3DSQA

Structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
278
Chain Sequence
PPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolysyl-tRNA synthetase
publication title Structure of Desulfitobacterium hafniense PylSc, a pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
total genus 80
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3dsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3dsqA02
2EAYA 3IALA 4TQDA 2YI9A 2CJ9A 3UH0A 4KQEA 3VQWA 1NYQA 3FJPA 2DEQA 2DQ0A 3A32A 3HFZB 3HXUA 4CH3A 2R72A 2RQ6A 1EVLA 3W3SA 4YRKA 2IY5A 1O9HA 4XEMA 2EL9A 3HXVA 1NJ6A 4K86A 4P75A 2DXTA 3E9HA 4HWTA 2ZGWA 3RIRA 2DU7A 1E24A 2CGHA 1EOVA 4YRMA 4EX5A 2DU5A 4P74A 3PCOA 2ODRC 2I4MA 4YRQA 1ATIA 3KFUA 4HVCA 1ASYA 3HY0A 4WJ3M 3QNEA 3BJUA 3P8VA 1HXDA 4P3OA 3R07A 3HXWA 2PMFA 2I4OA 2C7IA 4TVWA 1E22A 2G4CA 4HWPA 2RHQA 3A5YA 4LNSA 1Z7NA 3A7UA 1WQ7A 1E1OA 4CH5A 4XTWA 2I4NA 4P3NA 1X55A 4HWRA 3IG2A 4YPFA 3VQYA 2DZCA 2CJBA 3P8TA 4H2YA 4TVAA 3V8KA 4XU3A 4DQ2A 3HRIA 4BW9A 2QHSA 4YRSA 5C53B 2QHUA 1EFWA 1KOGA 1Z7MA 2IY5B 3QO8A 4XTZA 4OLFA 2ALYA 1B7YA 2ZT7A 3RGLA 1RIQA 4P3PA 3RKXA 4X5OA 4Q15A 4YDQA 2ZCEA 1G5HA 3G1ZA 4G85A 3BFMA 1X01A 3HXXA 1YB3A 3A7AA 2E41A 2YIAA 3V8LA 4H2VA 4YYEA 3LSQA 4YRNA 4UP9A 4P75C 5HGQA 3V7CA 3TEHB 1SRYA 4YCVA 2DTOA 2YI8A 1KMNA 2DTHA 1NJ2A 4P71A 5ELNA 3P8YA 4H2UA 2DVEA 4P74C 1EQRA 1GGMA 4P72C 1WYDA 2RHQB 3NENA 1BBWA 4Q6GA 4YREA 3M4PA 4YROA 1YGBA 3RUXA 1NNHA 2E10A 3MEYA 4H2XA 2ARUA 4P73A 1SERA 1G5IA 3CMQA 2ZZFA 1YFRA 4TVAB 2QHTA 4TTVA 1N9WA 3A5ZA 3HXYA 4OP0A 1SETA 4H2WA 3MF1A 2PMEA 2Q7GA 2DKGA 3LSSA 2Q7HA 3VQVA 2C8MA 2ZZEA 4UPAA 3DSQA 2HEPA 1WPYA 1G51A 4UP7A 1B7YB 4CS3A 4HWOA 3RACA 1WNLA 1USYA 2QJ1A 1EIYB 2ZNIA 3UGTA 5ELOA 1BBUA 3EFRA 4YCWA 3EFSA 2ZNJA 4YRPA 3L1AA 4XTUA 11ASA 5C51B 4PG3A 2XTIA 2ZT6A 3UGQA 2I4LA 2ZR2A 2EJGA 1HC7A 2QHVA 4RQEA 1B8AA 2EWNA 3A7RA 2E65A 4P71C 3REUA 2Q5IA 3HTZA 2JVDA 4XTXA 3REXA 5KNNA 12ASA 4YRFA 2E64A 2EJ9A 2RHSA 4ZTZB 4KR3A 4TVYA 2DJZA 3ERRA 1IL2A 2E1HA 2Q7EA 2DQ3A 1X2HA 5C52B 4E51A 1PYSA 2YIBD 4XTYA 3L4GA 4P73C 3PCOB 1X2GA 4CS2A 1WU7A 2ZXFA 2EJFA 4K88A 2AKWA 3NEMA 4L87A 4XU1A 2DDZA 1YFSA 1JJCA 3LC0A 1YFTA 3PZCA 4RDXA 4TWAA 3UFGA 3V8JA 4YRRA 2ZT8A 3RKYA 3HFVA 4XTVA 1EVKA 2DZ9A 2PGGA 4YRCA 4J15A 3OD1A 4UP8A 4AH6A 2YIBA 1H4TA 3VBBA 1FYFA 4CH6A 3QTCA 4YCUA 1O9GA 3TEGA 4ZTUB 3A74A 3NELA 3RKWA 1J5WA 1SESA 4RMFA 5K1PA 2ZR3A 2J3LA 4YRJA 4YRGA 3A31A 2RHSB 2CJAA 3WQZA 4WF2A 2ALYB 1C0AA 3HXZA 3VQXA 4H2SA 2AMCA 4BWAA 1PYSB 2Q5HA 2ZIOA 4H2TA 4KR2A 3L4GB 3L2ZA 1WQWA 1NYRA 4K87A 4YRIA 4O2DA 1L0WA 2ARTA 1X56A 1NJ5A 4H02A 2AKWB 4P72A 1B70A 2DTIA 3E9IA 3BHPA 2ODRD 2RJZA 1JJCB 5E3IA 4RQFA 3IKLA 3RL6A 3V7SA 3TEHA 3QO7A 3ZEDA 2P5IA 3HRKA 4TQFA 3TUPA 4YRTA 2ZTGA 3HY1A 4XU0A 1G6UA 3IKMB 4H2XB 1W66A 1BIAA 4EO4A 2PUSA 2ZINA 3HFZA 3RF1A 1H4SA 1NJ1A 2FYKA 2ZIMA 4PHCA 2XGTA 2CIMA 3M4QA 4WJ4A 4CS4A 1KMMA 2P0LA 1WLEA 4XEOA 2ZZGA 4G84A 3ICAA 4HA8A 2E5AA 1VQZA 1X54A 5F5WA 5K1XA 3QO5A 1QE0A 1ADJA 2R70A 2AMCB 4YP0A 1BIBA 2J3MA 1NJ8A 2HNIA 4YRLA 4XU2A 4HWSA 1H4VB 3NETA 4DPGA 4WI1A 4CH4A 1HTTA 1EIYA 1LYLA 4NCXA 1B76A 1ADYA 1ASZA 4ZIBA 3MF2A 2E3CA 1B70B 3V7RA 1E1TA 3I7FA 2ARSA 1USYC 2ZT5A 2DXUA 1H4QA 1QF6A
chains in the Genus database with same CATH superfamily
1M4UA 2QEXV 3ABUA 1B3QA 1OCRB 5D5QA 1BT8A 2CJ9A 1B6QA 3JAKB 3UH0A 4ZKIA 1R3JC 2CH7B 3G67A 2IM9A 4O4HB 4JAAA 4KXRA 3I5DA 3T4DA 1K92A 3N27A 3A32A 3HFZB 3IC7A 3ETGA 4CH3A 2RQ6A 2UXNA 2OIGA 3I55V 5BY1A 4I50A 2QWPB 4YRKA 4DR4B 2X7RB 5D5PA 2F4VO 3T1YB 3FFQA 1MMMA 1NJ6A 5IJ0A 4DV7O 4LF6B 2ZT9B 3CP1A 3JCZA 2AZ0A 1R3KC 2MW2B 3AK3A 1YHQV 5BZBA 4P74A 1M90W 2ODRC 3RN4A 2E5LO 3FYEB 4DR2O 4YRQA 4D6TH 3P3PA 3BJUA 4HZ3A 1FXVA 2C2AA 2A3QA 1ENVA 3KCXA 5JVDB 1T5EA 4Z1VA 1R3IC 2JS3A 2RHQA 2GHYA 5FPOA 2YEVA 4XTWA 4FIPC 3WFVA 2OWOA 3F5WC 5IYDO 4MVZA 4MVUA 4X62O 3CXCU 4KHPB 1AR1B 3CJHA 2DZCA 1J5EB 4EEQA 3IC9A 1FXHA 1M56B 2Y4TA 4QGPA 2UXDB 1RPRA 1H8HG 2ZQMA 1HNXO 4YRSA 5C53B 1Y67A 2XUMA 5CBGA 5E79Z 1XILA 1V55B 4J42A 4MW8A 1WPBA 4JI1O 2A06H 3K5MA 4OLFA 4DK0A 3CCJV 1MA1A 4PI0A 2ZT7A 2IJHA 4AQYB 2EJ7A 2ZD9A 2EIJB 3B8NA 3BFRA 1X4TA 2E41A 4LFCB 2ZE6A 4BR6A 1YSCA 5H9CA 3JATA 3RYCB 1ORQC 4YRNA 2LFSA 3UQ8A 2ZE5A 2XAGA 1Z5VA 3H1LH 1KMNA 1I5YA 2ODMA 3OR7C 4BW5A 3ABMB 4P74C 1DTOA 4MW3A 4NTYA 2KSDA 2PF4E 2Y69C 3ASNC 3JCUZ 3RWRD 4JTDB 1MZEA 5CA0B 3E8GA 1A32A 4IYHA 4LF9O 1HR0O 3E89A 4P73A 1W0KG 1F23A 1YCIA 5H6RA 1KECA 4QPKA 2EJRA 1ZAUA 2FKXA 2QHTA 5B1AB 4EFEA 1CPYA 3RVZA 3HXYA 4IL6Z 3MQZA 4OP0A 1NVPB 3CC7V 3CXHF 5B1NA 2RMKB 4O4LA 2NS6A 2AGAA 2B1GA 1WN7A 2ZE7A 3JD0A 3LSSA 4UPAA 2E75B 1VQ4V 1G51A 4UP7A 4CS3A 1TVKA 4HWOA 1NTZH 1OHHG 2H8PC 2HVJC 2LW7A 2K1EA 3CX5F 2DMXA 3R65A 2ZXWB 1USYA 4HNAA 2QJ1A 5BXZA 5JQGB 3ETEA 1BBUA 3N2GB 3JASA 3AK2A 1K9MW 4LFBO 4YRPA 1FYJA 1JCHA 2ITDC 5GONB 2P67A 2F4VB 11ASA 3TK1A 4PG3A 4DR1O 4I9QA 2ZT6A 3UGQA 4DV7B 2I4LA 4HT4A 5DECA 2QHVA 2CTRA 4IGGA 2BTQA 1B8AA 4DUZO 4WF9V 1QBZA 2E5LB 4I4TB 3KZIZ 2KG7B 3OUFA 4DR2B 1IBLO 1NR1A 3HTZA 1LUWA 3REXA 5KNNA 5F2VO 1QCEA 1MSDA 2EJ9A 4LVLA 4WBNA 1KP2A 5LA6B 1Q6UA 2GUZA 4TVYA 1F4NA 1YEWA 2EILB 4K0KO 1IL2A 2E1HA 2AHZA 2Q4PA 1K7DA 1YTFB 1YF2A 4J7JA 3RYHA 4P73C 1Q82W 1R3LC 1D5AA 1VF7A 3TGUH 4X62B 2N74A 1WU7A 3T1CA 2W6IG 5JWPA 1TAEA 3L70H 3ZHVA 3SYQA 1XOUA 1Q86W 4L87A 3F7YC 1YFSA 1K33A 4TWKA 1JJCA 3SYCA 1GKFA 3PZCA 1NZ6A 4TWAA 1AR5A 3U10A 1QVGU 3CRAA 1HNXB 1VQ9V 2ZT8A 4UCTA 4X1IA 1NI8A 3MAQA 1EVKA 4JI1B 2DZ9A 2QWNB 3SPHA 5CBFA 2EIKC 1RM1B 2HFEC 3ETDA 1Y4MA 1H4TA 1R73A 5CMUA 1FYFA 4X1YB 3QTCA 3LUTB 4DV2O 3SYPA 4ZTUB 3A74A 1PM9A 4D7SA 1H2NA 1R6KA 3RYFB 4AHCA 4RMFA 5K1PA 1IX9A 1JVMA 3AG2C 4CC5A 2ZR3A 1OCCC 5JJJB 3A31A 4TUYA 1BSMA 3F7VC 4NXNO 2CTPA 4BIUA 4WF2A 2ALYB 2CDYA 4RO2A 2LGQA 1KQSU 3N2KA 2A0LA 1JX9A 3JD2A 3T1HO 1FXKA 2L35A 4QE7A 2ZIOA 4P9OA 2CTQA 4OPHA 4K87A 3CCMV 1W2BU 4LF9B 3SJCC 2N05A 2QTOA 3A0HZ 3K79A 5KX5A 1HR0B 2ARTA 4P72A 1XREA 4UVBA 2B1IA 3BAAA 3BHPA 1YI2V 4GKKO 3CYOA 1ZL8B 4DO2A 3D3IA 4RQFA 3IKLA 5LP6B 1L1FA 3OMAB 1KKDA 5CB4A 3ZEDA 3CCUV 5EIBD 3ZHRA 1KP3A 3CCLV 1VQLV 1JR9A 2JGDA 3E8FA 3CRCA 1QQCA 3HY1A 1K73W 2DYSC 1NQTA 2X6BA 3JAWB 1EN4A 4FPPA 4GKJO 1E1RG 4EO4A 2PUSA 5EYPA 2B9ZA 3O9OA 1H4SA 3ABKB 4P30A 2XGTA 3FAVB 5IE9A 4WJ4A 4YIOA 1FS0G 1JA8A 5EZYA 4LFBB 1BS3A 5FNVB 3ICAA 2EINC 3DXRB 4DV4O 4DR1B 1YVWA 3RBZA 4Z1MG 2R70A 1XMOO 4YP0A 1I5XA 1AI6A 1AP5A 2XHBA 4LFAO 2Q0AA 3DC6A 2WLNA 1EZVH 5KUKA 4DUZB 3OFNG 3A2FA 4DPGA 4O4IA 2GV9A 1HP8A 1IBLB 3K06A 3EHBB 3R66A 4H0LB 2W6JG 2OCCC 2ARSA 4JI7O 1FXKC 4WFGA 2UXBO 2DXUA 4I0XB 4ZBMA 4K0KB 1VQOV 4UCSA 1AI7A 3CD6V 2QM7A 1S5JA 1PKXA 3B8MA 4KQEA 1R1BA 3VQWA 3OT7A 2XAJA 1I08A 5KAFZ 2DEQA 2DQ0A 4PA9A 1K3EA 4MSWC 4PELA 5IYZB 5CN0A 3QF7A 1NJIW 3Q4HA 1KC8W 1WJZA 4P75A 5LGTA 2DXTA 1YXBA 4HWTA 3RIRA 3W7UA 2QR4A 5KA5A 2CTWA 3JALA 1N8RW 3I56V 2XAHA 1NTKH 1PL4A 1EOVA 4YRMA 4I55A 2DU5A 3PCOA 4O2AB 3OD4A 3T2MA 1EN6A 3CPWU 4DV2B 1KUQA 5KLVH 2I4MA 2VWJA 1ATIA 3B77A 4HVCA 1DLBA 1ASYA 5EIBC 2Q6AA 2QDOA 2O57A 3P8VA 1N33O 1EBOA 4P3OA 1K8AW 2QKAA 4UCVA 1VF6C 3HKBB 1Y74A 3OGCC 3OUSA 4NXNB 3K5OA 2AW9A 5A2QN 3A5YA 1WQ7A 2H94A 4CH5A 4WFHA 1Y76B 1GM7A 3T1HB 1EN5A 3ZRXA 4EKWA 1GMGA 4KUMA 2LJ2A 2PZSA 5LMNO 3K3WA 4YPFA 3VQYA 5LXTB 2Q9LA 2CJBA 3OW2U 3P8TA 4H2YA 3EVKA 5KMGB 1DF5A 1N34O 1XNRO 1UFIA 4JI2O 4DQ2A 3O65A 5BMVA 4GKKB 4AI8A 4TV8B 5FPRA 2QHUA 3UCSC 3CC2V 3UO3A 1Q6IA 4I50B 4B3RO 4TV9B 3ABTA 1FAFA 1F7YA 1KOGA 1FFTB 4YXWG 3HB3B 3K5NA 5EC2C 4LBEC 4XTZA 4LH7A 5IJ0B 3LDEA 4YJ3A 1B7YA 3RGLA 4P3PA 3BA9A 5LMUO 4WFEA 4X5OA 1G5HA 3G1ZA 5L3CA 4G85A 4LR3A 2D2CB 1W59A 4MS2A 4GKJB 1RFYA 4FM1A 2A9HA 5EBMC 4H2VA 3ASNB 1MG1A 4FLTA 4OGQB 4P75C 1FJGO 5HGQA 1H2LA 2DTOA 2QWQB 4U3JA 1NJ2A 1QR9A 1XL4A 1WP8A 3QG5A 4Q20A 2QA4V 1VQNV 1ZWIC 4YY3O 4CC6A 4DV4B 1US6A 3CC4V 2RHQB 5IYBO 4YREA 1PL0A 2YEVB 1XMOB 4LFAB 1YGBA 5J2TA 1NH2D 1RP3B 3C3TA 4R6ZA 2QM8A 2OT5A 2UUCO 1G5IA 3CMQA 4UV8A 2H3OA 3JAMN 1OJHA 3H9VA 4TTVA 5CA1A 1N9WA 3A5ZA 1BZKA 3FD9A 4JI7B 2GTAA 5KUMA 4DV0O 2UXBB 3OEEG 2HP8A 5JJNB 3BPZA 1SETA 4R8CA 4H2WA 3MF1A 2PMEA 1Q8IA 1SQXH 1KKCA 2C8MA 4HYOA 2ZZEA 1GAXA 4PDRA 2PYLA 1WNLA 4F6RA 4JI5O 3OMNB 1EIYB 2ZNIA 1MSWD 3UGTA 1TUBA 4X9QA 1R6TA 1W0JG 2BOBC 4ZOLB 1XHZA 3JD3A 3CSXA 4BIZA 4LF7O 2ZNJA 1FPOA 4XTUA 1QU7A 1XNQO 2XASA 2XTIA 1FFXA 1H2GA 3AEIA 2WLIA 1NR7A 2FL4A 1Q6HA 3C3SA 1HC7A 3FX7A 1PNLA 4QNHB 2HLDG 1QLNA 1QLEC 3JAKA 4JV5O 2WLLA 4DV6O 4LH6A 3A7RA 4OXSA 2FYUH 4UXNA 1N33B 4CZZA 1XHXA 2E64A 4YRFA 2RHSA 3CRMA 2XOKG 4UVCA 2P4VA 4KR3A 1XUQA 1AJNA 4J9YB 2XNDG 2ETNA 3HKCA 4XDJA 3K58A 2IU3A 1WA8A 2Q7EA 5EBLC 5IJ9B 5C52B 1SA0A 4E51A 2NNUA 4O4LB 1PYSA 3A8TA 3L4GA 4JI0O 2OTJV 1OZ0A 3RYIA 4DV1O 4G28B 4CS2A 4QJFB 1WNSA 4JI4O 4WFBV 5LMNB 2DN9A 2ZXFA 5IT9N 2AKWA 5EC1C 2EIKB 4HNAB 2DDZA 3IGAC 4DR5O 3LC0A 2Q73A 1N34B 2WA4A 1NKDA 1YFTA 1XNRB 3JD4A 4JI2B 3AG4C 1VARA 2F93B 2F95B 1S76D 2KB1A 3NXSA 3V8JA 2Z5UA 4GX5A 4O4JA 4YJ2B 4B3RB 3RKYA 5HFLA 3UKMA 3LDDA 1IDSA 5IY5C 4FM2A 1TUEB 2QSAA 3OD1A 4UP8A 4AH6A 3AG2B 2DYRC 5LMUB 4X1KA 4YIPA 2BTQB 3TEGA 3NELA 4DUYO 3K08A 3OAAG 2Y0PA 1OCZC 3RGBA 4FK5C 2JDIG 2OIEA 1FJGB 1ZSPA 4MVOA 1BE3H 4JI6O 4JTAB 2Q0OC 1MABG 4LCUC 3MDSA 5AG2A 4WBNB 3TXSA 4X88A 3ZRSA 2CJAA 1NTMH 2M7WA 1V54C 3VQXA 1KBHA 4YY3B 2XT9A 4BWAA 4MTXA 4LVJA 3SJQC 2Q5HA 4H2TA 3RYHB 1P84F 1QNMA 3L2ZA 1WQWA 1NYRA 2CGNA 3NR7A 5L3DA 1AI4A 3L9DA 1L0WA 4LVIA 1XQ8A 5J9PC 2UUCB 2DYSB 2Z0AA 2VS0A 1ZTEA 2Y48A 1JJCB 1BL8A 5E3IA 3K57A 5BR8O 1IVSA 3QO7A 4DYLA 4J41A 3FKSG 2EX3A 4IHJA 4YHHO 4DV0B 3HRKA 2EIMC 1UJWB 3FB7C 2BSKA 1PNMA 2ZTGA 1FD9A 4DV3O 4GUNA 1GN3A 2OCHA 2Q68A 1AILA 4H2XB 5CA0A 3RF1A 4JI5B 2EINB 1NJ1A 2FYKA 1GTOA 4RWUA 4JYAO 3HKDA 2CIMA 3D36A 2QKSA 4FFBB 2JRIA 4XDLA 4CS4A 1WPXA 4LF7B 1L0LH 4H13B 4GCZA 1S5LZ 1JFFA 4WFAV 4HA8A 1XNQB 1X54A 4TUYB 5F5WA 2HHHO 2YICA 4UV9A 3J7AU 2J3MA 2OCCB 1NJ8A 4U3FH 1JJOA 2UXCO 2AHYA 2PTMA 4JV5B 3BA8A 1M56C 3NETA 4DV6B 3W7WA 1KYOF 2P06A 5IWAO 1HTTA 1ADYA 2Q8VA 5KX5B 2OTLV 1OCOB 3V7RA 1PD3A 4X20B 1CXZB 1USYC 1BGYH 2ZT5A 1AP6A 1HW7A 3P32A 5CB4B 1VIBA 2BCCH 2E74B 2EIJC 1GRJA 2EAYA 1DK1A 1JOYA 4G27B 2JGDB 2W0FC 1FKAO 4JI0B 2JGUA 3G6BA 4DV1B 5LOVB 3H01A 4X64O 4JI4B 1SQGA 1NYQA 1U96A 2WLKA 2RN9A 3K59A 5EYPB 5LGUA 3OGIB 2R72A 4DR5B 3RW0A 2LW1A 1EVLA 4A5UB 4B3TO 3W3SA 1ZX3A 1PPJH 1DF4A 1GN2A 1WP7A 2VRZA 1RSOA 4I7ZB 2IY5A 4RUFA 4LP8A 4XEMA 4LF4O 2EL9A 4K86A 4PHZA 3E9HA 2GTSA 3WB0A 3W7XA 4D7TA 1I94O 4IT5A 1XL6A 4DK1A 4E4EA 4EX5A 2HJFC 3D36C 3X2QB 5LHGA 2P4KA 3K9SA 3KFUA 2EZOA 5C93A 4DUYB 3ZHTA 1VQ7V 1LUVA 4O4IB 1HXDA 3R07A 2PYJA 5DN6G 3HXWA 1OV9A 4JI6B 4UVAA 2I4OA 5J2UA 3CE2A 3DTUB 3AG3C 4DRXB 2G4CA 4HWPA 4FLUA 4LNSA 1Z7NA 4LWSA 3K03A 4P3NA 1VMGA 1X55A 2ADPA 1NT2B 3QVNA 1P7GA 4HWRA 1VF5B 2XAFA 4X1YA 3IG2A 2CGOA 2V1DA 3ABLC 4TVAA 3V8KA 2QM4A 4PA3A 4PA6A 4UCOA 5FL7G 2JS5A 4XU3A 3H1JH 3RYFA 4FLYA 4BW9A 2QHSA 4FFKA 5JH7B 2EULA 4JAVA 5BR8B 4MVRA 3SPGA 2UUAO 2OYQA 1Z7MA 5H2FZ 4XBFA 4YHHB 3Q4HB 3UT5B 3QO8A 5KA6A 1SF9A 4RAIA 4CBCA 2ALYA 3E22A 4O2BB 3E8BA 3W7SA 1RIQA 4DV3B 1SKVA 5IDJA 2ZCEA 2W0XA 1S0VA 4JI8O 5LYJA 3BFMA 1X01A 2CUGA 2RNBA 3JALB 1XBLA 3HXXA 4I55B 4FLXA 1P49A 3A7AA 3KKYA 3V8LA 5LHHA 4YYEA 3OTOO 3LSQA 2R9IA 4JYAB 2LFRA 4ASUG 1P4RA 4MVQA 3STZC 1SQFA 2MK3A 3TEHB 4YCVA 3ZMZA 1ZL8A 3M99B 2AZ2A 3ETQA 3CCRV 3P8YA 4H2UA 3ZHQA 2G38A 2YIDA 2ITCC 2DVEA 3SJBC 4HBNA 4P72C 2ZE8A 4RUEA 2HHHB 4J9ZB 4Q6GA 3A0BZ 2IW5A 1E79G 2UXXA 3RUXA 1NNHA 2UXCB 4B3MO 3MEYA 1MOFA 2ARUA 2JIZG 4J7KA 3W7TA 5IWAB 1E1QG 2ZZFA 1YFRA 5L3FA 5LL6Y 3FAVA 4B3SO 4EB6A 3BRCA 5BMVB 2F23A 2X6AA 3SGIA 5B1OA 1KB9F 5L3BA 2RCVA 2P90A 4UB6Z 3P30A 1I0HA 4WFFA 2Q7GA 3DXRA 2DKGA 2P6JA 2Q7HA 3VQVA 5C8YA 5TISZ 1AJQA 1MNGA 2HEPA 1WPYA 4DR3O 1B7YB 3RACA 3ZMSA 3HPLC 1N32O 3JSLA 3ZHUA 4X64B 3UM7A 4ZHQA 5KAIZ 4QIWF 3B40A 3M7MX 3EFRA 4YCWA 4BAYA 3AK1A 3EFSA 5KHJA 4B3TB 1QLEB 2F43G 2WAMA 4ABMA 3OE7G 2CAZC 4U3JB 4LF4B 2WA3A 5C51B 1K34A 1GM9A 3SPJA 3OR6C 4KL1A 1GN6A 4TT3G 1JJ2U 4LNUA 2EJGA 1Q81W 1I94B 1H2SB 4N21A 4RQEA 4PDVA 3G6EV 5GW7A 4ZI7A 1G4YB 2EWNA 5J2TB 5HFMA 2QWRB 3OTFA 4B7KA 2E65A 2Q5IA 1K5QA 2Z3YA 5B1BC 4XTXA 1HWYA 4PDLA 3TETA 4FLVA 3JARA 5E1AC 5B5EZ 4PD4F 5CA1B 1TGOA 4PJ0Z 3L71H 1M57C 4NR1A 4NTXA 1X2HA 2JEUA 1K97A 4I5SA 2YXLA 3AG4B 1M93A 4J11A 1BCCH 3ZRWA 4LVKA 4H37A 2Y69B 4JAUA 5IY5B 3MD0A 2F66C 4PA4A 1NH2B 2EJFA 4P2ZA 1YDXA 3L73H 4XU1A 3E35A 2DWDC 3H1KH 1TUBB 4NKGB 3S3WA 2A8EA 2DYRB 4J10A 2DE0X 4RDXA 1LNQA 4YRRA 1BQ0A 1F4MA 4B08A 3HFVA 4JZ2A 2UUAB 1QVFU 4XTVA 4LVMA 2PGGA 3UO2A 4YRCA 1H2KA 4JYCA 3HKEA 1M5IA 3WB1A 1FFXB 3GWOA 1B06A 1G1XB 2VWKA 4JI8B 3CEIA 3ASOC 3CJHB 1O9GA 3WG7C 1N0NA 4IIJA 1V54B 4GYCB 2A79B 2WLLB 1SQBH 4JGSA 4UFZA 3ZS8C 5LXTA 3RKWA 2UUBO 5ITZA 3G71V 1J5WA 4GX1A 1SESA 4KP4A 3OTOB 4DR7O 1H8EG 2VQFO 5KMGA 2P7TC 4YRJA 2HG5C 3ZBHA 2CE4A 4TV8A 2RHSB 4U7OA 1J95A 1URFA 1B04A 2ZDIA 4TV9A 3WQZA 1M9NA 3K0GA 3HKCB 4EFBA 2AMCA 1WA8B 1YZBA 1SA0B 1PYSB 3L4GB 4I9WA 4B7EA 4B3MB 1PV0A 3RYIB 4DW0A 4O2DA 2EIMB 4YRIA 1K4DC 3JATB 3OM3B 2YS8A 4H02A 4MVSA 2AKWB 1B70A 3E9IA 3OEHG 3AG7A 1QHTA 4K35A 4GZRB 1I7FA 3RL6A 4B3SB 3V7SA 2GSMB 3L75H 3AG1C 4O4JB 1AR4A 2XAQA 1NS1A 1JQ0A 4X66O 2CH7A 2L6LA 3LNMB 3B4SA 2V7QG 4O4HA 4DR3B 2CK3G 2XTAA 1N32B 1D2DA 4K8XA 3HFZA 4X1KB 1SZXA 4PHCA 5FLXN 5LHIA 2YXYA 3SYOA 1H2MA 1BHBA 2Q5ZA 2VQEO 4PDMA 4G84A 2DWEC 2E5AA 1VQZA 4F4LA 1VP7A 3K0DA 3G4SV 3QO5A 2DW4A 1QE0A 1ADJA 4HAMA 3GVMA 2BOCC 1TVKB 2WLHA 2HNIA 3JYCA 2Y4UA 4XU2A 4PI2A 1S5HC 3FYIB 4Z2WA 1H4VB 3SPIA 3BVOA 3A0RA 3TXQA 4NTWA 1EIYA 4MTGA 1LYLA 3JASB 2ZDIC 1COWG 4ZOLA 4ZIBA 5JVDA 3MF2A 2E3CA 2HR3A 1E1TA 2ILMA 1Q43A 5L3GA 3ZX6A 4LF5O 4MTOA 3CMAV 4OPAA 3RVYA 1H4QA 1HNZO 5B3SC 4IHJB 1OCCB 2WLJA 2BSKB 3IALA 4TQDA 2YI9A 4L8JA 1AB3A 2IJIA 1PP9H 3KG2A 4GX2A 4IYIA 1IXMA 3FJPA 1Q7YW 2QE7G 3J81N 3HXUA 4LC1A 2YUAA 3THOA 2GUZB 3HKDB 3ZMTA 1OCRC 3IJ4A 5KHGA 1O9HA 1U97A 4DV5O 3HXVA 1Z5WA 1JFFB 3ZN1A 2NN4A 5IJ9A 2ZGWA 2DU7A 1E24A 1THZA 4XDKA 2CGHA 4K3AA 1VQPV 3KCYA 3AG3B 2NR5A 4FJCC 1YJ9V 3C90A 3RYCA 1Z2GA 5KHIA 3D3QA 3PJSK 3HY0A 4WJ3M 2EBOA 3QNEA 2V4DA 2UUBB 1SC5B 3CWBH 1D5NA 4DR7B 2VQFB 3TJTA 5KHKA 2PMFA 1NVPD 3OMIB 2C7IA 4X1IB 1XMQO 1E22A 4TVWA 2PI4A 4YJ2A 3ABLB 1GM8A 1YJWV 1MZFA 1UPGA 3A7UA 3CMEV 1N36O 4JYYA 1RPOA 1CEZA 1E1OA 3G80A 2I4NA 4JYBA 2HVKC 5B66Z 4LF8O 2JEXA 3SPCA 5A9GA 1F51A 1L0NH 4P9PA 3GB7C 1EZJA 1N0JA 1HNWO 2R9RB 3B2EE 3CCEV 1IZ3A 3LNNA 3EXAA 3EFFK 3HRIA 3ZN0A 1EFWA 4JASA 3JD1A 1KU9A 1RSOB 3ZHSA 3ZRVA 2IY5B 3N2KB 3CRRA 4R50A 5EK0A 1FXKB 2GBOA 4X66B 3RKXA 4Q15A 4YDQA 4FMTA 2EZPA 4G2KA 4U7NA 1IXBA 5JQGA 1IBKO 3N2GA 1YB3A 1V55C 2BTOA 2N04A 1V9PA 4FM0A 3SJAC 1WB8A 4X65O 2YIAA 3ZJZA 3STLC 4UP9A 2WWWA 2B5UA 3DGEA 2R9AA 1N4CA 4JI3O 3V7CA 1SRYA 5GONA 2YI8A 2IJKA 2DTHA 4P71A 5ELNA 4PA7A 4UUJC 2ZM6O 2VQEB 4ICGA 2RDCA 5GTIZ 4J7ZA 5J2UB 1YTFD 4OX9O 1BHAA 1EQRA 1GGMA 1AROP 1WYDA 2ZKOA 3NENA 1BBWA 3L72H 3K04A 4NXMO 4PV1B 4LWSB 1IBMO 3M4PA 4I4TA 4YROA 3CCQV 3TCUA 2KG7A 1EFRG 2E10A 3LDCA 4H2XA 2P5OA 3E2EA 3ABMC 1SERA 4MTFA 3APQA 4TVAB 1WB7A 5LA6A 5EZYB 4JPRA 4FFBA 4NVPA 2P22C 2YC0A 4LF5B 3ML0A 3FB6C 1DGSA 1HNZB 3WB2A 5JJEB 4JF3A 2KQXA 4DXWA 2IH3C 3DSQA 4FZ0A 4X89A 5H5NA 2WPDG 3E22B 2ARHA 3D8CA 5B1AC 2FMLA 3RT3C 3H1IH 3P3NA 4GX0A 1P7BA 5LYJB 4DR6O 5ELOA 1YJNV 3L74H 3B09A 3J80N 1GN4A 2KKWA 2LP7A 1CP9A 3WU2Z 1SS3A 2UU9O 1G8MA 3E83A 4AILC 2LO1A 3L1AA 4JTCB 2DJVA 1SQQH 2Y0IA 4X20A 5CBHA 4GLXA 2ZXWC 3BABA 4DV5B 4TOIA 3HR0A 1GO3F 4NB5A 5B1BB 4TSFG 2X0LA 1NBMG 3IFXA 2ZR2A 1TA8A 2YDEA 4C7UA 3ZCCA 4FVMA 4FZ1A 2YSUB 2A7WA 2K9PA 2JJ2G 5LOVA 3BY6A 4P71C 1M57B 1XDCA 3REUA 3ICXA 4H44B 2JVDA 1VQ8V 12ASA 1YIJV 2HKOA 4KFMA 3U0ZA 4ZTZB 4W4KA 3CRQA 1S77D 2DJZA 5LGNA 1BQZA 2X6CA 4EB6B 1XMQB 3ERRA 3MHSC 3RFRA 3FB8C 1JMKC 4UB8Z 2DOSA 5JCOA 3IAYA 2DQ3A 1M1KW 1N36B 4MT8A 1ROPA 2YIBD 4XTYA 4J80A 1VF6A 3PCOB 5C8YB 2IBZH 1X2GA 4NYKA 2QGNA 4LF8B 1VEWA 2ATKC 4K88A 2EILC 5DEDA 1GH6A 3NEMA 4JZGA 4ZHQB 4UCUA 1AI5A 1HNWB 5LP6A 2YXHA 1Y74B 1BMFG 3MHHC 5IYCO 1KD1W 4DR4O 2FTKA 4DW1A 3UFGA 3ASOB 2AXTZ 3WG7B 4FLZA 4GT1A 3T1YO 1ZLZA 5H6QA 4DRXA 5L3EA 4LF6O 4F6EA 1VQKV 1JPXA 3CB2A 4J15A 1VQ6V 2NLJC 3JAWA 2YIBA 3VBBA 4LNUB 3H1HH 4CH6A 4YCUA 3E86A 1VQ5V 4QE9A 1OCOC 2M6YA 4ZI7B 1IBKB 3E8HA 3CCVV 4X65B 1S72V 3DC5A 1RM1C 4JI3B 4UCRA 1YITV 2Q67A 2JJ1G 2JK5C 5FNVA 1EM1A 2J3LA 5CA3A 4YRGA 5JH7A 3JARB 2ZM6B 2E76B 4MVMA 1C0AA 2PI5A 3HXZA 4H2SA 4YJ3B 4OX9B 3UT5A 1S3JA 2Q69A 1Q90D 1SQPH 4W4LA 4O2BA 4NXMB 4N23A 1IBMB 3CHXA 4KR2A 4KHPO 2WLMA 1VQMV 3ZRWB 3AG1B 1QR8A 1J5EO 3CCSV 2D3OW 3LSUA 1X56A 1NJ5A 4E2LA 4QPJA 3ZMUA 2DTIA 2BE3A 5JCOC 3VOUA 2UXDO 2ODRD 2RJZA 1AVMA 3APOA 2IJJA 3PN1A 1SQVH 4I0XA 3TEHA 3K9AA 1AJPA 2P5IA 1NU1H 3CS5A 3T4ZA 2HJDA 3JSNA 4X8AA 4TQFA 3TUPA 3SYAA 4YRTA 5KHHA 2IU0A 3X2QC 4XU0A 1Q5OA 1G6UA 4AQYO 3HKEB 4K8ZA 3IKMB 1K5SA 1WAZA 5LP6C 1W66A 1BIAA 3U11A 2ZINA 5DM6V 2GDSA 4LFCO 4DR6B 3BCCH 2FB5A 1Y66A 2ZIMA 4IIJB 3BEHA 5LBQA 5IYZA 3M4QA 2F1MA 1XI1A 2ADQB 5ITZB 2QWOB 1KMMA 1K4CC 2P0LA 3SDLA 1WLEA 5EBWC 2UU9B 1X59A 3S3XA 1IURA 2ZZGA 4XEOA 3M8AA 4FLWA 3K5LA 5K1XA 1ZUQA 3ABKC 1HDJA 4WCEV 5GTHZ 2AMCB 2WSSG 2QTSA 4O2AA 1BIBA 1LR1A 4F6RB 4R7CA 1PNKA 3FB5C 4YRLA 1R6NA 4HWSA 1KMIZ 1L8DA 4WI1A 4CH4A 5B3SB 4BIOA 1XEQA 4NCXA 1B76A 3SR2C 1Y6XA 3HKBA 1ASZA 4H33A 3ZIAG 3F5TA 1Q3EA 2LQTA 1B70B 2IH1C 1H38A 3I7FA 2PY5A 3ZMVA 1SZTA 1OCZB 1GK9A 2WLIB 3GWKC 1Y76A 2LGWA 2QKCA 1QF6A
chains in the Genus database with same CATH topology
2EAYA 1M4UA 3IALA 4TQDA 2YI9A 4L8JA 5D5QA 2CJ9A 1S5JA 3JAKB 3UH0A 4JI0B 2JGUA 4KQEA 3VQWA 4DV1B 5LOVB 2IM9A 4JI4B 4O4HB 1SQGA 1NYQA 3FJPA 3K59A 2DEQA 2DQ0A 5EYPB 3A32A 3HFZB 3HXUA 4CH3A 2R72A 4DR5B 2RQ6A 3THOA 1EVLA 3W3SA 4I50A 5IYZB 3HKDB 4YRKA 4DR4B 5KHGA 1RSOA 2IY5A 3QF7A 5D5PA 1O9HA 4XEMA 2EL9A 3HXVA 3T1YB 3FFQA 1NJ6A 4K86A 1Z5WA 1JFFB 4PHZA 5IJ0A 4P75A 2DXTA 3E9HA 4LF6B 4HWTA 5IJ9A 3WB0A 2ZGWA 3RIRA 2DU7A 4D7TA 1E24A 4DK1A 3JALA 2CGHA 1EOVA 4YRMA 4I55A 4EX5A 2DU5A 4P74A 3PCOA 4O2AB 2ODRC 4DV2B 2I4MA 3RYCA 2VWJA 4YRQA 1ATIA 3KFUA 5KHIA 4HVCA 1ASYA 3HY0A 5EIBC 4DUYB 4WJ3M 2UUBB 2V4DA 3BJUA 3QNEA 4O4IB 3P8VA 1HXDA 4P3OA 4DR7B 2VQFB 4UCVA 2PYJA 5KHKA 3R07A 3HXWA 3HKBB 2PMFA 4JI6B 5JVDB 2I4OA 2C7IA 1T5EA 4X1IB 5J2UA 4DRXB 1E22A 2G4CA 4TVWA 4NXNB 3K5OA 4FLUA 4HWPA 4YJ2A 2RHQA 3A5YA 4LNSA 1Z7NA 3A7UA 1WQ7A 5FPOA 1E1OA 4CH5A 4XTWA 2I4NA 2OWOA 4P3NA 1X55A 3T1HB 1NT2B 2PZSA 4HWRA 4X1YA 4KHPB 3IG2A 4YPFA 3VQYA 5LXTB 2DZCA 1J5EB 2CJBA 4EEQA 3P8TA 4H2YA 4TVAA 2QM4A 3V8KA 4UCOA 5KMGB 2JS5A 3B2EE 4XU3A 3RYFA 4FLYA 4DQ2A 3LNNA 3HRIA 2UXDB 5BMVA 4BW9A 2QHSA 4YRSA 4GKKB 5C53B 4TV8B 5FPRA 5JH7B 2QHUA 4I50B 5BR8B 1EFWA 4TV9B 1KOGA 2OYQA 1Z7MA 1KU9A 2IY5B 3K5NA 4YHHB 1WPBA 3N2KB 3UT5B 3K5MA 3QO8A 4XTZA 4OLFA 2ALYA 4DK0A 4LH7A 4PI0A 5IJ0B 3E22A 4O2BB 4YJ3A 1B7YA 2ZT7A 3RGLA 1RIQA 4P3PA 4DV3B 1SKVA 3BA9A 4X66B 4Q15A 4X5OA 2ZCEA 1G5HA 3G1ZA 4G85A 3RKXA 4YDQA 4AQYB 5LYJA 4LR3A 1X01A 3BFMA 3JALB 3HXXA 5JQGA 4GKJB 4I55B 3N2GA 1P49A 4FLXA 1YB3A 3A7AA 2BTOA 1X4TA 1V9PA 4FM0A 4LFCB 3SJAC 4FM1A 2E41A 2YIAA 3V8LA 4H2VA 3RYCB 3JATA 4YYEA 3LSQA 4JYAB 4YRNA 4FLTA 4UP9A 2R9AA 3UQ8A 4P75C 5HGQA 1SQFA 3V7CA 3TEHB 1SRYA 5GONA 4YCVA 2DTOA 1Z5VA 2YI8A 4U3JA 1KMNA 1NJ2A 2DTHA 4P71A 5ELNA 2VQEB 3ETQA 3P8YA 4H2UA 3QG5A 2DVEA 5J2UB 4P74C 4CC6A 4DV4B 1EQRA 3SJBC 1GGMA 4HBNA 4P72C 1WYDA 2RHQB 3RWRD 3NENA 2HHHB 1BBWA 4Q6GA 4YREA 1XMOB 4LFAB 3M4PA 4I4TA 5CA0B 4YROA 1YGBA 5J2TA 3RUXA 1NNHA 2E10A 2UXCB 3MEYA 4H2XA 2P5OA 2ARUA 5IWAB 4P73A 1SERA 1G5IA 3CMQA 2ZZFA 1YFRA 4TVAB 5LA6A 5EZYB 1ZAUA 4FFBA 2QHTA 4EB6A 4TTVA 3BRCA 5CA1A 4NVPA 5BMVB 1N9WA 2P22C 3A5ZA 4EFEA 4LF5B 3SGIA 4JI7B 3HXYA 2UXBB 3MQZA 4OP0A 5JJNB 1DGSA 3BPZA 1HNZB 4O4LA 3WB2A 5JJEB 1SETA 4H2WA 2NS6A 3MF1A 2PMEA 1Q8IA 2Q7GA 2DKGA 1WN7A 3LSSA 2Q7HA 3VQVA 2C8MA 5C8YA 2ZZEA 4UPAA 3DSQA 2HEPA 1WPYA 3E22B 1G51A 4UP7A 2PYLA 1B7YB 4CS3A 1TVKA 4HWOA 3RACA 1WNLA 3JSLA 4F6RA 4X64B 5LYJB 1USYA 4ZHQA 4HNAA 2QJ1A 1EIYB 2ZNIA 3UGTA 5JQGB 5ELOA 1TUBA 1BBUA 3M7MX 3N2GB 3EFRA 4YCWA 4ZOLB 1XHZA 3CSXA 2KKWA 3JASA 3EFSA 5KHJA 2ZNJA 4B3TB 4YRPA 4AILC 3L1AA 4XTUA 5GONB 2CAZC 4U3JB 4LF4B 4X20A 4GLXA 2F4VB 3BABA 11ASA 4DV5B 5C51B 4PG3A 4TOIA 2XTIA 1FFXA 4I9QA 2ZT6A 3UGQA 4DV7B 2I4LA 4KL1A 2ZR2A 1TA8A 4LNUA 2EJGA 4HT4A 1I94B 1H2SB 1HC7A 2QHVA 4RQEA 2BTQA 1B8AA 4FVMA 4ZI7A 3JAKA 2EWNA 2E5LB 4I4TB 4LH6A 5J2TB 5LOVA 3A7RA 3OTFA 2E65A 4P71C 3REUA 4DR2B 2Q5IA 3HTZA 3ICXA 2JVDA 4XTXA 3REXA 5KNNA 12ASA 1N33B 4YRFA 1XHXA 4FLVA 2E64A 2EJ9A 2RHSA 4LVLA 4WBNA 3JARA 3U0ZA 4ZTZB 5LA6B 4KR3A 4TVYA 2DJZA 3K58A 4EB6B 1YEWA 3HKCA 5CA1B 1TGOA 1XMQB 3ERRA 3RFRA 1JMKC 5JCOA 1IL2A 3IAYA 2Q7EA 2E1HA 5IJ9B 2DQ3A 1X2HA 5C52B 1N36B 2YXLA 1SA0A 4E51A 4O4LB 1PYSA 1M93A 2YIBD 3RYHA 4XTYA 3L4GA 4P73C 3PCOB 1D5AA 1VF7A 5C8YB 1X2GA 4LVKA 3RYIA 4X62B 4CS2A 1WU7A 1WNSA 4LF8B 5LMNB 1TAEA 2ZXFA 2F66C 2EJFA 4K88A 2AKWA 3NEMA 4L87A 4ZHQB 4XU1A 4HNAB 2DDZA 1YFSA 1JJCA 3LC0A 4UCUA 1N34B 1HNWB 1TUBB 5LP6A 1YFTA 1XNRB 2A8EA 3PZCA 4JI2B 4RDXA 4TWAA 3UFGA 2F93B 2F95B 3U10A 3V8JA 1HNXB 4YRRA 4FLZA 2ZT8A 4UCTA 4O4JA 4YJ2B 4B3RB 3RKYA 3HFVA 4B08A 2UUAB 4X1IA 4FM2A 3MAQA 4DRXA 4XTVA 1EVKA 4JI1B 2DZ9A 4LVMA 2PGGA 4YRCA 3CB2A 4J15A 3OD1A 4UP8A 4AH6A 3HKEA 1M5IA 3WB1A 3JAWA 1FFXB 2YIBA 1H4TA 3VBBA 5LMUB 4LNUB 1FYFA 2VWKA 4X1KA 4X1YB 4CH6A 4JI8B 3QTCA 4YCUA 1O9GA 2BTQB 3TEGA 4IIJA 3A74A 4ZTUB 4ZI7B 4GYCB 1IBKB 3NELA 4UFZA 4D7SA 3ZS8C 5LXTA 3RKWA 4X65B 3RYFB 5ITZA 1J5WA 1SESA 3OTOB 4AHCA 3RGBA 4RMFA 5KMGA 4JI3B 5K1PA 4UCRA 1FJGB 5FNVA 4CC5A 2ZR3A 2J3LA 4YRJA 4YRGA 5JJJB 3A31A 4TV8A 5JH7A 4WBNB 3JARB 4TUYA 2RHSB 2ZM6B 1B04A 4TV9A 2CJAA 3WQZA 4WF2A 2ALYB 1C0AA 3HXZA 3HKCB 3VQXA 4H2SA 4YJ3B 4YY3B 4OX9B 3N2KA 4EFBA 3UT5A 2AMCA 4BWAA 4O2BA 4LVJA 1SA0B 4NXMB 1PYSB 2Q5HA 2ZIOA 4H2TA 3RYHB 1IBMB 3CHXA 4KR2A 3L4GB 3L2ZA 1WQWA 4B3MB 1NYRA 3RYIB 4K87A 4YRIA 4O2DA 4LF9B 3JATB 1L0WA 3SJCC 5KX5A 2ARTA 1XQ8A 1HR0B 1NJ5A 1X56A 4H02A 4LVIA 2AKWB 2UUCB 4P72A 1B70A 2DTIA 5JCOC 3BAAA 3BHPA 2ODRD 3E9IA 1QHTA 2RJZA 1JJCB 1I7FA 5E3IA 3PN1A 3IKLA 5LP6B 3RL6A 4RQFA 3K57A 4B3SB 3V7SA 3TEHA 5CB4A 3QO7A 3ZEDA 5EIBD 2P5IA 2EX3A 4IHJA 3JSNA 4DV0B 3HRKA 4O4JB 4TQFA 3TUPA 4YRTA 5KHHA 1QQCA 2ZTGA 3HY1A 4XU0A 1Q5OA 1G6UA 3HKEB 4K8ZA 3JAWB 4O4HA 4DR3B 3IKMB 4H2XB 5LP6C 1W66A 1BIAA 1N32B 4EO4A 5CA0A 3U11A 2PUSA 2ZINA 5EYPA 4K8XA 4X1KB 4JI5B 3HFZA 3RF1A 1H4SA 1NJ1A 4DR6B 2FYKA 2ZIMA 4IIJB 4PHCA 2XGTA 5IYZA 3HKDA 2CIMA 3M4QA 2F1MA 1XI1A 4FFBB 5ITZB 4WJ4A 4CS4A 4LF7B 1KMMA 2P0LA 5EZYA 2UU9B 4LFBB 1WLEA 4XEOA 2ZZGA 1JFFA 5FNVB 4G84A 3ICAA 4HA8A 2E5AA 4FLWA 1XNQB 1VQZA 1X54A 4TUYB 5F5WA 3K5LA 5K1XA 4DR1B 3QO5A 1QE0A 1ADJA 2R70A 1TVKB 2AMCB 4YP0A 4O2AA 1BIBA 2XHBA 2J3MA 1NJ8A 4F6RB 2HNIA 2Q0AA 1JJOA 4YRLA 4XU2A 4DUZB 4PI2A 2PTMA 4JV5B 4HWSA 3BA8A 1H4VB 3NETA 1KMIZ 4DV6B 1L8DA 3A2FA 4WI1A 4DPGA 4CH4A 1HTTA 4O4IA 2GV9A 1EIYA 1IBLB 1LYLA 4NCXA 1B76A 3JASB 3HKBA 3SR2C 1ADYA 1ASZA 5KX5B 4ZIBA 4ZOLA 5JVDA 3MF2A 1Q3EA 2E3CA 1B70B 3V7RA 1E1TA 1Q43A 3I7FA 4X20B 2ARSA 2PY5A 1USYC 2ZT5A 1HW7A 2DXUA 5CB4B 1H4QA 4K0KB 4IHJB 4UCSA 1QF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAY A;  3IAL A;  4TQD A;  2YI9 A;  2CJ9 A;  3UH0 A;  4KQE A;  3VQW A;  1NYQ A;  3FJP A;  2DEQ A;  2DQ0 A;  3A32 A;  3HFZ B;  3HXU A;  4CH3 A;  2R72 A;  2RQ6 A;  1EVL A;  3W3S A;  4YRK A;  2IY5 A;  1O9H A;  4XEM A;  2EL9 A;  3HXV A;  1NJ6 A;  4K86 A;  4P75 A;  2DXT A;  3E9H A;  4HWT A;  2ZGW A;  3RIR A;  2DU7 A;  1E24 A;  2CGH A;  1EOV A;  4YRM A;  4EX5 A;  2DU5 A;  4P74 A;  3PCO A;  2ODR C;  2I4M A;  4YRQ A;  1ATI A;  3KFU A;  4HVC A;  1ASY A;  3HY0 A;  4WJ3 M;  3QNE A;  3BJU A;  3P8V A;  1HXD A;  4P3O A;  3R07 A;  3HXW A;  2PMF A;  2I4O A;  2C7I A;  4TVW A;  1E22 A;  2G4C A;  4HWP A;  2RHQ A;  3A5Y A;  4LNS A;  1Z7N A;  3A7U A;  1WQ7 A;  1E1O A;  4CH5 A;  4XTW A;  2I4N A;  4P3N A;  1X55 A;  4HWR A;  3IG2 A;  4YPF A;  3VQY A;  2DZC A;  2CJB A;  3P8T A;  4H2Y A;  4TVA A;  3V8K A;  4XU3 A;  4DQ2 A;  3HRI A;  4BW9 A;  2QHS A;  4YRS A;  5C53 B;  2QHU A;  1EFW A;  1KOG A;  1Z7M A;  2IY5 B;  3QO8 A;  4XTZ A;  4OLF A;  2ALY A;  1B7Y A;  2ZT7 A;  3RGL A;  1RIQ A;  4P3P A;  3RKX A;  4X5O A;  4Q15 A;  4YDQ A;  2ZCE A;  1G5H A;  3G1Z A;  4G85 A;  3BFM A;  1X01 A;  3HXX A;  1YB3 A;  3A7A A;  2E41 A;  2YIA A;  3V8L A;  4H2V A;  4YYE A;  3LSQ A;  4YRN A;  4UP9 A;  4P75 C;  5HGQ A;  3V7C A;  3TEH B;  1SRY A;  4YCV A;  2DTO A;  2YI8 A;  1KMN A;  2DTH A;  1NJ2 A;  4P71 A;  5ELN A;  3P8Y A;  4H2U A;  2DVE A;  4P74 C;  1EQR A;  1GGM A;  4P72 C;  1WYD A;  2RHQ B;  3NEN A;  1BBW A;  4Q6G A;  4YRE A;  3M4P A;  4YRO A;  1YGB A;  3RUX A;  1NNH A;  2E10 A;  3MEY A;  4H2X A;  2ARU A;  4P73 A;  1SER A;  1G5I A;  3CMQ A;  2ZZF A;  1YFR A;  4TVA B;  2QHT A;  4TTV A;  1N9W A;  3A5Z A;  3HXY A;  4OP0 A;  1SET A;  4H2W A;  3MF1 A;  2PME A;  2Q7G A;  2DKG A;  3LSS A;  2Q7H A;  3VQV A;  2C8M A;  2ZZE A;  4UPA A;  3DSQ A;  2HEP A;  1WPY A;  1G51 A;  4UP7 A;  1B7Y B;  4CS3 A;  4HWO A;  3RAC A;  1WNL A;  1USY A;  2QJ1 A;  1EIY B;  2ZNI A;  3UGT A;  5ELO A;  1BBU A;  3EFR A;  4YCW A;  3EFS A;  2ZNJ A;  4YRP A;  3L1A A;  4XTU A;  11AS A;  5C51 B;  4PG3 A;  2XTI A;  2ZT6 A;  3UGQ A;  2I4L A;  2ZR2 A;  2EJG A;  1HC7 A;  2QHV A;  4RQE A;  1B8A A;  2EWN A;  3A7R A;  2E65 A;  4P71 C;  3REU A;  2Q5I A;  3HTZ A;  2JVD A;  4XTX A;  3REX A;  5KNN A;  12AS A;  4YRF A;  2E64 A;  2EJ9 A;  2RHS A;  4ZTZ B;  4KR3 A;  4TVY A;  2DJZ A;  3ERR A;  1IL2 A;  2E1H A;  2Q7E A;  2DQ3 A;  1X2H A;  5C52 B;  4E51 A;  1PYS A;  2YIB D;  4XTY A;  3L4G A;  4P73 C;  3PCO B;  1X2G A;  4CS2 A;  1WU7 A;  2ZXF A;  2EJF A;  4K88 A;  2AKW A;  3NEM A;  4L87 A;  4XU1 A;  2DDZ A;  1YFS A;  1JJC A;  3LC0 A;  1YFT A;  3PZC A;  4RDX A;  4TWA A;  3UFG A;  3V8J A;  4YRR A;  2ZT8 A;  3RKY A;  3HFV A;  4XTV A;  1EVK A;  2DZ9 A;  2PGG A;  4YRC A;  4J15 A;  3OD1 A;  4UP8 A;  4AH6 A;  2YIB A;  1H4T A;  3VBB A;  1FYF A;  4CH6 A;  3QTC A;  4YCU A;  1O9G A;  3TEG A;  4ZTU B;  3A74 A;  3NEL A;  3RKW A;  1J5W A;  1SES A;  4RMF A;  5K1P A;  2ZR3 A;  2J3L A;  4YRJ A;  4YRG A;  3A31 A;  2RHS B;  2CJA A;  3WQZ A;  4WF2 A;  2ALY B;  1C0A A;  3HXZ A;  3VQX A;  4H2S A;  2AMC A;  4BWA A;  1PYS B;  2Q5H A;  2ZIO A;  4H2T A;  4KR2 A;  3L4G B;  3L2Z A;  1WQW A;  1NYR A;  4K87 A;  4YRI A;  4O2D A;  1L0W A;  2ART A;  1X56 A;  1NJ5 A;  4H02 A;  2AKW B;  4P72 A;  1B70 A;  2DTI A;  3E9I A;  3BHP A;  2ODR D;  2RJZ A;  1JJC B;  5E3I A;  4RQF A;  3IKL A;  3RL6 A;  3V7S A;  3TEH A;  3QO7 A;  3ZED A;  2P5I A;  3HRK A;  4TQF A;  3TUP A;  4YRT A;  2ZTG A;  3HY1 A;  4XU0 A;  1G6U A;  3IKM B;  4H2X B;  1W66 A;  1BIA A;  4EO4 A;  2PUS A;  2ZIN A;  3HFZ A;  3RF1 A;  1H4S A;  1NJ1 A;  2FYK A;  2ZIM A;  4PHC A;  2XGT A;  2CIM A;  3M4Q A;  4WJ4 A;  4CS4 A;  1KMM A;  2P0L A;  1WLE A;  4XEO A;  2ZZG A;  4G84 A;  3ICA A;  4HA8 A;  2E5A A;  1VQZ A;  1X54 A;  5F5W A;  5K1X A;  3QO5 A;  1QE0 A;  1ADJ A;  2R70 A;  2AMC B;  4YP0 A;  1BIB A;  2J3M A;  1NJ8 A;  2HNI A;  4YRL A;  4XU2 A;  4HWS A;  1H4V B;  3NET A;  4DPG A;  4WI1 A;  4CH4 A;  1HTT A;  1EIY A;  1LYL A;  4NCX A;  1B76 A;  1ADY A;  1ASZ A;  4ZIB A;  3MF2 A;  2E3C A;  1B70 B;  3V7R A;  1E1T A;  3I7F A;  2ARS A;  1USY C;  2ZT5 A;  2DXU A;  1H4Q A;  1QF6 A; 
#chains in the Genus database with same CATH topology
 1M4U A;  2QEX V;  3ABU A;  1B3Q A;  1OCR B;  5D5Q A;  1BT8 A;  2CJ9 A;  1B6Q A;  3JAK B;  3UH0 A;  4ZKI A;  1R3J C;  2CH7 B;  3G67 A;  2IM9 A;  4O4H B;  4JAA A;  4KXR A;  3I5D A;  3T4D A;  1K92 A;  3N27 A;  3A32 A;  3HFZ B;  3IC7 A;  3ETG A;  4CH3 A;  2RQ6 A;  2UXN A;  2OIG A;  3I55 V;  5BY1 A;  4I50 A;  2QWP B;  4YRK A;  4DR4 B;  2X7R B;  5D5P A;  2F4V O;  3T1Y B;  3FFQ A;  1MMM A;  1NJ6 A;  5IJ0 A;  4DV7 O;  4LF6 B;  2ZT9 B;  3CP1 A;  3JCZ A;  2AZ0 A;  1R3K C;  2MW2 B;  3AK3 A;  1YHQ V;  5BZB A;  4P74 A;  1M90 W;  2ODR C;  3RN4 A;  2E5L O;  3FYE B;  4DR2 O;  4YRQ A;  4D6T H;  3P3P A;  3BJU A;  4HZ3 A;  1FXV A;  2C2A A;  2A3Q A;  1ENV A;  3KCX A;  5JVD B;  1T5E A;  4Z1V A;  1R3I C;  2JS3 A;  2RHQ A;  2GHY A;  5FPO A;  2YEV A;  4XTW A;  4FIP C;  3WFV A;  2OWO A;  3F5W C;  5IYD O;  4MVZ A;  4MVU A;  4X62 O;  3CXC U;  4KHP B;  1AR1 B;  3CJH A;  2DZC A;  1J5E B;  4EEQ A;  3IC9 A;  1FXH A;  1M56 B;  2Y4T A;  4QGP A;  2UXD B;  1RPR A;  1H8H G;  2ZQM A;  1HNX O;  4YRS A;  5C53 B;  1Y67 A;  2XUM A;  5CBG A;  5E79 Z;  1XIL A;  1V55 B;  4J42 A;  4MW8 A;  1WPB A;  4JI1 O;  2A06 H;  3K5M A;  4OLF A;  4DK0 A;  3CCJ V;  1MA1 A;  4PI0 A;  2ZT7 A;  2IJH A;  4AQY B;  2EJ7 A;  2ZD9 A;  2EIJ B;  3B8N A;  3BFR A;  1X4T A;  2E41 A;  4LFC B;  2ZE6 A;  4BR6 A;  1YSC A;  5H9C A;  3JAT A;  3RYC B;  1ORQ C;  4YRN A;  2LFS A;  3UQ8 A;  2ZE5 A;  2XAG A;  1Z5V A;  3H1L H;  1KMN A;  1I5Y A;  2ODM A;  3OR7 C;  4BW5 A;  3ABM B;  4P74 C;  1DTO A;  4MW3 A;  4NTY A;  2KSD A;  2PF4 E;  2Y69 C;  3ASN C;  3JCU Z;  3RWR D;  4JTD B;  1MZE A;  5CA0 B;  3E8G A;  1A32 A;  4IYH A;  4LF9 O;  1HR0 O;  3E89 A;  4P73 A;  1W0K G;  1F23 A;  1YCI A;  5H6R A;  1KEC A;  4QPK A;  2EJR A;  1ZAU A;  2FKX A;  2QHT A;  5B1A B;  4EFE A;  1CPY A;  3RVZ A;  3HXY A;  4IL6 Z;  3MQZ A;  4OP0 A;  1NVP B;  3CC7 V;  3CXH F;  5B1N A;  2RMK B;  4O4L A;  2NS6 A;  2AGA A;  2B1G A;  1WN7 A;  2ZE7 A;  3JD0 A;  3LSS A;  4UPA A;  2E75 B;  1VQ4 V;  1G51 A;  4UP7 A;  4CS3 A;  1TVK A;  4HWO A;  1NTZ H;  1OHH G;  2H8P C;  2HVJ C;  2LW7 A;  2K1E A;  3CX5 F;  2DMX A;  3R65 A;  2ZXW B;  1USY A;  4HNA A;  2QJ1 A;  5BXZ A;  5JQG B;  3ETE A;  1BBU A;  3N2G B;  3JAS A;  3AK2 A;  1K9M W;  4LFB O;  4YRP A;  1FYJ A;  1JCH A;  2ITD C;  5GON B;  2P67 A;  2F4V B;  11AS A;  3TK1 A;  4PG3 A;  4DR1 O;  4I9Q A;  2ZT6 A;  3UGQ A;  4DV7 B;  2I4L A;  4HT4 A;  5DEC A;  2QHV A;  2CTR A;  4IGG A;  2BTQ A;  1B8A A;  4DUZ O;  4WF9 V;  1QBZ A;  2E5L B;  4I4T B;  3KZI Z;  2KG7 B;  3OUF A;  4DR2 B;  1IBL O;  1NR1 A;  3HTZ A;  1LUW A;  3REX A;  5KNN A;  5F2V O;  1QCE A;  1MSD A;  2EJ9 A;  4LVL A;  4WBN A;  1KP2 A;  5LA6 B;  1Q6U A;  2GUZ A;  4TVY A;  1F4N A;  1YEW A;  2EIL B;  4K0K O;  1IL2 A;  2E1H A;  2AHZ A;  2Q4P A;  1K7D A;  1YTF B;  1YF2 A;  4J7J A;  3RYH A;  4P73 C;  1Q82 W;  1R3L C;  1D5A A;  1VF7 A;  3TGU H;  4X62 B;  2N74 A;  1WU7 A;  3T1C A;  2W6I G;  5JWP A;  1TAE A;  3L70 H;  3ZHV A;  3SYQ A;  1XOU A;  1Q86 W;  4L87 A;  3F7Y C;  1YFS A;  1K33 A;  4TWK A;  1JJC A;  3SYC A;  1GKF A;  3PZC A;  1NZ6 A;  4TWA A;  1AR5 A;  3U10 A;  1QVG U;  3CRA A;  1HNX B;  1VQ9 V;  2ZT8 A;  4UCT A;  4X1I A;  1NI8 A;  3MAQ A;  1EVK A;  4JI1 B;  2DZ9 A;  2QWN B;  3SPH A;  5CBF A;  2EIK C;  1RM1 B;  2HFE C;  3ETD A;  1Y4M A;  1H4T A;  1R73 A;  5CMU A;  1FYF A;  4X1Y B;  3QTC A;  3LUT B;  4DV2 O;  3SYP A;  4ZTU B;  3A74 A;  1PM9 A;  4D7S A;  1H2N A;  1R6K A;  3RYF B;  4AHC A;  4RMF A;  5K1P A;  1IX9 A;  1JVM A;  3AG2 C;  4CC5 A;  2ZR3 A;  1OCC C;  5JJJ B;  3A31 A;  4TUY A;  1BSM A;  3F7V C;  4NXN O;  2CTP A;  4BIU A;  4WF2 A;  2ALY B;  2CDY A;  4RO2 A;  2LGQ A;  1KQS U;  3N2K A;  2A0L A;  1JX9 A;  3JD2 A;  3T1H O;  1FXK A;  2L35 A;  4QE7 A;  2ZIO A;  4P9O A;  2CTQ A;  4OPH A;  4K87 A;  3CCM V;  1W2B U;  4LF9 B;  3SJC C;  2N05 A;  2QTO A;  3A0H Z;  3K79 A;  5KX5 A;  1HR0 B;  2ART A;  4P72 A;  1XRE A;  4UVB A;  2B1I A;  3BAA A;  3BHP A;  1YI2 V;  4GKK O;  3CYO A;  1ZL8 B;  4DO2 A;  3D3I A;  4RQF A;  3IKL A;  5LP6 B;  1L1F A;  3OMA B;  1KKD A;  5CB4 A;  3ZED A;  3CCU V;  5EIB D;  3ZHR A;  1KP3 A;  3CCL V;  1VQL V;  1JR9 A;  2JGD A;  3E8F A;  3CRC A;  1QQC A;  3HY1 A;  1K73 W;  2DYS C;  1NQT A;  2X6B A;  3JAW B;  1EN4 A;  4FPP A;  4GKJ O;  1E1R G;  4EO4 A;  2PUS A;  5EYP A;  2B9Z A;  3O9O A;  1H4S A;  3ABK B;  4P30 A;  2XGT A;  3FAV B;  5IE9 A;  4WJ4 A;  4YIO A;  1FS0 G;  1JA8 A;  5EZY A;  4LFB B;  1BS3 A;  5FNV B;  3ICA A;  2EIN C;  3DXR B;  4DV4 O;  4DR1 B;  1YVW A;  3RBZ A;  4Z1M G;  2R70 A;  1XMO O;  4YP0 A;  1I5X A;  1AI6 A;  1AP5 A;  2XHB A;  4LFA O;  2Q0A A;  3DC6 A;  2WLN A;  1EZV H;  5KUK A;  4DUZ B;  3OFN G;  3A2F A;  4DPG A;  4O4I A;  2GV9 A;  1HP8 A;  1IBL B;  3K06 A;  3EHB B;  3R66 A;  4H0L B;  2W6J G;  2OCC C;  2ARS A;  4JI7 O;  1FXK C;  4WFG A;  2UXB O;  2DXU A;  4I0X B;  4ZBM A;  4K0K B;  1VQO V;  4UCS A;  1AI7 A;  3CD6 V;  2QM7 A;  1S5J A;  1PKX A;  3B8M A;  4KQE A;  1R1B A;  3VQW A;  3OT7 A;  2XAJ A;  1I08 A;  5KAF Z;  2DEQ A;  2DQ0 A;  4PA9 A;  1K3E A;  4MSW C;  4PEL A;  5IYZ B;  5CN0 A;  3QF7 A;  1NJI W;  3Q4H A;  1KC8 W;  1WJZ A;  4P75 A;  5LGT A;  2DXT A;  1YXB A;  4HWT A;  3RIR A;  3W7U A;  2QR4 A;  5KA5 A;  2CTW A;  3JAL A;  1N8R W;  3I56 V;  2XAH A;  1NTK H;  1PL4 A;  1EOV A;  4YRM A;  4I55 A;  2DU5 A;  3PCO A;  4O2A B;  3OD4 A;  3T2M A;  1EN6 A;  3CPW U;  4DV2 B;  1KUQ A;  5KLV H;  2I4M A;  2VWJ A;  1ATI A;  3B77 A;  4HVC A;  1DLB A;  1ASY A;  5EIB C;  2Q6A A;  2QDO A;  2O57 A;  3P8V A;  1N33 O;  1EBO A;  4P3O A;  1K8A W;  2QKA A;  4UCV A;  1VF6 C;  3HKB B;  1Y74 A;  3OGC C;  3OUS A;  4NXN B;  3K5O A;  2AW9 A;  5A2Q N;  3A5Y A;  1WQ7 A;  2H94 A;  4CH5 A;  4WFH A;  1Y76 B;  1GM7 A;  3T1H B;  1EN5 A;  3ZRX A;  4EKW A;  1GMG A;  4KUM A;  2LJ2 A;  2PZS A;  5LMN O;  3K3W A;  4YPF A;  3VQY A;  5LXT B;  2Q9L A;  2CJB A;  3OW2 U;  3P8T A;  4H2Y A;  3EVK A;  5KMG B;  1DF5 A;  1N34 O;  1XNR O;  1UFI A;  4JI2 O;  4DQ2 A;  3O65 A;  5BMV A;  4GKK B;  4AI8 A;  4TV8 B;  5FPR A;  2QHU A;  3UCS C;  3CC2 V;  3UO3 A;  1Q6I A;  4I50 B;  4B3R O;  4TV9 B;  3ABT A;  1FAF A;  1F7Y A;  1KOG A;  1FFT B;  4YXW G;  3HB3 B;  3K5N A;  5EC2 C;  4LBE C;  4XTZ A;  4LH7 A;  5IJ0 B;  3LDE A;  4YJ3 A;  1B7Y A;  3RGL A;  4P3P A;  3BA9 A;  5LMU O;  4WFE A;  4X5O A;  1G5H A;  3G1Z A;  5L3C A;  4G85 A;  4LR3 A;  2D2C B;  1W59 A;  4MS2 A;  4GKJ B;  1RFY A;  4FM1 A;  2A9H A;  5EBM C;  4H2V A;  3ASN B;  1MG1 A;  4FLT A;  4OGQ B;  4P75 C;  1FJG O;  5HGQ A;  1H2L A;  2DTO A;  2QWQ B;  4U3J A;  1NJ2 A;  1QR9 A;  1XL4 A;  1WP8 A;  3QG5 A;  4Q20 A;  2QA4 V;  1VQN V;  1ZWI C;  4YY3 O;  4CC6 A;  4DV4 B;  1US6 A;  3CC4 V;  2RHQ B;  5IYB O;  4YRE A;  1PL0 A;  2YEV B;  1XMO B;  4LFA B;  1YGB A;  5J2T A;  1NH2 D;  1RP3 B;  3C3T A;  4R6Z A;  2QM8 A;  2OT5 A;  2UUC O;  1G5I A;  3CMQ A;  4UV8 A;  2H3O A;  3JAM N;  1OJH A;  3H9V A;  4TTV A;  5CA1 A;  1N9W A;  3A5Z A;  1BZK A;  3FD9 A;  4JI7 B;  2GTA A;  5KUM A;  4DV0 O;  2UXB B;  3OEE G;  2HP8 A;  5JJN B;  3BPZ A;  1SET A;  4R8C A;  4H2W A;  3MF1 A;  2PME A;  1Q8I A;  1SQX H;  1KKC A;  2C8M A;  4HYO A;  2ZZE A;  1GAX A;  4PDR A;  2PYL A;  1WNL A;  4F6R A;  4JI5 O;  3OMN B;  1EIY B;  2ZNI A;  1MSW D;  3UGT A;  1TUB A;  4X9Q A;  1R6T A;  1W0J G;  2BOB C;  4ZOL B;  1XHZ A;  3JD3 A;  3CSX A;  4BIZ A;  4LF7 O;  2ZNJ A;  1FPO A;  4XTU A;  1QU7 A;  1XNQ O;  2XAS A;  2XTI A;  1FFX A;  1H2G A;  3AEI A;  2WLI A;  1NR7 A;  2FL4 A;  1Q6H A;  3C3S A;  1HC7 A;  3FX7 A;  1PNL A;  4QNH B;  2HLD G;  1QLN A;  1QLE C;  3JAK A;  4JV5 O;  2WLL A;  4DV6 O;  4LH6 A;  3A7R A;  4OXS A;  2FYU H;  4UXN A;  1N33 B;  4CZZ A;  1XHX A;  2E64 A;  4YRF A;  2RHS A;  3CRM A;  2XOK G;  4UVC A;  2P4V A;  4KR3 A;  1XUQ A;  1AJN A;  4J9Y B;  2XND G;  2ETN A;  3HKC A;  4XDJ A;  3K58 A;  2IU3 A;  1WA8 A;  2Q7E A;  5EBL C;  5IJ9 B;  5C52 B;  1SA0 A;  4E51 A;  2NNU A;  4O4L B;  1PYS A;  3A8T A;  3L4G A;  4JI0 O;  2OTJ V;  1OZ0 A;  3RYI A;  4DV1 O;  4G28 B;  4CS2 A;  4QJF B;  1WNS A;  4JI4 O;  4WFB V;  5LMN B;  2DN9 A;  2ZXF A;  5IT9 N;  2AKW A;  5EC1 C;  2EIK B;  4HNA B;  2DDZ A;  3IGA C;  4DR5 O;  3LC0 A;  2Q73 A;  1N34 B;  2WA4 A;  1NKD A;  1YFT A;  1XNR B;  3JD4 A;  4JI2 B;  3AG4 C;  1VAR A;  2F93 B;  2F95 B;  1S76 D;  2KB1 A;  3NXS A;  3V8J A;  2Z5U A;  4GX5 A;  4O4J A;  4YJ2 B;  4B3R B;  3RKY A;  5HFL A;  3UKM A;  3LDD A;  1IDS A;  5IY5 C;  4FM2 A;  1TUE B;  2QSA A;  3OD1 A;  4UP8 A;  4AH6 A;  3AG2 B;  2DYR C;  5LMU B;  4X1K A;  4YIP A;  2BTQ B;  3TEG A;  3NEL A;  4DUY O;  3K08 A;  3OAA G;  2Y0P A;  1OCZ C;  3RGB A;  4FK5 C;  2JDI G;  2OIE A;  1FJG B;  1ZSP A;  4MVO A;  1BE3 H;  4JI6 O;  4JTA B;  2Q0O C;  1MAB G;  4LCU C;  3MDS A;  5AG2 A;  4WBN B;  3TXS A;  4X88 A;  3ZRS A;  2CJA A;  1NTM H;  2M7W A;  1V54 C;  3VQX A;  1KBH A;  4YY3 B;  2XT9 A;  4BWA A;  4MTX A;  4LVJ A;  3SJQ C;  2Q5H A;  4H2T A;  3RYH B;  1P84 F;  1QNM A;  3L2Z A;  1WQW A;  1NYR A;  2CGN A;  3NR7 A;  5L3D A;  1AI4 A;  3L9D A;  1L0W A;  4LVI A;  1XQ8 A;  5J9P C;  2UUC B;  2DYS B;  2Z0A A;  2VS0 A;  1ZTE A;  2Y48 A;  1JJC B;  1BL8 A;  5E3I A;  3K57 A;  5BR8 O;  1IVS A;  3QO7 A;  4DYL A;  4J41 A;  3FKS G;  2EX3 A;  4IHJ A;  4YHH O;  4DV0 B;  3HRK A;  2EIM C;  1UJW B;  3FB7 C;  2BSK A;  1PNM A;  2ZTG A;  1FD9 A;  4DV3 O;  4GUN A;  1GN3 A;  2OCH A;  2Q68 A;  1AIL A;  4H2X B;  5CA0 A;  3RF1 A;  4JI5 B;  2EIN B;  1NJ1 A;  2FYK A;  1GTO A;  4RWU A;  4JYA O;  3HKD A;  2CIM A;  3D36 A;  2QKS A;  4FFB B;  2JRI A;  4XDL A;  4CS4 A;  1WPX A;  4LF7 B;  1L0L H;  4H13 B;  4GCZ A;  1S5L Z;  1JFF A;  4WFA V;  4HA8 A;  1XNQ B;  1X54 A;  4TUY B;  5F5W A;  2HHH O;  2YIC A;  4UV9 A;  3J7A U;  2J3M A;  2OCC B;  1NJ8 A;  4U3F H;  1JJO A;  2UXC O;  2AHY A;  2PTM A;  4JV5 B;  3BA8 A;  1M56 C;  3NET A;  4DV6 B;  3W7W A;  1KYO F;  2P06 A;  5IWA O;  1HTT A;  1ADY A;  2Q8V A;  5KX5 B;  2OTL V;  1OCO B;  3V7R A;  1PD3 A;  4X20 B;  1CXZ B;  1USY C;  1BGY H;  2ZT5 A;  1AP6 A;  1HW7 A;  3P32 A;  5CB4 B;  1VIB A;  2BCC H;  2E74 B;  2EIJ C;  1GRJ A;  2EAY A;  1DK1 A;  1JOY A;  4G27 B;  2JGD B;  2W0F C;  1FKA O;  4JI0 B;  2JGU A;  3G6B A;  4DV1 B;  5LOV B;  3H01 A;  4X64 O;  4JI4 B;  1SQG A;  1NYQ A;  1U96 A;  2WLK A;  2RN9 A;  3K59 A;  5EYP B;  5LGU A;  3OGI B;  2R72 A;  4DR5 B;  3RW0 A;  2LW1 A;  1EVL A;  4A5U B;  4B3T O;  3W3S A;  1ZX3 A;  1PPJ H;  1DF4 A;  1GN2 A;  1WP7 A;  2VRZ A;  1RSO A;  4I7Z B;  2IY5 A;  4RUF A;  4LP8 A;  4XEM A;  4LF4 O;  2EL9 A;  4K86 A;  4PHZ A;  3E9H A;  2GTS A;  3WB0 A;  3W7X A;  4D7T A;  1I94 O;  4IT5 A;  1XL6 A;  4DK1 A;  4E4E A;  4EX5 A;  2HJF C;  3D36 C;  3X2Q B;  5LHG A;  2P4K A;  3K9S A;  3KFU A;  2EZO A;  5C93 A;  4DUY B;  3ZHT A;  1VQ7 V;  1LUV A;  4O4I B;  1HXD A;  3R07 A;  2PYJ A;  5DN6 G;  3HXW A;  1OV9 A;  4JI6 B;  4UVA A;  2I4O A;  5J2U A;  3CE2 A;  3DTU B;  3AG3 C;  4DRX B;  2G4C A;  4HWP A;  4FLU A;  4LNS A;  1Z7N A;  4LWS A;  3K03 A;  4P3N A;  1VMG A;  1X55 A;  2ADP A;  1NT2 B;  3QVN A;  1P7G A;  4HWR A;  1VF5 B;  2XAF A;  4X1Y A;  3IG2 A;  2CGO A;  2V1D A;  3ABL C;  4TVA A;  3V8K A;  2QM4 A;  4PA3 A;  4PA6 A;  4UCO A;  5FL7 G;  2JS5 A;  4XU3 A;  3H1J H;  3RYF A;  4FLY A;  4BW9 A;  2QHS A;  4FFK A;  5JH7 B;  2EUL A;  4JAV A;  5BR8 B;  4MVR A;  3SPG A;  2UUA O;  2OYQ A;  1Z7M A;  5H2F Z;  4XBF A;  4YHH B;  3Q4H B;  3UT5 B;  3QO8 A;  5KA6 A;  1SF9 A;  4RAI A;  4CBC A;  2ALY A;  3E22 A;  4O2B B;  3E8B A;  3W7S A;  1RIQ A;  4DV3 B;  1SKV A;  5IDJ A;  2ZCE A;  2W0X A;  1S0V A;  4JI8 O;  5LYJ A;  3BFM A;  1X01 A;  2CUG A;  2RNB A;  3JAL B;  1XBL A;  3HXX A;  4I55 B;  4FLX A;  1P49 A;  3A7A A;  3KKY A;  3V8L A;  5LHH A;  4YYE A;  3OTO O;  3LSQ A;  2R9I A;  4JYA B;  2LFR A;  4ASU G;  1P4R A;  4MVQ A;  3STZ C;  1SQF A;  2MK3 A;  3TEH B;  4YCV A;  3ZMZ A;  1ZL8 A;  3M99 B;  2AZ2 A;  3ETQ A;  3CCR V;  3P8Y A;  4H2U A;  3ZHQ A;  2G38 A;  2YID A;  2ITC C;  2DVE A;  3SJB C;  4HBN A;  4P72 C;  2ZE8 A;  4RUE A;  2HHH B;  4J9Z B;  4Q6G A;  3A0B Z;  2IW5 A;  1E79 G;  2UXX A;  3RUX A;  1NNH A;  2UXC B;  4B3M O;  3MEY A;  1MOF A;  2ARU A;  2JIZ G;  4J7K A;  3W7T A;  5IWA B;  1E1Q G;  2ZZF A;  1YFR A;  5L3F A;  5LL6 Y;  3FAV A;  4B3S O;  4EB6 A;  3BRC A;  5BMV B;  2F23 A;  2X6A A;  3SGI A;  5B1O A;  1KB9 F;  5L3B A;  2RCV A;  2P90 A;  4UB6 Z;  3P30 A;  1I0H A;  4WFF A;  2Q7G A;  3DXR A;  2DKG A;  2P6J A;  2Q7H A;  3VQV A;  5C8Y A;  5TIS Z;  1AJQ A;  1MNG A;  2HEP A;  1WPY A;  4DR3 O;  1B7Y B;  3RAC A;  3ZMS A;  3HPL C;  1N32 O;  3JSL A;  3ZHU A;  4X64 B;  3UM7 A;  4ZHQ A;  5KAI Z;  4QIW F;  3B40 A;  3M7M X;  3EFR A;  4YCW A;  4BAY A;  3AK1 A;  3EFS A;  5KHJ A;  4B3T B;  1QLE B;  2F43 G;  2WAM A;  4ABM A;  3OE7 G;  2CAZ C;  4U3J B;  4LF4 B;  2WA3 A;  5C51 B;  1K34 A;  1GM9 A;  3SPJ A;  3OR6 C;  4KL1 A;  1GN6 A;  4TT3 G;  1JJ2 U;  4LNU A;  2EJG A;  1Q81 W;  1I94 B;  1H2S B;  4N21 A;  4RQE A;  4PDV A;  3G6E V;  5GW7 A;  4ZI7 A;  1G4Y B;  2EWN A;  5J2T B;  5HFM A;  2QWR B;  3OTF A;  4B7K A;  2E65 A;  2Q5I A;  1K5Q A;  2Z3Y A;  5B1B C;  4XTX A;  1HWY A;  4PDL A;  3TET A;  4FLV A;  3JAR A;  5E1A C;  5B5E Z;  4PD4 F;  5CA1 B;  1TGO A;  4PJ0 Z;  3L71 H;  1M57 C;  4NR1 A;  4NTX A;  1X2H A;  2JEU A;  1K97 A;  4I5S A;  2YXL A;  3AG4 B;  1M93 A;  4J11 A;  1BCC H;  3ZRW A;  4LVK A;  4H37 A;  2Y69 B;  4JAU A;  5IY5 B;  3MD0 A;  2F66 C;  4PA4 A;  1NH2 B;  2EJF A;  4P2Z A;  1YDX A;  3L73 H;  4XU1 A;  3E35 A;  2DWD C;  3H1K H;  1TUB B;  4NKG B;  3S3W A;  2A8E A;  2DYR B;  4J10 A;  2DE0 X;  4RDX A;  1LNQ A;  4YRR A;  1BQ0 A;  1F4M A;  4B08 A;  3HFV A;  4JZ2 A;  2UUA B;  1QVF U;  4XTV A;  4LVM A;  2PGG A;  3UO2 A;  4YRC A;  1H2K A;  4JYC A;  3HKE A;  1M5I A;  3WB1 A;  1FFX B;  3GWO A;  1B06 A;  1G1X B;  2VWK A;  4JI8 B;  3CEI A;  3ASO C;  3CJH B;  1O9G A;  3WG7 C;  1N0N A;  4IIJ A;  1V54 B;  4GYC B;  2A79 B;  2WLL B;  1SQB H;  4JGS A;  4UFZ A;  3ZS8 C;  5LXT A;  3RKW A;  2UUB O;  5ITZ A;  3G71 V;  1J5W A;  4GX1 A;  1SES A;  4KP4 A;  3OTO B;  4DR7 O;  1H8E G;  2VQF O;  5KMG A;  2P7T C;  4YRJ A;  2HG5 C;  3ZBH A;  2CE4 A;  4TV8 A;  2RHS B;  4U7O A;  1J95 A;  1URF A;  1B04 A;  2ZDI A;  4TV9 A;  3WQZ A;  1M9N A;  3K0G A;  3HKC B;  4EFB A;  2AMC A;  1WA8 B;  1YZB A;  1SA0 B;  1PYS B;  3L4G B;  4I9W A;  4B7E A;  4B3M B;  1PV0 A;  3RYI B;  4DW0 A;  4O2D A;  2EIM B;  4YRI A;  1K4D C;  3JAT B;  3OM3 B;  2YS8 A;  4H02 A;  4MVS A;  2AKW B;  1B70 A;  3E9I A;  3OEH G;  3AG7 A;  1QHT A;  4K35 A;  4GZR B;  1I7F A;  3RL6 A;  4B3S B;  3V7S A;  2GSM B;  3L75 H;  3AG1 C;  4O4J B;  1AR4 A;  2XAQ A;  1NS1 A;  1JQ0 A;  4X66 O;  2CH7 A;  2L6L A;  3LNM B;  3B4S A;  2V7Q G;  4O4H A;  4DR3 B;  2CK3 G;  2XTA A;  1N32 B;  1D2D A;  4K8X A;  3HFZ A;  4X1K B;  1SZX A;  4PHC A;  5FLX N;  5LHI A;  2YXY A;  3SYO A;  1H2M A;  1BHB A;  2Q5Z A;  2VQE O;  4PDM A;  4G84 A;  2DWE C;  2E5A A;  1VQZ A;  4F4L A;  1VP7 A;  3K0D A;  3G4S V;  3QO5 A;  2DW4 A;  1QE0 A;  1ADJ A;  4HAM A;  3GVM A;  2BOC C;  1TVK B;  2WLH A;  2HNI A;  3JYC A;  2Y4U A;  4XU2 A;  4PI2 A;  1S5H C;  3FYI B;  4Z2W A;  1H4V B;  3SPI A;  3BVO A;  3A0R A;  3TXQ A;  4NTW A;  1EIY A;  4MTG A;  1LYL A;  3JAS B;  2ZDI C;  1COW G;  4ZOL A;  4ZIB A;  5JVD A;  3MF2 A;  2E3C A;  2HR3 A;  1E1T A;  2ILM A;  1Q43 A;  5L3G A;  3ZX6 A;  4LF5 O;  4MTO A;  3CMA V;  4OPA A;  3RVY A;  1H4Q A;  1HNZ O;  5B3S C;  4IHJ B;  1OCC B;  2WLJ A;  2BSK B;  3IAL A;  4TQD A;  2YI9 A;  4L8J A;  1AB3 A;  2IJI A;  1PP9 H;  3KG2 A;  4GX2 A;  4IYI A;  1IXM A;  3FJP A;  1Q7Y W;  2QE7 G;  3J81 N;  3HXU A;  4LC1 A;  2YUA A;  3THO A;  2GUZ B;  3HKD B;  3ZMT A;  1OCR C;  3IJ4 A;  5KHG A;  1O9H A;  1U97 A;  4DV5 O;  3HXV A;  1Z5W A;  1JFF B;  3ZN1 A;  2NN4 A;  5IJ9 A;  2ZGW A;  2DU7 A;  1E24 A;  1THZ A;  4XDK A;  2CGH A;  4K3A A;  1VQP V;  3KCY A;  3AG3 B;  2NR5 A;  4FJC C;  1YJ9 V;  3C90 A;  3RYC A;  1Z2G A;  5KHI A;  3D3Q A;  3PJS K;  3HY0 A;  4WJ3 M;  2EBO A;  3QNE A;  2V4D A;  2UUB B;  1SC5 B;  3CWB H;  1D5N A;  4DR7 B;  2VQF B;  3TJT A;  5KHK A;  2PMF A;  1NVP D;  3OMI B;  2C7I A;  4X1I B;  1XMQ O;  1E22 A;  4TVW A;  2PI4 A;  4YJ2 A;  3ABL B;  1GM8 A;  1YJW V;  1MZF A;  1UPG A;  3A7U A;  3CME V;  1N36 O;  4JYY A;  1RPO A;  1CEZ A;  1E1O A;  3G80 A;  2I4N A;  4JYB A;  2HVK C;  5B66 Z;  4LF8 O;  2JEX A;  3SPC A;  5A9G A;  1F51 A;  1L0N H;  4P9P A;  3GB7 C;  1EZJ A;  1N0J A;  1HNW O;  2R9R B;  3B2E E;  3CCE V;  1IZ3 A;  3LNN A;  3EXA A;  3EFF K;  3HRI A;  3ZN0 A;  1EFW A;  4JAS A;  3JD1 A;  1KU9 A;  1RSO B;  3ZHS A;  3ZRV A;  2IY5 B;  3N2K B;  3CRR A;  4R50 A;  5EK0 A;  1FXK B;  2GBO A;  4X66 B;  3RKX A;  4Q15 A;  4YDQ A;  4FMT A;  2EZP A;  4G2K A;  4U7N A;  1IXB A;  5JQG A;  1IBK O;  3N2G A;  1YB3 A;  1V55 C;  2BTO A;  2N04 A;  1V9P A;  4FM0 A;  3SJA C;  1WB8 A;  4X65 O;  2YIA A;  3ZJZ A;  3STL C;  4UP9 A;  2WWW A;  2B5U A;  3DGE A;  2R9A A;  1N4C A;  4JI3 O;  3V7C A;  1SRY A;  5GON A;  2YI8 A;  2IJK A;  2DTH A;  4P71 A;  5ELN A;  4PA7 A;  4UUJ C;  2ZM6 O;  2VQE B;  4ICG A;  2RDC A;  5GTI Z;  4J7Z A;  5J2U B;  1YTF D;  4OX9 O;  1BHA A;  1EQR A;  1GGM A;  1ARO P;  1WYD A;  2ZKO A;  3NEN A;  1BBW A;  3L72 H;  3K04 A;  4NXM O;  4PV1 B;  4LWS B;  1IBM O;  3M4P A;  4I4T A;  4YRO A;  3CCQ V;  3TCU A;  2KG7 A;  1EFR G;  2E10 A;  3LDC A;  4H2X A;  2P5O A;  3E2E A;  3ABM C;  1SER A;  4MTF A;  3APQ A;  4TVA B;  1WB7 A;  5LA6 A;  5EZY B;  4JPR A;  4FFB A;  4NVP A;  2P22 C;  2YC0 A;  4LF5 B;  3ML0 A;  3FB6 C;  1DGS A;  1HNZ B;  3WB2 A;  5JJE B;  4JF3 A;  2KQX A;  4DXW A;  2IH3 C;  3DSQ A;  4FZ0 A;  4X89 A;  5H5N A;  2WPD G;  3E22 B;  2ARH A;  3D8C A;  5B1A C;  2FML A;  3RT3 C;  3H1I H;  3P3N A;  4GX0 A;  1P7B A;  5LYJ B;  4DR6 O;  5ELO A;  1YJN V;  3L74 H;  3B09 A;  3J80 N;  1GN4 A;  2KKW A;  2LP7 A;  1CP9 A;  3WU2 Z;  1SS3 A;  2UU9 O;  1G8M A;  3E83 A;  4AIL C;  2LO1 A;  3L1A A;  4JTC B;  2DJV A;  1SQQ H;  2Y0I A;  4X20 A;  5CBH A;  4GLX A;  2ZXW C;  3BAB A;  4DV5 B;  4TOI A;  3HR0 A;  1GO3 F;  4NB5 A;  5B1B B;  4TSF G;  2X0L A;  1NBM G;  3IFX A;  2ZR2 A;  1TA8 A;  2YDE A;  4C7U A;  3ZCC A;  4FVM A;  4FZ1 A;  2YSU B;  2A7W A;  2K9P A;  2JJ2 G;  5LOV A;  3BY6 A;  4P71 C;  1M57 B;  1XDC A;  3REU A;  3ICX A;  4H44 B;  2JVD A;  1VQ8 V;  12AS A;  1YIJ V;  2HKO A;  4KFM A;  3U0Z A;  4ZTZ B;  4W4K A;  3CRQ A;  1S77 D;  2DJZ A;  5LGN A;  1BQZ A;  2X6C A;  4EB6 B;  1XMQ B;  3ERR A;  3MHS C;  3RFR A;  3FB8 C;  1JMK C;  4UB8 Z;  2DOS A;  5JCO A;  3IAY A;  2DQ3 A;  1M1K W;  1N36 B;  4MT8 A;  1ROP A;  2YIB D;  4XTY A;  4J80 A;  1VF6 A;  3PCO B;  5C8Y B;  2IBZ H;  1X2G A;  4NYK A;  2QGN A;  4LF8 B;  1VEW A;  2ATK C;  4K88 A;  2EIL C;  5DED A;  1GH6 A;  3NEM A;  4JZG A;  4ZHQ B;  4UCU A;  1AI5 A;  1HNW B;  5LP6 A;  2YXH A;  1Y74 B;  1BMF G;  3MHH C;  5IYC O;  1KD1 W;  4DR4 O;  2FTK A;  4DW1 A;  3UFG A;  3ASO B;  2AXT Z;  3WG7 B;  4FLZ A;  4GT1 A;  3T1Y O;  1ZLZ A;  5H6Q A;  4DRX A;  5L3E A;  4LF6 O;  4F6E A;  1VQK V;  1JPX A;  3CB2 A;  4J15 A;  1VQ6 V;  2NLJ C;  3JAW A;  2YIB A;  3VBB A;  4LNU B;  3H1H H;  4CH6 A;  4YCU A;  3E86 A;  1VQ5 V;  4QE9 A;  1OCO C;  2M6Y A;  4ZI7 B;  1IBK B;  3E8H A;  3CCV V;  4X65 B;  1S72 V;  3DC5 A;  1RM1 C;  4JI3 B;  4UCR A;  1YIT V;  2Q67 A;  2JJ1 G;  2JK5 C;  5FNV A;  1EM1 A;  2J3L A;  5CA3 A;  4YRG A;  5JH7 A;  3JAR B;  2ZM6 B;  2E76 B;  4MVM A;  1C0A A;  2PI5 A;  3HXZ A;  4H2S A;  4YJ3 B;  4OX9 B;  3UT5 A;  1S3J A;  2Q69 A;  1Q90 D;  1SQP H;  4W4L A;  4O2B A;  4NXM B;  4N23 A;  1IBM B;  3CHX A;  4KR2 A;  4KHP O;  2WLM A;  1VQM V;  3ZRW B;  3AG1 B;  1QR8 A;  1J5E O;  3CCS V;  2D3O W;  3LSU A;  1X56 A;  1NJ5 A;  4E2L A;  4QPJ A;  3ZMU A;  2DTI A;  2BE3 A;  5JCO C;  3VOU A;  2UXD O;  2ODR D;  2RJZ A;  1AVM A;  3APO A;  2IJJ A;  3PN1 A;  1SQV H;  4I0X A;  3TEH A;  3K9A A;  1AJP A;  2P5I A;  1NU1 H;  3CS5 A;  3T4Z A;  2HJD A;  3JSN A;  4X8A A;  4TQF A;  3TUP A;  3SYA A;  4YRT A;  5KHH A;  2IU0 A;  3X2Q C;  4XU0 A;  1Q5O A;  1G6U A;  4AQY O;  3HKE B;  4K8Z A;  3IKM B;  1K5S A;  1WAZ A;  5LP6 C;  1W66 A;  1BIA A;  3U11 A;  2ZIN A;  5DM6 V;  2GDS A;  4LFC O;  4DR6 B;  3BCC H;  2FB5 A;  1Y66 A;  2ZIM A;  4IIJ B;  3BEH A;  5LBQ A;  5IYZ A;  3M4Q A;  2F1M A;  1XI1 A;  2ADQ B;  5ITZ B;  2QWO B;  1KMM A;  1K4C C;  2P0L A;  3SDL A;  1WLE A;  5EBW C;  2UU9 B;  1X59 A;  3S3X A;  1IUR A;  2ZZG A;  4XEO A;  3M8A A;  4FLW A;  3K5L A;  5K1X A;  1ZUQ A;  3ABK C;  1HDJ A;  4WCE V;  5GTH Z;  2AMC B;  2WSS G;  2QTS A;  4O2A A;  1BIB A;  1LR1 A;  4F6R B;  4R7C A;  1PNK A;  3FB5 C;  4YRL A;  1R6N A;  4HWS A;  1KMI Z;  1L8D A;  4WI1 A;  4CH4 A;  5B3S B;  4BIO A;  1XEQ A;  4NCX A;  1B76 A;  3SR2 C;  1Y6X A;  3HKB A;  1ASZ A;  4H33 A;  3ZIA G;  3F5T A;  1Q3E A;  2LQT A;  1B70 B;  2IH1 C;  1H38 A;  3I7F A;  2PY5 A;  3ZMV A;  1SZT A;  1OCZ B;  1GK9 A;  2WLI B;  3GWK C;  1Y76 A;  2LGW A;  2QKC A;  1QF6 A; 
#chains in the Genus database with same CATH homology
 2EAY A;  1M4U A;  3IAL A;  4TQD A;  2YI9 A;  4L8J A;  5D5Q A;  2CJ9 A;  1S5J A;  3JAK B;  3UH0 A;  4JI0 B;  2JGU A;  4KQE A;  3VQW A;  4DV1 B;  5LOV B;  2IM9 A;  4JI4 B;  4O4H B;  1SQG A;  1NYQ A;  3FJP A;  3K59 A;  2DEQ A;  2DQ0 A;  5EYP B;  3A32 A;  3HFZ B;  3HXU A;  4CH3 A;  2R72 A;  4DR5 B;  2RQ6 A;  3THO A;  1EVL A;  3W3S A;  4I50 A;  5IYZ B;  3HKD B;  4YRK A;  4DR4 B;  5KHG A;  1RSO A;  2IY5 A;  3QF7 A;  5D5P A;  1O9H A;  4XEM A;  2EL9 A;  3HXV A;  3T1Y B;  3FFQ A;  1NJ6 A;  4K86 A;  1Z5W A;  1JFF B;  4PHZ A;  5IJ0 A;  4P75 A;  2DXT A;  3E9H A;  4LF6 B;  4HWT A;  5IJ9 A;  3WB0 A;  2ZGW A;  3RIR A;  2DU7 A;  4D7T A;  1E24 A;  4DK1 A;  3JAL A;  2CGH A;  1EOV A;  4YRM A;  4I55 A;  4EX5 A;  2DU5 A;  4P74 A;  3PCO A;  4O2A B;  2ODR C;  4DV2 B;  2I4M A;  3RYC A;  2VWJ A;  4YRQ A;  1ATI A;  3KFU A;  5KHI A;  4HVC A;  1ASY A;  3HY0 A;  5EIB C;  4DUY B;  4WJ3 M;  2UUB B;  2V4D A;  3BJU A;  3QNE A;  4O4I B;  3P8V A;  1HXD A;  4P3O A;  4DR7 B;  2VQF B;  4UCV A;  2PYJ A;  5KHK A;  3R07 A;  3HXW A;  3HKB B;  2PMF A;  4JI6 B;  5JVD B;  2I4O A;  2C7I A;  1T5E A;  4X1I B;  5J2U A;  4DRX B;  1E22 A;  2G4C A;  4TVW A;  4NXN B;  3K5O A;  4FLU A;  4HWP A;  4YJ2 A;  2RHQ A;  3A5Y A;  4LNS A;  1Z7N A;  3A7U A;  1WQ7 A;  5FPO A;  1E1O A;  4CH5 A;  4XTW A;  2I4N A;  2OWO A;  4P3N A;  1X55 A;  3T1H B;  1NT2 B;  2PZS A;  4HWR A;  4X1Y A;  4KHP B;  3IG2 A;  4YPF A;  3VQY A;  5LXT B;  2DZC A;  1J5E B;  2CJB A;  4EEQ A;  3P8T A;  4H2Y A;  4TVA A;  2QM4 A;  3V8K A;  4UCO A;  5KMG B;  2JS5 A;  3B2E E;  4XU3 A;  3RYF A;  4FLY A;  4DQ2 A;  3LNN A;  3HRI A;  2UXD B;  5BMV A;  4BW9 A;  2QHS A;  4YRS A;  4GKK B;  5C53 B;  4TV8 B;  5FPR A;  5JH7 B;  2QHU A;  4I50 B;  5BR8 B;  1EFW A;  4TV9 B;  1KOG A;  2OYQ A;  1Z7M A;  1KU9 A;  2IY5 B;  3K5N A;  4YHH B;  1WPB A;  3N2K B;  3UT5 B;  3K5M A;  3QO8 A;  4XTZ A;  4OLF A;  2ALY A;  4DK0 A;  4LH7 A;  4PI0 A;  5IJ0 B;  3E22 A;  4O2B B;  4YJ3 A;  1B7Y A;  2ZT7 A;  3RGL A;  1RIQ A;  4P3P A;  4DV3 B;  1SKV A;  3BA9 A;  4X66 B;  4Q15 A;  4X5O A;  2ZCE A;  1G5H A;  3G1Z A;  4G85 A;  3RKX A;  4YDQ A;  4AQY B;  5LYJ A;  4LR3 A;  1X01 A;  3BFM A;  3JAL B;  3HXX A;  5JQG A;  4GKJ B;  4I55 B;  3N2G A;  1P49 A;  4FLX A;  1YB3 A;  3A7A A;  2BTO A;  1X4T A;  1V9P A;  4FM0 A;  4LFC B;  3SJA C;  4FM1 A;  2E41 A;  2YIA A;  3V8L A;  4H2V A;  3RYC B;  3JAT A;  4YYE A;  3LSQ A;  4JYA B;  4YRN A;  4FLT A;  4UP9 A;  2R9A A;  3UQ8 A;  4P75 C;  5HGQ A;  1SQF A;  3V7C A;  3TEH B;  1SRY A;  5GON A;  4YCV A;  2DTO A;  1Z5V A;  2YI8 A;  4U3J A;  1KMN A;  1NJ2 A;  2DTH A;  4P71 A;  5ELN A;  2VQE B;  3ETQ A;  3P8Y A;  4H2U A;  3QG5 A;  2DVE A;  5J2U B;  4P74 C;  4CC6 A;  4DV4 B;  1EQR A;  3SJB C;  1GGM A;  4HBN A;  4P72 C;  1WYD A;  2RHQ B;  3RWR D;  3NEN A;  2HHH B;  1BBW A;  4Q6G A;  4YRE A;  1XMO B;  4LFA B;  3M4P A;  4I4T A;  5CA0 B;  4YRO A;  1YGB A;  5J2T A;  3RUX A;  1NNH A;  2E10 A;  2UXC B;  3MEY A;  4H2X A;  2P5O A;  2ARU A;  5IWA B;  4P73 A;  1SER A;  1G5I A;  3CMQ A;  2ZZF A;  1YFR A;  4TVA B;  5LA6 A;  5EZY B;  1ZAU A;  4FFB A;  2QHT A;  4EB6 A;  4TTV A;  3BRC A;  5CA1 A;  4NVP A;  5BMV B;  1N9W A;  2P22 C;  3A5Z A;  4EFE A;  4LF5 B;  3SGI A;  4JI7 B;  3HXY A;  2UXB B;  3MQZ A;  4OP0 A;  5JJN B;  1DGS A;  3BPZ A;  1HNZ B;  4O4L A;  3WB2 A;  5JJE B;  1SET A;  4H2W A;  2NS6 A;  3MF1 A;  2PME A;  1Q8I A;  2Q7G A;  2DKG A;  1WN7 A;  3LSS A;  2Q7H A;  3VQV A;  2C8M A;  5C8Y A;  2ZZE A;  4UPA A;  3DSQ A;  2HEP A;  1WPY A;  3E22 B;  1G51 A;  4UP7 A;  2PYL A;  1B7Y B;  4CS3 A;  1TVK A;  4HWO A;  3RAC A;  1WNL A;  3JSL A;  4F6R A;  4X64 B;  5LYJ B;  1USY A;  4ZHQ A;  4HNA A;  2QJ1 A;  1EIY B;  2ZNI A;  3UGT A;  5JQG B;  5ELO A;  1TUB A;  1BBU A;  3M7M X;  3N2G B;  3EFR A;  4YCW A;  4ZOL B;  1XHZ A;  3CSX A;  2KKW A;  3JAS A;  3EFS A;  5KHJ A;  2ZNJ A;  4B3T B;  4YRP A;  4AIL C;  3L1A A;  4XTU A;  5GON B;  2CAZ C;  4U3J B;  4LF4 B;  4X20 A;  4GLX A;  2F4V B;  3BAB A;  11AS A;  4DV5 B;  5C51 B;  4PG3 A;  4TOI A;  2XTI A;  1FFX A;  4I9Q A;  2ZT6 A;  3UGQ A;  4DV7 B;  2I4L A;  4KL1 A;  2ZR2 A;  1TA8 A;  4LNU A;  2EJG A;  4HT4 A;  1I94 B;  1H2S B;  1HC7 A;  2QHV A;  4RQE A;  2BTQ A;  1B8A A;  4FVM A;  4ZI7 A;  3JAK A;  2EWN A;  2E5L B;  4I4T B;  4LH6 A;  5J2T B;  5LOV A;  3A7R A;  3OTF A;  2E65 A;  4P71 C;  3REU A;  4DR2 B;  2Q5I A;  3HTZ A;  3ICX A;  2JVD A;  4XTX A;  3REX A;  5KNN A;  12AS A;  1N33 B;  4YRF A;  1XHX A;  4FLV A;  2E64 A;  2EJ9 A;  2RHS A;  4LVL A;  4WBN A;  3JAR A;  3U0Z A;  4ZTZ B;  5LA6 B;  4KR3 A;  4TVY A;  2DJZ A;  3K58 A;  4EB6 B;  1YEW A;  3HKC A;  5CA1 B;  1TGO A;  1XMQ B;  3ERR A;  3RFR A;  1JMK C;  5JCO A;  1IL2 A;  3IAY A;  2Q7E A;  2E1H A;  5IJ9 B;  2DQ3 A;  1X2H A;  5C52 B;  1N36 B;  2YXL A;  1SA0 A;  4E51 A;  4O4L B;  1PYS A;  1M93 A;  2YIB D;  3RYH A;  4XTY A;  3L4G A;  4P73 C;  3PCO B;  1D5A A;  1VF7 A;  5C8Y B;  1X2G A;  4LVK A;  3RYI A;  4X62 B;  4CS2 A;  1WU7 A;  1WNS A;  4LF8 B;  5LMN B;  1TAE A;  2ZXF A;  2F66 C;  2EJF A;  4K88 A;  2AKW A;  3NEM A;  4L87 A;  4ZHQ B;  4XU1 A;  4HNA B;  2DDZ A;  1YFS A;  1JJC A;  3LC0 A;  4UCU A;  1N34 B;  1HNW B;  1TUB B;  5LP6 A;  1YFT A;  1XNR B;  2A8E A;  3PZC A;  4JI2 B;  4RDX A;  4TWA A;  3UFG A;  2F93 B;  2F95 B;  3U10 A;  3V8J A;  1HNX B;  4YRR A;  4FLZ A;  2ZT8 A;  4UCT A;  4O4J A;  4YJ2 B;  4B3R B;  3RKY A;  3HFV A;  4B08 A;  2UUA B;  4X1I A;  4FM2 A;  3MAQ A;  4DRX A;  4XTV A;  1EVK A;  4JI1 B;  2DZ9 A;  4LVM A;  2PGG A;  4YRC A;  3CB2 A;  4J15 A;  3OD1 A;  4UP8 A;  4AH6 A;  3HKE A;  1M5I A;  3WB1 A;  3JAW A;  1FFX B;  2YIB A;  1H4T A;  3VBB A;  5LMU B;  4LNU B;  1FYF A;  2VWK A;  4X1K A;  4X1Y B;  4CH6 A;  4JI8 B;  3QTC A;  4YCU A;  1O9G A;  2BTQ B;  3TEG A;  4IIJ A;  3A74 A;  4ZTU B;  4ZI7 B;  4GYC B;  1IBK B;  3NEL A;  4UFZ A;  4D7S A;  3ZS8 C;  5LXT A;  3RKW A;  4X65 B;  3RYF B;  5ITZ A;  1J5W A;  1SES A;  3OTO B;  4AHC A;  3RGB A;  4RMF A;  5KMG A;  4JI3 B;  5K1P A;  4UCR A;  1FJG B;  5FNV A;  4CC5 A;  2ZR3 A;  2J3L A;  4YRJ A;  4YRG A;  5JJJ B;  3A31 A;  4TV8 A;  5JH7 A;  4WBN B;  3JAR B;  4TUY A;  2RHS B;  2ZM6 B;  1B04 A;  4TV9 A;  2CJA A;  3WQZ A;  4WF2 A;  2ALY B;  1C0A A;  3HXZ A;  3HKC B;  3VQX A;  4H2S A;  4YJ3 B;  4YY3 B;  4OX9 B;  3N2K A;  4EFB A;  3UT5 A;  2AMC A;  4BWA A;  4O2B A;  4LVJ A;  1SA0 B;  4NXM B;  1PYS B;  2Q5H A;  2ZIO A;  4H2T A;  3RYH B;  1IBM B;  3CHX A;  4KR2 A;  3L4G B;  3L2Z A;  1WQW A;  4B3M B;  1NYR A;  3RYI B;  4K87 A;  4YRI A;  4O2D A;  4LF9 B;  3JAT B;  1L0W A;  3SJC C;  5KX5 A;  2ART A;  1XQ8 A;  1HR0 B;  1NJ5 A;  1X56 A;  4H02 A;  4LVI A;  2AKW B;  2UUC B;  4P72 A;  1B70 A;  2DTI A;  5JCO C;  3BAA A;  3BHP A;  2ODR D;  3E9I A;  1QHT A;  2RJZ A;  1JJC B;  1I7F A;  5E3I A;  3PN1 A;  3IKL A;  5LP6 B;  3RL6 A;  4RQF A;  3K57 A;  4B3S B;  3V7S A;  3TEH A;  5CB4 A;  3QO7 A;  3ZED A;  5EIB D;  2P5I A;  2EX3 A;  4IHJ A;  3JSN A;  4DV0 B;  3HRK A;  4O4J B;  4TQF A;  3TUP A;  4YRT A;  5KHH A;  1QQC A;  2ZTG A;  3HY1 A;  4XU0 A;  1Q5O A;  1G6U A;  3HKE B;  4K8Z A;  3JAW B;  4O4H A;  4DR3 B;  3IKM B;  4H2X B;  5LP6 C;  1W66 A;  1BIA A;  1N32 B;  4EO4 A;  5CA0 A;  3U11 A;  2PUS A;  2ZIN A;  5EYP A;  4K8X A;  4X1K B;  4JI5 B;  3HFZ A;  3RF1 A;  1H4S A;  1NJ1 A;  4DR6 B;  2FYK A;  2ZIM A;  4IIJ B;  4PHC A;  2XGT A;  5IYZ A;  3HKD A;  2CIM A;  3M4Q A;  2F1M A;  1XI1 A;  4FFB B;  5ITZ B;  4WJ4 A;  4CS4 A;  4LF7 B;  1KMM A;  2P0L A;  5EZY A;  2UU9 B;  4LFB B;  1WLE A;  4XEO A;  2ZZG A;  1JFF A;  5FNV B;  4G84 A;  3ICA A;  4HA8 A;  2E5A A;  4FLW A;  1XNQ B;  1VQZ A;  1X54 A;  4TUY B;  5F5W A;  3K5L A;  5K1X A;  4DR1 B;  3QO5 A;  1QE0 A;  1ADJ A;  2R70 A;  1TVK B;  2AMC B;  4YP0 A;  4O2A A;  1BIB A;  2XHB A;  2J3M A;  1NJ8 A;  4F6R B;  2HNI A;  2Q0A A;  1JJO A;  4YRL A;  4XU2 A;  4DUZ B;  4PI2 A;  2PTM A;  4JV5 B;  4HWS A;  3BA8 A;  1H4V B;  3NET A;  1KMI Z;  4DV6 B;  1L8D A;  3A2F A;  4WI1 A;  4DPG A;  4CH4 A;  1HTT A;  4O4I A;  2GV9 A;  1EIY A;  1IBL B;  1LYL A;  4NCX A;  1B76 A;  3JAS B;  3HKB A;  3SR2 C;  1ADY A;  1ASZ A;  5KX5 B;  4ZIB A;  4ZOL A;  5JVD A;  3MF2 A;  1Q3E A;  2E3C A;  1B70 B;  3V7R A;  1E1T A;  1Q43 A;  3I7F A;  4X20 B;  2ARS A;  2PY5 A;  1USY C;  2ZT5 A;  1HW7 A;  2DXU A;  5CB4 B;  1H4Q A;  4K0K B;  4IHJ B;  4UCS A;  1QF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...