY B;  1FJG B;  2PYJ A;  1EVK A;  4DV7 B;  1Z7M A;  4YYE A;  2F93 B;  4Q6G A;  4LF7 B;  3IAY A;  1J5W A;  1SQG A;  1QQC A;  3K5N A;  1XQ8 A;  4H02 A;  4JI8 B;  1JJO A;  5LXT A;  3OTO B;  1HTT A;  3U11 A;  3HKC B;  5CB4 A;  3LSS A;  4X20 B;  3LSQ A;  5JJJ B;  2YXL A;  2YIA A;  5J2T B;  3JSN A;  1Q5O A;  4OX9 B;  1X2G A;  4HWT A;  2UU9 B;  2FYK A;  2E41 A;  3L4G A;  1HR0 B;  4DV0 B;  1B7Y B;  3QO8 A;  1M93 A;  4P73 C;  3ICX A;  4PHC A;  5C51 B;  4ZOL A;  2HNI A;  1PYS B;  4YRF A;  4EX5 A;  1TVK A;  3RYH A;  3JAR A;  1B76 A;  1EVL A;  2E1H A;  4FLV A;  3OD1 A;  3HKD B;  2BTO A;  4FLT A;  4KHP B;  4I55 A;  11AS A;  3JAW A;  2OYQ A;  4GYC B;  4LFA B;  1Z7N A;  1YEW A;  4H2T A;  4XU0 A;  4X62 B;  2Q7G A;  5KHJ A;  3FJP A;  4RDX A;  4HWP A;  1E1T A;  4XTW A;  3V8K A;  5ELO A;  3IKL A;  1NJ8 A;  2OWO A;  1S5J A;  2IY5 B;  4J15 A;  4WBN B;  1JFF A;  1X01 A;  4K8Z A;  2YIB A;  4LF9 B;  3K5O A;  4JI4 B;  2CGH A;  1YFR A;  2ZZF A;  5J2U B;  2C8M A;  5FPR A;  1BIA A;  3E9H A;  4XU2 A;  5CA1 B;  2AKW B;  3RGB A;  4F6R B;  3I7F A;  5LP6 C;  4JI1 B;  4LFB B;  1YFT A;  1TUB B;  4IHJ B;  5IYZ B;  4IIJ B;  4YRP A;  3V8J A;  3WB2 A;  3IKM B;  4P75 A;  3RYC B;  4OP0 A;  4L8J A;  1M5I A;  1ZAU A;  4ZHQ A;  4EB6 B;  4K0K B;  4YY3 B;  3T1Y B;  2ZM6 B;  4YJ3 B;  1NYR A;  4TVW A;  4P3P A;  5HGQ A;  3TUP A;  4P75 C;  2DTH A;  4FLW A;  2HHH B;  2XGT A;  4DK1 A;  5LP6 A;  2UUB B;  4LF6 B;  3LC0 A;  4I50 B;  1SES A;  4TTV A;  1KMI Z;  3UT5 B;  2RHQ B;  1SKV A;  4PHZ A;  4LVK A;  3BA8 A;  3VBB A;  4O4H A;  1WYD A;  3MF1 A;  4L87 A;  3P8V A;  4AHC A;  4O2A B;  5BR8 B;  1HNZ B;  2PME A;  4X1Y A;  2RQ6 A;  4NVP A;  2R70 A;  4D7T A;  4AIL C;  4DV6 B;  4CS4 A;  1SA0 A;  5EYP A;  2DU5 A;  5IJ9 B;  3CB2 A;  3BJU A;  5J2T A;  3K58 A;  4YCW A;  1KU9 A;  3OTF A;  3THO A;  3E22 A;  2YIB D;  4JI6 B;  3HXW A;  2QHS A;  5K1X A;  1BBU A;  3HXX A;  3MF2 A;  4PG3 A;  3R07 A;  5EZY A;  1QE0 A;  1B7Y A;  3HTZ A;  4YRL A;  4HWS A;  4LVM A;  4U3J B;  3JSL A;  3MQZ A;  1JMK C;  3SJC C;  2Q0A A;  4YRJ A;  4XTV A;  5GON B;  3TEH B;  2I4O A;  4ZI7 B;  1XNR B;  2P22 C;  1B04 A;  1I94 B;  4DR1 B;  3VQW A;  3QNE A;  1WPY A;  4DUZ B;  1WNS A;  4XTU A;  4UCR A;  2ALY A;  4P74 C;  4LVI A;  4NXM B;  1NYQ A;  3BAA A;  2CIM A;  4DPG A;  1ADY A;  3MEY A;  5KNN A;  2PMF A;  3SJA C;  1H4T A;  4BWA A;  4HNA A;  2E5L B;  5CA1 A;  4O4J B;  4TV9 A;  2ZZG A;  3CMQ A;  4FM0 A;  2DTO A;  1WLE A;  3A2F A;  2UUC B;  2DQ0 A;  4EFB A;  1BIB A;  2JS5 A;  1X4T A;  2RJZ A;  4IIJ A;  4HBN A;  4JI2 B;  2C7I A;  3P8T A;  5JCO A;  4P71 A;  4B08 A;  2PYL A;  3V7C A;  5KHG A;  3JAK A;  2ZT5 A;  1KMN A;  3HXZ A;  1B8A A;  4YJ3 A;  4P73 A;  4WJ3 M;  4DV5 B;  1FFX A;  4P3O A;  4E51 A;  5J2U A;  1WQ7 A;  1WPB A;  2Q7E A;  4H2W A;  3WB1 A;  1XHX A;  1JJC A;  1SRY A;  1PYS A;  4IHJ A;  2DQ3 A;  3BAB A;  1YFS A;  2EJ9 A;  3HY1 A;  2PUS A;  4FLX A;  4KQE A;  5C53 B;  5IJ0 A;  5JQG B;  5LOV B;  3RYI B;  4I55 B;  4UCU A;  4FLY A;  3JAW B;  4GKJ B;  1USY A;  1P49 A;  3NET A;  4TOI A;  4H2X B;  4LF8 B;  5CA0 B;  4RMF A;  1M4U A;  4YRR A;  3RAC A;  2QHT A;  3RKW A;  1H4Q A;  3BHP A;  2DEQ A;  3WQZ A;  2E65 A;  1FYF A;  4H2S A;  5D5P A;  1V9P A;  4O4I B;  2DTI A;  4FM1 A;  4B3R B;  2VQE B;  1N33 B;  2UXB B;  2YI8 A;  4O4L A;  4X1K B;  5FNV A;  4O2D A;  1SER A;  2J3L A;  4U3J A;  5KX5 B;  4UP9 A;  2PY5 A;  4EEQ A;  2PGG A;  4DV2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...