3DSQA

Structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
278
Chain Sequence
PPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pyrrolysyl-tRNA synthetase
publication title Structure of Desulfitobacterium hafniense PylSc, a pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 80
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3dsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3dsqA02
4WJ4A 3FJPA 3HXVA 4P73C 2YIBA 4CH3A 2ZT8A 4YREA 2I4OA 3V8JA 2ZZEA 4HWSA 2RJZA 4YRIA 1JJCA 4P3OA 4G84A 4ZTZB 1ADYA 5C51B 2DVEA 2ZGWA 5HGQA 2AMCA 3L4GB 2R70A 4K87A 3LSSA 2EWNA 4YPFA 2PGGA 2YI8A 1NJ5A 4YRMA 3DSQA 4TWAA 3REUA 3P8VA 1B70A 4E51A 3A7AA 1BIAA 3IKMB 1HTTA 1KMMA 4Q15A 3VBBA 2Q7EA 2RHSA 2DJZA 2P5IA 2CJBA 2QJ1A 2DZCA 1X2GA 3A32A 3BFMA 4UP7A 3HRKA 5K1PA 3UH0A 1X56A 4XEOA 4TTVA 4YCUA 1SERA 3IALA 2PUSA 1NNHA 4H2UA 3LSQA 4CH4A 2FYKA 1EFWA 3QTCA 3L4GA 3VQYA 2ZCEA 1WQ7A 1LYLA 3EFSA 2ZIMA 1L0WA 2ZTGA 2E65A 4EO4A 1HC7A 11ASA 2RQ6A 3M4PA 2EJGA 1WPYA 3REXA 1H4SA 4G85A 1KOGA 2ZT5A 4YRKA 4HA8A 1X55A 3NENA 1Z7NA 1ASZA 3RGLA 2ARTA 4P75A 4XTUA 2QHSA 3VQWA 3R07A 1X54A 4XTVA 3ICAA 3V8LA 4XTWA 4UP9A 1EQRA 1ASYA 4KQEA 2PMEA 3QNEA 2ZIOA 2E10A 2Q7HA 4ZIBA 12ASA 1VQZA 4TVAB 2DXUA 2DU7A 1N9WA 5K1XA 1NJ2A 1WYDA 2I4MA 3RKYA 4YRJA 4H2WA 2HEPA 4PG3A 4RQEA 3HTZA 4P73A 1YFTA 4YRFA 2EL9A 4PHCA 2G4CA 4P74A 4HWOA 3NEMA 4OP0A 2DZ9A 4TVYA 1G51A 4RQFA 1YFRA 2Q5IA 4XU1A 5C53B 4UPAA 2DTOA 3OD1A 2J3LA 3L2ZA 4YROA 2EAYA 3ZEDA 1SRYA 3BHPA 4YRPA 3RL6A 3UGTA 4YRSA 4TVWA 3QO5A 2DQ3A 4TVAA 3TEHB 3KFUA 4P71A 1E24A 3HXWA 2RHQB 4ZTUB 4EX5A 2C7IA 1ATIA 3HY1A 1WLEA 3RF1A 4P72A 1H4QA 1WQWA 4UP8A 3QO8A 2DU5A 3E9HA 2ZZGA 3MEYA 3E9IA 1EIYB 4WJ3M 2HNIA 4YYEA 4BWAA 4YCWA 4KR3A 1GGMA 3HFZB 4H2TA 4HWRA 4NCXA 4HVCA 2XTIA 1QE0A 2Q7GA 4L87A 4P3PA 1E22A 3HXYA 1B76A 1WU7A 4DQ2A 5C52B 2ALYB 5F5WA 3HRIA 3RUXA 3P8YA 1NJ8A 4H2XB 3TEHA 4YRNA 3A7UA 2J3MA 4H02A 4YRTA 2RHQA 1B7YB 4WI1A 1X2HA 1WNLA 1E1OA 4XTXA 2EJFA 4YCVA 3HXUA 3HXXA 3M4QA 2E5AA 3A5YA 3MF1A 2DEQA 4Q6GA 3RKWA 1YB3A 3UFGA 2ARSA 1EIYA 3V7RA 3A74A 3IKLA 3TUPA 3V8KA 3PZCA 4BW9A 3HFZA 4CS4A 1NYRA 5KNNA 1BBWA 3CMQA 2ZZFA 4YDQA 1H4TA 2ALYA 3G1ZA 4H2XA 4CS3A 1BBUA 2ZR2A 3NETA 4YRLA 2E41A 2CJAA 1B7YA 3W3SA 2CIMA 4J15A 2XGTA 1PYSB 3P8TA 4AH6A 4YRGA 3VQVA 2ODRC 1USYC 1EOVA 4KR2A 2ZNIA 4TQFA 4DPGA 1O9HA 3QO7A 1NYQA 2DDZA 5ELNA 3L1AA 4P74C 1YFSA 1SETA 4O2DA 2ARUA 1E1TA 1HXDA 2ZT6A 4WF2A 3NELA 2ODRD 1RIQA 1C0AA 3A31A 2QHUA 4RDXA 4XEMA 4RMFA 3A7RA 2CJ9A 3BJUA 2AKWB 3A5ZA 2ZR3A 2DTHA 1EVLA 2YIBD 1B8AA 4P71C 1PYSA 1FYFA 4P3NA 3RACA 3ERRA 3HFVA 3TEGA 4LNSA 4H2YA 1YGBA 4P72C 1IL2A 2E64A 3VQXA 2DXTA 1W66A 1ADJA 2IY5B 1G5IA 3LC0A 1H4VB 2P0LA 4XU3A 4X5OA 4YRQA 4H2SA 3RIRA 2JVDA 3RKXA 4YRCA 1X01A 2ZNJA 2DKGA 2C8MA 2YIAA 2PMFA 2I4LA 3MF2A 4YP0A 2AKWA 2I4NA 4YRRA 2ZXFA 2E1HA 4HWPA 3PCOB 5ELOA 2QHVA 3HY0A 2QHTA 4CH6A 4HWTA 1EVKA 1JJCB 3HXZA 1KMNA 1BIBA 1G5HA 1O9GA 1NJ6A 4H2VA 4XU0A 3WQZA 4XU2A 4K86A 2EJ9A 4TQDA 2AMCB 4P75C 4K88A 1J5WA 2IY5A 4OLFA 2DQ0A 3UGQA 3V7CA 1NJ1A 1Z7MA 3IG2A 3I7FA 4XTZA 4CH5A 1B70B 4CS2A 2YI9A 1QF6A 2E3CA 1USYA 3EFRA 2R72A 4XTYA 2ZINA 3V7SA 2CGHA 5E3IA 2ZT7A 1SESA 2Q5HA 2RHSB 1G6UA 2DTIA 3PCOA
chains in the Genus database with same CATH superfamily
3F7YC 2IH1C 2JIZG 2WLMA 2F95B 3H1IH 1H2LA 4P73C 2YIBA 2WA4A 3L71H 4CH3A 4ZKIA 2ZT8A 5E79Z 3ZMVA 1XL6A 3QVNA 3RYCA 4HWSA 4XDJA 4TOIA 5JCOC 4UB8Z 1JJCA 4ASUG 4G84A 4ZTZB 3SR2C 3CCEV 4O4IA 2AXTZ 2XAFA 3P3NA 1KECA 1HWYA 1JVMA 5HGQA 2AMCA 3L4GB 2XTAA 4QPKA 4P2ZA 3RWRD 3CRQA 1HNZB 2R9IA 2EWNA 1MMMA 3CP1A 4X1IA 1I7FA 2YI8A 1WP8A 3DSQA 4JI2O 5LA6B 4B3TB 3REUA 4MVRA 4UCVA 1HR0B 5J2UA 1B70A 4GT1A 4LFBO 4MT8A 3W7TA 2F43G 2DWEC 1SS3A 5HFMA 1KU9A 1YITV 1KMMA 3SPJA 4X65O 4Q15A 3RYIA 1XMOO 2Q7EA 1V54C 3WB1A 2RHSA 1PP9H 2O57A 4LF8O 2P5IA 4LFAB 5LL6Y 4H0LB 2R9AA 4UP7A 4I0XB 3HRKA 2VS0A 4WFHA 2Y48A 1N4CA 2Q6AA 2GUZA 4UVCA 2EZOA 1M5IA 5EZYB 1GAXA 1X59A 3N2GA 1HNWB 1IZ3A 3QTCA 1NR1A 3KKYA 1GRJA 1ZL8B 1XNRO 1SQFA 5LYJA 3WU2Z 1SQQH 4MVMA 4XDKA 3IC7A 2ZTGA 2YXLA 4EO4A 1K4CC 3F5TA 11ASA 4X64B 1QCEA 1YVWA 2EJGA 3M4PA 4X89A 4GX2A 2ZT5A 4YRKA 1LR1A 5D5PA 3LNMB 4CBCA 1X55A 4DR4B 4FPPA 3T1HB 1ASZA 3RGLA 1ZUQA 2CGOA 4PDMA 2ARTA 4P75A 4PELA 4X1KA 1FJGO 3R07A 4YY3B 1BE3H 1NQTA 1COWG 1ASYA 2LGWA 1KKDA 4DRXA 4E4EA 3CEIA 2Q7HA 2HR3A 2WPDG 4ZIBA 4DR5B 2UUAO 2QEXV 3T1YO 2DXUA 1B3QA 4EKWA 3P3PA 1BCCH 3OM3B 5K1XA 4JI0B 3MQZA 3RKYA 2B1IA 3PJSK 5IYDO 1NR7A 4I4TB 1EN5A 2KKWA 1FXHA 2E5LO 2B9ZA 4LNUB 5LGNA 2EL9A 1VIBA 3OTFA 1H2NA 3AG2B 2DZ9A 3EFFK 1G51A 2XAGA 1GKFA 4XU1A 3APOA 3M99B 4BR6A 3OGCC 5C53B 1Q86W 2JS5A 5GW7A 4UPAA 1QNMA 3OAAG 3CPWU 5EBMC 3JAMN 4RWUA 2DOSA 3H1KH 2EAYA 1YIJV 1G1XB 2Q5ZA 3ZMZA 1OCOC 2F1MA 3FB7C 1AI4A 4DR1B 3QO5A 3G4SV 5LGUA 2DQ3A 1VQNV 2VQFB 1PL0A 4JI5B 4IIJB 4P71A 2QM4A 5TISZ 1KC8W 1A32A 4ZTUB 4EX5A 2EINB 5J2TA 2LP7A 3IAYA 4FLYA 2C7IA 3HY1A 4B3TO 1HR0O 1H4QA 5LP6A 4UP8A 1GN3A 3QO8A 1VQ6V 4QIWF 4N23A 3HB3B 4FLVA 1Q82W 4DW1A 2ZZGA 2LFRA 2Y0IA 1YJNV 4ZOLB 5DEDA 3TJTA 1OCRB 5DECA 3CCVV 3E9IA 4UV9A 1GM8A 4FM1A 2AHYA 1Z5WA 2HFEC 4O4HB 4BWAA 1M56B 1VQLV 2JRIA 2N04A 2WLJA 4B3RB 2ITCC 3UT5A 3JD4A 1PD3A 2XTIA 2NNUA 4DK1A 4ZI7B 1QE0A 3OUSA 3HXYA 3DXRA 3IFXA 4DQ2A 2ITDC 1XEQA 3ASOC 1MZFA 1NJ8A 1N33O 4X8AA 1AI7A 1IURA 4H02A 5JQGA 1NS1A 4YRTA 1G4YB 1B7YB 4GLXA 4WI1A 3CXCU 4LWSA 3K9AA 1Y76A 1TAEA 1WNLA 5IWAO 1OCZB 4W4LA 1M93A 1WA8B 3J80N 3T2MA 2E5AA 1MZEA 1US6A 3AEIA 4JI7B 1DF4A 2BE3A 1NVPB 1S3JA 1JPXA 1PV0A 1QHTA 1YEWA 1YB3A 2HVJC 4KL1A 4F6EA 4YY3O 3IKLA 2F93B 4UB6Z 3TUPA 3UM7A 4HZ3A 2IBZH 4ZBMA 1GMGA 4BW9A 3CMEV 1VQ7V 1I08A 5KNNA 1NTKH 1BBWA 4DR5O 3CMQA 4MVOA 2QSAA 4LVIA 3OFNG 1H4TA 5JH7A 4RAIA 1MG1A 4TT3G 2ALYA 3G1ZA 4FJCC 4WFGA 2DN9A 2ZR2A 3NETA 4MVZA 2OTJV 4O2BB 4LF4B 5JCOA 2ZXWB 2OT5A 2CIMA 4J15A 1PYSB 4UVBA 4YRGA 3VQVA 2PI5A 4LC1A 4FLUA 2ZNIA 3HKBA 2RDCA 3L74H 4DXWA 3B8MA 5KHHA 3SJQC 2CUGA 1TVKA 4NYKA 3B77A 4P74C 4GKKO 3W7UA 3AK2A 1E1TA 4WF2A 4JAAA 4PD4F 3RVYA 1YSCA 2UUCO 5GONB 4DR1O 2ODRD 2IH3C 2EULA 4FK5C 2VQFO 3A31A 4JI5O 1CEZA 2UU9B 1R3LC 1QU7A 2QWNB 1CP9A 3BJUA 2EBOA 4U3JA 4JAVA 3STLC 3OE7G 1NJIW 1M4UA 5LOVA 1MSWD 3E22A 4J80A 4FFKA 5IE9A 3L72H 1FXKA 4P3NA 3D3IA 1V9PA 3ERRA 1R3KC 2C2AA 4H2YA 4P72C 1IL2A 2Q0OC 5FNVB 4QPJA 5B3SB 2DXTA 4BIOA 4U7OA 3LC0A 5A9GA 1VQKV 4XU3A 3KG2A 4QE9A 3BAAA 4WBNA 2XASA 1AJQA 3ABLB 3RKXA 1IX9A 2YIAA 1G8MA 1NBMG 3MAQA 2JJ1G 2I4NA 2ZXFA 1PNMA 3E2EA 1OHHG 2E1HA 3OUFA 2QHVA 4WFBV 4H33A 4UCTA 1GN6A 3A0BZ 4QE7A 1AR1B 4JYAO 3DGEA 2CH7A 3ZN1A 1N36B 4JI7O 1F23A 4KP4A 1EVKA 1KMNA 3TK1A 2ZE7A 2W0FC 2RN9A 4JI3O 4HNAA 3LNNA 4FMTA 3CC2V 3WQZA 1FAFA 5KAIZ 2EJ9A 4TQDA 3RYFB 3FB8C 1MNGA 4JTAB 4WF9V 1Y74A 4P75C 2DYRB 1J5WA 2IY5A 3JASB 4DV0B 3V7CA 3ETEA 2EJ7A 2XNDG 1RSOA 3B4SA 3W7SA 4OPHA 4LF7B 5EC2C 2WLIA 2H8PC 3ZHVA 3RW0A 1SZTA 5KX5B 3ZHUA 4OGQB 2WLHA 5H2FZ 2CGHA 4LF4O 2OCCB 1R73A 2HP8A 4W4KA 3AG3B 5IYZB 1AJPA 3PCOA 2WLKA 4H44B 5BXZA 1RP3B 3FJPA 2Y4UA 2GV9A 4QJFB 3JD1A 5DM6V 2BSKB 2RJZA 3RN4A 3OTOO 2ZGWA 2Y69B 4K87A 2DYSC 1AP6A 3LSUA 2PGGA 4YRMA 5F2VO 1Q5OA 3BY6A 4TV8A 4YXWG 4X65B 2AW9A 1FFXA 4JI6B 1XMOB 3AG4B 4LF8B 2X6BA 1BIAA 4GYCB 3CD6V 4B3SO 3W7WA 4X1YA 5JJJB 5B1OA 4AQYO 2WLNA 2CJBA 2QJ1A 1PKXA 1B6QA 4DV5O 1P4RA 1X2GA 1NVPD 5LP6C 3A32A 1D5NA 4PI2A 1TUBA 2IJIA 1YHQV 4TV9A 4XEOA 4O4LB 5IJ9B 4FVMA 1BT8A 2CTWA 2PUSA 4DK0A 4G28B 1JCHA 4H2UA 3O9OA 4CH4A 4IHJA 2UXBB 1SC5B 2Q68A 2QE7G 4DV4O 2WLLA 4O4JB 2HLDG 2EIKB 2ZCEA 1WQ7A 1LYLA 3EFSA 1Q6HA 2QKCA 2UUBB 1NH2D 2GSMB 3A8TA 4MW8A 2G38A 1HC7A 2BTOA 1OJHA 2RQ6A 4JI4B 1PNKA 1WPYA 3TXQA 3REXA 1H4SA 4FZ0A 1ZTEA 2XT9A 3FX7A 4GX1A 4G85A 1KOGA 3SYOA 3U11A 1FJGB 5KUMA 2Q8VA 3GWOA 2HJFC 1BHBA 3CC7V 1N36O 3CRCA 3ZHQA 3OMIB 5CA1A 4XTVA 1GN2A 3ICAA 3V8LA 5LHHA 4UP9A 5H6QA 3NXSA 2PMEA 3QNEA 4DUZO 1N32O 2ZIOA 2A7WA 12ASA 4Q20A 2E76B 3B40A 4FLTA 4DV0O 1N9WA 4EB6B 3TCUA 1V54B 1M1KW 1WYDA 3ZIAG 4HYOA 1VARA 5E1AC 3ZRWA 4LF7O 4YRJA 4JZGA 4H2WA 2QM7A 2D3OW 5KHIA 3F7VC 3WG7B 2L6LA 1YFTA 2G4CA 3Q4HA 4P74A 4NTXA 4TVYA 4Z1VA 4PA3A 4J7ZA 4I55A 4KFMA 1IDSA 1UJWB 3G71V 2CK3G 3OGIB 4DV1B 3ZEDA 5C8YB 2AZ2A 3UGTA 4YRSA 3AK1A 2EX3A 1VQMV 4TVWA 4D6TH 1DTOA 1V55C 3E35A 1SA0A 2FB5A 2H94A 4JV5B 1BGYH 4JZ2A 4TVAA 3KFUA 1QVFU 2WAMA 1VMGA 1Q6IA 1QLEC 2RHQB 2P4VA 5IT9N 1FS0G 4H13B 2P22C 3CRAA 3ZRXA 4X20A 1WLEA 5CA3A 4P72A 4JI6O 2OYQA 1WQWA 3CCJV 2DU5A 1Q6UA 4DYLA 3E9HA 4C7UA 5CA0B 1QVGU 1NZ6A 1Y66A 1WAZA 2UXNA 4YJ2A 5L3EA 3ZMSA 1W0KG 3G67A 4JTCB 1AJNA 1K9MW 3RYHA 2HKOA 4WJ3M 3E8HA 4P30A 1YF2A 1R6TA 4YCWA 3JALB 2PYLA 3SYPA 3SPHA 1FXKC 4J7JA 1GGMA 5JVDB 1NTMH 2UXCO 3T4ZA 5BMVA 1N33B 4L87A 2Q7GA 2QTOA 5IJ0B 4DV7B 3EVKA 2ADQB 3IGAC 2UXBO 1OV9A 2OIEA 5F5WA 3P8YA 1MSDA 2D2CB 3CCRV 3TEHA 4YRNA 3A7UA 3HKEB 4AHCA 1VQ9V 5IWAB 4GUNA 1YJWV 2UUBO 1WB8A 3HKCA 2ZDIA 5LXTA 3C90A 3J81N 4WCEV 1L1FA 4JI4O 1PNLA 4IGGA 2W6IG 4B7EA 4YCVA 4DR2O 3HXUA 2E74B 1OCOB 3ZMUA 2PY5A 1K3EA 1CXZB 3LUTB 1CPYA 3CCUV 2ARSA 2CTPA 1EIYA 5IYBO 3CCMV 3V7RA 4KXRA 4QNHB 3CE2A 3PZCA 3HFZA 3LDDA 1SQVH 2WA3A 4YIPA 2ZZFA 1M90W 2ZQMA 1KD1W 5GTIZ 1KP3A 1I5XA 4YDQA 1XILA 3NR7A 3ZJZA 4H2XA 1BZKA 3N27A 1BQ0A 2NR5A 2N74A 1FKAO 1DGSA 2CJAA 1X4TA 2YS8A 5JJNB 3B09A 4FLWA 1XHXA 4PA4A 3P8TA 3E8BA 4UCUA 3ZHRA 2ODRC 2KG7B 2Z3YA 1EOVA 4KR2A 4D7SA 1BSMA 4TQFA 4GKKB 1SF9A 2A8EA 3KCYA 3ASOB 4R8CA 3GWKC 3L73H 2UUCB 4DV1O 1RM1C 5ITZB 3BA8A 1SETA 2ARUA 2IU3A 3NELA 2JGUA 2ADPA 2EILB 3CCSV 2FMLA 4JV5O 4XEMA 4X62B 2EIJB 3N2KA 4RMFA 3A7RA 2CJ9A 5KHJA 3FKSG 1H2GA 4PA6A 1I94O 1JQ0A 2XOKG 1MABG 2RCVA 1EFRG 1EVLA 3FAVA 2BTQB 1NI8A 2QWPB 3CRMA 4HT4A 1AROP 3CCLV 1ROPA 5AG2A 4YHHB 5CB4A 4LR3A 4I50B 4LNSA 1BS3A 2A9HA 4XDLA 3VQXA 3HKDB 2ZT9B 1W66A 1ADJA 1G5IA 4JF3A 5EYPB 3ETDA 1AR5A 4FFBA 3AG2C 2P0LA 4PA7A 4TUYB 1H38A 4DV7O 3APQA 2LQTA 3JAWB 4H2SA 3RIRA 3FFQA 2ZM6O 4YRCA 2ZNJA 3H01A 4R6ZA 2C8MA 4LF9O 2AKWA 3ZRSA 1IXMA 4O2AB 1K4DC 4JYAB 5ELOA 3D36A 2FL4A 3HY0A 1THZA 4JTDB 4TSFG 4ZHQA 4HWTA 3ABMC 4JI3B 2HHHB 4MVQA 3JSNA 3RYCB 1N0JA 1EM1A 1JJCB 2EINC 3HXZA 4LVJA 2RMKB 4O4IB 4XU0A 2A79B 1WNSA 2Y0PA 2QDOA 4J10A 2YICA 4TWKA 4XU2A 2AMCB 1QR8A 2QKAA 4F6RA 2GTSA 2DQ0A 3UGQA 1NJ1A 4X1IB 1FPOA 3S3WA 1I0HA 2MW2B 1IVSA 4RO2A 1OCRC 5J2UB 1B70B 5B66Z 4XTYA 5L3BA 4B08A 4I9QA 2V1DA 3UO3A 3V7SA 2YEVA 5E3IA 1L0NH 3RYIB 2ZT7A 1SESA 1Y67A 3ABKB 3JARA 4E2LA 3QG5A 2RHSB 4U7NA 2DTIA 2YXHA 1D5AA 2JGDA 1B04A 3HXVA 4Z2WA 1FYJA 2EIMC 5KUKA 3OTOB 2GUZB 1S77D 4PDRA 2PZSA 4YRIA 4NR1A 1EN4A 1YXBA 4P3OA 2HVKC 1JFFA 2QM8A 1ADYA 2IJKA 5C51B 3N2GB 5L3GA 1OCZC 3CCQV 1ZWIC 1DK1A 3OMNB 2R70A 5LYJB 1JOYA 4LVKA 3LSSA 3JATA 1S5JA 3SJAC 4X62O 1K92A 4GZRB 5KMGA 2Z5UA 4B3SB 2Y4TA 1WN7A 1M57C 3BPZA 4AQYB 1OZ0A 3A7AA 3SJCC 3IKMB 5B1BC 4MVSA 4DV5B 3WB0A 3FD9A 1HTTA 5IY5B 1AVMA 1XNQB 5EK0A 4BIZA 2HJDA 1JX9A 3JAKA 4YJ3A 4LCUC 1TUEB 2DZCA 4X66B 4PJ0Z 3CJHA 4YHHO 1XBLA 4X1KB 4FM2A 3BFMA 2Q9LA 1K34A 2P5OA 5K1PA 1X56A 2F23A 4NVPA 1SERA 2F66C 3K08A 4DRXB 3IALA 1AI6A 3MD0A 4DV4B 5BZBA 3ZHSA 2UXDB 2FYKA 1H2MA 4MTXA 1VQ5V 3L4GA 1W0JG 4MS2A 4X9QA 3VQYA 4DR3B 4DV6O 4EEQA 1T5EA 1L0WA 5LHIA 2E65A 3K04A 5LA6A 3LDEA 1AILA 3AG1C 2GDSA 1LUWA 2IJJA 4HA8A 2A3QA 4LF6O 2XAJA 2X7RB 1E79G 2ZDIC 3NENA 1Z7NA 2CGNA 3FB6C 3HPLC 2M6YA 1SQPH 1P49A 2HHHO 3JCZA 5LGTA 2DYSB 4XTUA 4DUZB 1N32B 2NN4A 3SDLA 1YJ9V 3VQWA 1X54A 4I0XA 4XTWA 2VRZA 1R1BA 5EZYA 1VQZA 3W7XA 3JALA 2ATKC 1DLBA 2DU7A 2P6JA 3X2QB 5J2TB 2QWRB 1YI2V 2I4MA 1M9NA 2JEXA 3L70H 1ZL8A 1XI1A 2Q67A 2HEPA 5LP6B 4PG3A 2WSSG 3ZCCA 4K0KO 1OCCB 4RQEA 4YRFA 5B3SC 4PHCA 5BY1A 4HWOA 2OCHA 4OP0A 3K59A 3CC4V 4DV2B 3I56V 2CTQA 2OWOA 2Q5IA 3GB7C 1R6NA 3L9DA 4DO2A 5LBQA 3ABLC 2J3LA 3L2ZA 4YRPA 1SRYA 1GN4A 3RL6A 4K3AA 3UT5B 2JJ2G 4DR7B 5B1AC 4MSWC 1S5LZ 3DXRB 1EZVH 4DR6B 2IJHA 4RUEA 1JJOA 1UPGA 1QBZA 2BOCC 3HXWA 5JQGB 3OR6C 4LWSB 1Y76B 1ATIA 3RF1A 3RT3C 4I4TA 5LMNB 3KCXA 4N21A 5KAFZ 4LNUA 3SYCA 3CMAV 5FL7G 1XNQO 2DYRC 2JK5C 1IXBA 1HNXO 4LH7A 4MTGA 2DWDC 4X66O 3STZC 3SPCA 3GVMA 2UXCB 1Y4MA 4LVMA 2X6CA 5DN6G 1RPOA 4DUYB 3QF7A 1D2DA 4YYEA 2P90A 4HAMA 4H2TA 3ZRVA 4HVCA 2UXXA 3LDCA 2OCCC 3AG3C 2MK3A 2H3OA 2UXDO 1B76A 1WB7A 1E22A 1WU7A 4K8XA 5JH7B 2RNBA 2ALYB 3I5DA 4DR3O 4IIJA 1QQCA 2LO1A 2J3MA 4B7KA 1KMIZ 2AZ0A 4DR2B 5CMUA 2FKXA 2QR4A 1Q81W 2OTLV 1RFYA 2Q0AA 4J41A 3T1CA 1W2BU 2PYJA 4JGSA 2F4VB 3M4QA 2FTKA 3ASNC 3HKBB 4P9OA 2LFSA 4IYHA 2DEQA 2IM9A 4Q6GA 3RKWA 2X0LA 4ZOLA 1TVKB 4JYBA 4G27B 3D36C 1IBKO 4DW0A 1KKCA 1ZAUA 1QLNA 4O4HA 2QA4V 3AG4C 3K5OA 3V8KA 1S72V 1EN6A 4PDLA 1PL4A 1NYRA 1S76D 3JD0A 4ZI7A 3CRRA 4U3JB 3OEHG 5KHKA 1FD9A 1VF7A 2GTAA 5LOVB 3E22B 4XBFA 2OIGA 4LP8A 4YRLA 5D5QA 2E41A 3RVZA 3OD4A 1B7YA 3H1HH 5EIBD 2E75B 1FXKB 1J95A 1VQPV 1XDCA 2V4DA 1XMQO 4YIOA 1WA8A 4UUJC 4DV2O 5H5NA 2VQEO 1VF5B 2EIKC 1SQGA 3K5NA 1O9HA 3QO7A 1NYQA 3ZHTA 2NLJC 3L1AA 5C93A 1YFSA 1HW7A 4DR7O 1HXDA 2JS3A 2DE0X 4WBNB 2PTMA 4DR6O 1C0AA 1IBLO 1I94B 2QHUA 4R50A 1PPJH 1SQBH 3UO2A 1IBMO 2VWJA 3OEEG 4OX9O 4ICGA 4J9ZB 3A5ZA 2DTHA 2ETNA 4LVLA 4O2BA 5LMNO 2ILMA 3K57A 1P7BA 2ZE8A 2LW1A 1B8AA 2CH7B 1PYSA 3E8FA 2B5UA 3RACA 3HFVA 2CE4A 1R6KA 2Q73A 4WFEA 3TEGA 2EZPA 5LHGA 3A2FA 4HNAB 4DUYO 2K9PA 4FZ1A 4JYCA 2E64A 2XHBA 4PI0A 3WG7C 1L0LH 2DMXA 1Y74B 2QTSA 2YXYA 3C3SA 3M7MX 2IY5B 3SYQA 1H4VB 1ZX3A 2ZM6B 2QWOB 1RSOB 5GONA 1JJ2U 2WLIB 2IU0A 4LF9B 4NTYA 4FIPC 1YCIA 1X01A 3BRCA 5JWPA 1J5EB 2PMFA 1F4NA 1K8AW 3S3XA 4YRRA 4L8JA 1S0VA 3PCOB 1RM1B 4B3MB 4NKGB 2F4VO 3A0HZ 5KHGA 2QHTA 1FXVA 2N05A 4I5SA 1ORQC 1VF6C 3RGBA 1XHZA 3JCUZ 1BIBA 1G5HA 2ZE5A 1K97A 1O9GA 1NJ6A 4H2VA 2IW5A 5FNVA 1EBOA 3SYAA 4K86A 3E86A 3CYOA 4J42A 2XUMA 1YTFB 1JMKC 3CB2A 4OLFA 1KBHA 1Z7MA 3IG2A 3SGIA 4KHPB 2DJVA 1XREA 3R66A 3DC5A 5L3FA 4TV8B 4CH5A 1Q7YW 1FFXB 3EHBB 2E3CA 1USYA 3EFRA 1W59A 2ZINA 4PA9A 3UCSC 4X1YB 2YIDA 3C3TA 1BHAA 2Q5HA 1GM7A 2M7WA 1Y6XA 3OW2U 4LF5B 1G6UA 2KQXA 4UFZA 2JEUA 3RFRA 4WJ4A 2ARHA 1TUBB 3FYEB 4EFEA 2GBOA 1WPBA 5EBLC 5CBGA 4TV9B 4UV8A 1VEWA 4YREA 3P30A 2I4OA 5CN0A 3V8JA 3ABUA 2ZZEA 1N8RW 3BABA 1B06A 1H2KA 2X6AA 3BCCH 1URFA 4IHJB 2DVEA 1H8EG 3WB2A 3JD3A 2WLLB 3RYFA 3D3QA 1EZJA 2CAZC 3JASA 4BIUA 4YPFA 1NJ5A 4JASA 3SPGA 4TWAA 3ABMB 1HNZO 1GTOA 3P8VA 5KX5A 4E51A 1AI5A 2YUAA 1BQZA 3VBBA 4MVUA 2P67A 3DC6A 2DJZA 5IYZA 5IYCO 1BMFG 5J9PC 5CA1B 3UH0A 4LFAO 3B8NA 3TETA 3R65A 4CC6A 4TTVA 4YCUA 1NTZH 5EC1C 2BSKA 4IT5A 4DV6B 1NNHA 1P7GA 3LSQA 1K7DA 5EBWC 1EFWA 3MHSC 1JR9A 3ZRWB 3ICXA 3K5LA 5GTHZ 1XUQA 2LW7A 2ZIMA 2A0LA 1HNWO 4OPAA 3OMAB 2EIMB 3Q4HB 1J5EO 4LF6B 2AHZA 5BR8B 2BCCH 3ZS8C 1HP8A 3MDSA 4MTOA 2Z0AA 4I55B 2P4KA 4B3MO 3PN1A 3CHXA 4X64O 2EILC 1E1QG 2HG5C 5H9CA 4PV1B 1K33A 2EIJC 3CWBH 2QHSA 4DR4O 3T1HO 4NXMB 3OT7A 1DF5A 3AG7A 1EQRA 4LH6A 4KQEA 3K0GA 4O4LA 5IJ9A 3CS5A 2E10A 3OR7C 1M57B 1SA0B 1XQ8A 4TVAB 4WFFA 5B1BB 1NU1H 1NJ2A 3L75H 4K0KB 4KHPO 1M56C 4X20B 3T4DA 4O4JA 3ZN0A 1SQXH 4FM0A 1N0NA 5FPOA 3FB5C 3P32A 4JI0O 3HTZA 4P73A 1ZSPA 1I5YA 5KLVH 1LNQA 1NH2B 2QGNA 4Z1MG 3NEMA 4YJ2B 3ABTA 3I55V 4LF5O 3M8AA 4RQFA 1YFRA 3RYHB 1GO3F 4JI1B 3AK3A 4R7CA 4U3FH 3K3WA 2DTOA 1F4MA 3OD1A 2KSDA 3BFRA 4YROA 3E83A 3BHPA 3E89A 5KA5A 1LUVA 5BMVB 1VQ4V 1FFTB 4JPRA 3AG1B 2YDEA 4LFCB 1MOFA 3TEHB 2W0XA 4UVAA 1E24A 1KUQA 3U0ZA 1U97A 3HKCB 4EB6A 4AI8A 1R3JC 5LXTB 1SKVA 3WFVA 3A0RA 1KYOF 2WWWA 1HNXB 2A06H 1AP5A 1NT2B 4IL6Z 2DW4A 2CTRA 1L8DA 1K5QA 3MEYA 4WFAV 4GKJB 2L35A 1XOUA 5LMUB 1EIYB 1WP7A 3K06A 3K79A 2HNIA 4K8ZA 1P84F 2ZXWC 1MA1A 4NXNB 4KR3A 3HFZB 1QR9A 5C8YA 4HWRA 4NCXA 4BAYA 3E8GA 1N34B 2B1GA 4BW5A 3ABKC 4P3PA 1YTFD 4KUMA 4UCRA 1YDXA 4UCSA 4B3RO 5C52B 1Q8IA 3HRIA 3RUXA 5CBFA 3D8CA 3JYCA 4GCZA 4H2XB 2NS6A 4CZZA 3TGUH 5JJEB 1VF6A 4JI8B 4PDVA 3CX5F 2RHQA 4HBNA 3H1LH 5BR8O 1X2HA 3K03A 1E1OA 4XTXA 2EJFA 4J9YB 5B1AB 5CA0A 2ZKOA 3HXXA 3TXSA 1XL4A 1U96A 1IBKB 3A5YA 3ETGA 3MF1A 1F51A 2QWQB 2Q69A 1VQ8V 3G80A 1PM9A 4UXNA 3UFGA 1UFIA 2ODMA 3ZX6A 2W6JG 4J7KA 3A74A 4NXMO 3HR0A 2FYUH 3MHHC 4I7ZB 3RBZA 4DV3B 5JVDA 4CS4A 5EIBC 4MW3A 5IY5C 3N2KB 1VP7A 5IJ0A 3G6EV 3ETQA 3BEHA 4PHZA 4CC5A 4CS3A 5A2QN 1BBUA 1XMQB 3HKEA 3FAVB 2PI4A 2CDYA 1GM9A 2ZD9A 3W3SA 2VQEB 2YC0A 4GX5A 2XGTA 5FPRA 5L3CA 1Q90D 2KB1A 2R9RB 2V7QG 4AH6A 4LBEC 1USYC 5CB4B 1BL8A 2XAHA 4JI1O 4DPGA 4MTFA 2LJ2A 3G6BA 4QGPA 2DDZA 5ELNA 3FYIB 2XAQA 1Z2GA 5L3DA 1IBLB 4FFBB 4O2DA 2ZT6A 3ZBHA 1IBMB 1SZXA 4OX9B 4JYYA 2YSUB 2LGQA 4LFCO 1RIQA 4RDXA 1TGOA 5IDJA 1WPXA 1KP2A 4FLZA 3ASNB 4JI2B 2AKWB 4IYIA 3ZMTA 4LFBB 2UU9O 1S5HC 2ZR3A 3K58A 1ZLZA 3CXHF 2YIBD 3DTUB 3K9SA 3UQ8A 1GH6A 1F7YA 4AILC 1VQOV 4ZHQB 4H37A 1AR4A 4P71C 4I9WA 1FYFA 4JAUA 4NB5A 4GKJO 1ENVA 1RPRA 3X2QC 3H9VA 2KG7A 2Q4PA 5B5EZ 1K5SA 5LMUO 1YGBA 1HDJA 3K0DA 3UKMA 1H8HG 3BVOA 1KQSU 3CSXA 4NXNO 1R3IC 1OCCC 4NTWA 2BOBC 4F6RB 1Q3EA 1WJZA 5ITZA 1N34O 3H1JH 5HFLA 1Q43A 3JD2A 4X5OA 4P9PA 4EFBA 4K35A 4OXSA 2K1EA 3B2EE 1GK9A 1KB9F 1XNRB 4YRQA 1H2SB 2JVDA 3IC9A 2DKGA 2YEVB 4JI8O 2I4LA 3MF2A 4YP0A 3F5WC 2VWKA 3JARB 4J11A 4HWPA 2Y69C 1AB3A 4UCOA 1V55B 3BA9A 5CBHA 1NKDA 4F4LA 2BTQA 3KZIZ 2JGDB 3THOA 3U10A 5B1NA 3SPIA 2PF4E 3SJBC 4CH6A 4ABMA 1QLEB 3JSLA 3O65A 3K5MA 2ZE6A 1JFFB 2EJRA 4A5UB 4I50A 2P7TC 2QKSA 3EXAA 4X88A 5H6RA 3HKDA 2UUAB 4FLXA 4DV3O 3T1YB 3ML0A 4K88A 3JATB 5EYPA 1E1RG 3J7AU 3I7FA 4GX0A 4TUYA 4G2KA 5KMGB 1YZBA 4XTZA 3IJ4A 3JAWA 1TA8A 4CS2A 2YI9A 1QF6A 2P06A 2R72A 5FLXN 2JDIG 2E5LB 3VOUA 4D7TA 1JA8A 1Z5VA 4RUFA 5KA6A 3JAKB 2GHYA 2AGAA 4YJ3B 4O2AA 1K73W 3CJHB
chains in the Genus database with same CATH topology
4UFZA 3RFRA 4WJ4A 1TUBB 2F95B 1D5AA 4EFEA 3FJPA 1B04A 3HXVA 4P73C 1WPBA 2YIBA 3OTOB 4CH3A 2ZT8A 2GV9A 4TV9B 4YREA 2I4OA 3RYCA 3V8JA 2ZZEA 4HWSA 2PZSA 2RJZA 4YRIA 4TOIA 5JCOC 3BABA 1JJCA 4P3OA 4G84A 4ZTZB 1JFFA 3SR2C 1ADYA 4O4IA 5C51B 2DVEA 3N2GB 4IHJB 2ZGWA 3WB2A 5HGQA 2AMCA 3L4GB 3RYFA 2R70A 3RWRD 5LYJB 2CAZC 3JASA 1HNZB 3LSSA 2EWNA 4K87A 3JATA 4LVKA 1S5JA 3SJAC 4X1IA 4YPFA 1I7FA 2PGGA 2YI8A 1NJ5A 4YRMA 3DSQA 5KMGA 5LA6B 1Q5OA 4TWAA 4TV8A 4B3SB 4B3TB 3REUA 4UCVA 1WN7A 4X65B 1FFXA 4JI6B 5J2UA 1XMOB 1HR0B 1B70A 3P8VA 3BPZA 5KX5A 4LF8B 4AQYB 4E51A 3A7AA 3SJCC 1BIAA 3IKMB 4DV5B 4GYCB 3WB0A 1KU9A 1HTTA 1KMMA 1XNQB 4X1YA 3RYIA 5JJJB 3JAKA 2Q7EA 3WB1A 4Q15A 3VBBA 2RHSA 4YJ3A 2DJZA 2P5IA 4LFAB 2CJBA 2QJ1A 5IYZA 2DZCA 4X66B 1X2GA 5LP6C 3A32A 4X1KB 2R9AA 4PI2A 5CA1B 4FM2A 1TUBA 3BFMA 4UP7A 2P5OA 3HRKA 5K1PA 3UH0A 1X56A 4TV9A 4CC6A 4O4LB 5IJ9B 4NVPA 4TTVA 4XEOA 4YCUA 1SERA 2F66C 4FVMA 4DRXB 3IALA 2PUSA 4DV4B 4DK0A 1M5IA 5EZYB 4DV6B 2UXDB 1NNHA 4H2UA 3LSQA 4CH4A 2FYKA 3N2GA 4IHJA 2UXBB 1HNWB 1EFWA 3QTCA 4O4JB 3L4GA 3VQYA 4DR3B 2ZCEA 3ICXA 4EEQA 1SQFA 1T5EA 5LYJA 3K5LA 1LYLA 1WQ7A 3EFSA 2ZIMA 2UUBB 1L0WA 2ZTGA 2YXLA 2E65A 4EO4A 1HC7A 4LF6B 5LA6A 2BTOA 5BR8B 11ASA 4X64B 2RQ6A 4JI4B 3ZS8C 2EJGA 3M4PA 1WPYA 3REXA 1H4SA 4I55B 4G85A 1KOGA 2ZT5A 4YRKA 4HA8A 3PN1A 5D5PA 3U11A 3CHXA 1FJGB 1X55A 4DR4B 3NENA 1Z7NA 3T1HB 1ASZA 3RGLA 2ARTA 1P49A 4P75A 4XTUA 4DUZB 1N32B 2QHSA 4X1KA 3VQWA 5CA1A 1X54A 3R07A 4XTVA 3ICAA 4YY3B 3V8LA 4NXMB 4XTWA 4UP9A 1EQRA 1ASYA 4LH6A 4KQEA 4O4LA 5IJ9A 2PMEA 4DRXA 3QNEA 2ZIOA 2E10A 2Q7HA 1SA0B 1XQ8A 5EZYA 4ZIBA 4DR5B 12ASA 1VQZA 4TVAB 2DXUA 3JALA 4FLTA 2DU7A 1N9WA 5K1XA 4EB6B 1NJ2A 4K0KB 5J2TB 4JI0B 3MQZA 4X20B 1WYDA 4O4JA 2I4MA 3RKYA 4YRJA 1XI1A 4FM0A 4H2WA 2HEPA 4I4TB 5LP6B 2KKWA 5KHIA 4PG3A 5FPOA 4RQEA 3HTZA 4P73A 1YFTA 4LNUB 4YRFA 2EL9A 4PHCA 2G4CA 4P74A 4HWOA 3NEMA 3OTFA 4YJ2B 4OP0A 2DZ9A 4TVYA 1G51A 3K59A 4RQFA 4DV2B 1YFRA 2OWOA 4I55A 2Q5IA 4XU1A 3RYHB 5C53B 2JS5A 4JI1B 4UPAA 2DTOA 3OD1A 2J3LA 3L2ZA 4YROA 2EAYA 4DV1B 3ZEDA 5C8YB 3BHPA 1SRYA 3UT5B 4YRPA 3RL6A 3UGTA 5BMVB 4YRSA 4DR7B 2EX3A 2F1MA 4DR1B 4TVWA 3QO5A 4LFCB 4DR6B 2DQ3A 1SA0A 2VQFB 4JI5B 1JJOA 4JV5B 4TVAA 3TEHB 3KFUA 4IIJB 4P71A 1E24A 3HXWA 2QM4A 5JQGB 3U0ZA 2RHQB 3HKCB 4EB6A 4ZTUB 4EX5A 5J2TA 2P22C 3IAYA 4X20A 5LXTB 1SKVA 4FLYA 2C7IA 1ATIA 3HY1A 1WLEA 3RF1A 4P72A 2OYQA 1H4QA 4I4TA 5LP6A 1WQWA 1HNXB 4UP8A 3QO8A 1NT2B 2DU5A 5LMNB 3E9HA 5CA0B 4LNUA 4FLVA 1L8DA 4YJ2A 2ZZGA 3MEYA 4LH7A 4GKJB 4ZOLB 3RYHA 2UXCB 3E9IA 5LMUB 1EIYB 4WJ3M 4LVMA 4FM1A 4DUYB 1Z5WA 2HNIA 3QF7A 4O4HB 4BWAA 4K8ZA 4YYEA 4YCWA 3JALB 2PYLA 4NXNB 4KR3A 1GGMA 3HFZB 4H2TA 5JVDB 4B3RB 5C8YA 4HWRA 4NCXA 3UT5A 4HVCA 1N34B 2XTIA 5BMVA 1N33B 4DK1A 4ZI7B 2Q7GA 1QE0A 4L87A 4P3PA 1B76A 1E22A 5IJ0B 4DV7B 3HXYA 1WU7A 4UCRA 4K8XA 4DQ2A 4UCSA 5JH7B 5C52B 2ALYB 5F5WA 1Q8IA 3HRIA 3RUXA 3P8YA 1NJ8A 4H2XB 3TEHA 2NS6A 4IIJA 1QQCA 4YRNA 3A7UA 3HKEB 2J3MA 4AHCA 4H02A 5IWAB 5JQGA 5JJEB 4YRTA 4JI8B 1KMIZ 2RHQA 3HKCA 4HBNA 1B7YB 4GLXA 4DR2B 4WI1A 5LXTA 1X2HA 1TAEA 1WNLA 1M93A 2Q0AA 1E1OA 4XTXA 2EJFA 2PYJA 4YCVA 3HXUA 5CA0A 3HXXA 2F4VB 3M4QA 2E5AA 3HKBB 1IBKB 2PY5A 4JI7B 3A5YA 3MF1A 2DEQA 2IM9A 4Q6GA 3RKWA 1QHTA 4ZOLA 1YEWA 1YB3A 3UFGA 2ARSA 1TVKB 4KL1A 1EIYA 1ZAUA 3V7RA 3A74A 4O4HA 2F93B 3IKLA 3TUPA 3K5OA 3V8KA 3PZCA 4BW9A 4DV3B 5JVDA 3HFZA 4CS4A 1NYRA 5EIBC 5KNNA 1BBWA 3CMQA 3N2KB 4ZI7A 2ZZFA 5IJ0A 4LVIA 4U3JB 4YDQA 1H4TA 3ETQA 5JH7A 5KHKA 2ALYA 3G1ZA 4PHZA 1VF7A 4CC5A 4H2XA 4CS3A 5LOVB 1BBUA 3E22B 1XMQB 2ZR2A 3HKEA 3NETA 4YRLA 1DGSA 5D5QA 2E41A 4O2BB 4LF4B 5JCOA 2CJAA 1X4TA 1B7YA 3W3SA 5JJNB 2CIMA 2VQEB 4FLWA 4J15A 5EIBD 1XHXA 2XGTA 5FPRA 1PYSB 3P8TA 2V4DA 4UCUA 4AH6A 4YRGA 3VQVA 2ODRC 1USYC 5CB4B 4FLUA 1EOVA 4KR2A 4D7SA 2ZNIA 3HKBA 4TQFA 4DPGA 4GKKB 1SQGA 2A8EA 3K5NA 1O9HA 5KHHA 3QO7A 1NYQA 2DDZA 2UUCB 5ELNA 1TVKA 3L1AA 4P74C 5ITZB 1IBLB 1YFSA 1HW7A 3BA8A 4FFBB 1SETA 4O2DA 2ARUA 1E1TA 1HXDA 2ZT6A 4WF2A 1IBMB 3NELA 5GONB 2JGUA 4OX9B 2ODRD 4WBNB 2PTMA 1RIQA 1C0AA 1I94B 3A31A 2QHUA 4RDXA 1TGOA 2UU9B 4X62B 3N2KA 4FLZA 4RMFA 4XEMA 3A7RA 2CJ9A 2VWJA 3BJUA 4JI2B 4U3JA 5KHJA 2AKWB 1M4UA 4LFBB 3A5ZA 5LOVA 2ZR3A 3E22A 3K58A 2DTHA 1EVLA 2YIBD 4LVLA 2BTQB 4O2BA 3UQ8A 3K57A 4AILC 4HT4A 1B8AA 4ZHQB 4P71C 1PYSA 1FYFA 4P3NA 4YHHB 1V9PA 3RACA 3ERRA 5CB4A 3HFVA 4LR3A 3TEGA 4I50B 4LNSA 4H2YA 3A2FA 1YGBA 4HNAB 4P72C 1IL2A 5FNVB 3CSXA 2E64A 3VQXA 2XHBA 3HKDB 4PI0A 2DXTA 1W66A 3M7MX 4F6RB 1ADJA 2IY5B 1Q3EA 1G5IA 5ITZA 5EYPB 3LC0A 1H4VB 4FFBA 2ZM6B 2P0LA 4XU3A 4TUYB 1Q43A 4X5OA 4EFBA 5GONA 3B2EE 3BAAA 4LF9B 4WBNA 3JAWB 1XNRB 4YRQA 1H2SB 4H2SA 3FFQA 3RIRA 2JVDA 3RKXA 4YRCA 1X01A 2ZNJA 3BRCA 2DKGA 2C8MA 1J5EB 2YIAA 2PMFA 2I4LA 3MAQA 3MF2A 2AKWA 4YP0A 2VWKA 3JARB 2I4NA 4YRRA 4L8JA 2ZXFA 4O2AB 2E1HA 4HWPA 4JYAB 3PCOB 4UCOA 4B3MB 5ELOA 2QHVA 3BA9A 2BTQA 4UCTA 3THOA 3U10A 5KHGA 3HY0A 3SJBC 4CH6A 2QHTA 4ZHQA 4HWTA 4JI3B 1N36B 2HHHB 3JSNA 3RYCB 3JSLA 1EVKA 3RGBA 1XHZA 3K5MA 1JJCB 3HXZA 1KMNA 4LVJA 1JFFB 1BIBA 1G5HA 4I50A 1O9GA 4O4IB 1NJ6A 4H2VA 4XU0A 1WNSA 4HNAA 3LNNA 3WQZA 5FNVA 4XU2A 4K86A 2EJ9A 4TQDA 2AMCB 3HKDA 3RYFB 2UUAB 4FLXA 3T1YB 4P75C 4F6RA 4K88A 1J5WA 2IY5A 4OLFA 1JMKC 3CB2A 3JASB 4DV0B 3JATB 5EYPA 2DQ0A 3UGQA 1NJ1A 4X1IB 3V7CA 1Z7MA 3IG2A 3SGIA 3I7FA 4KHPB 4TUYA 1RSOA 5KMGB 4TV8B 4XTZA 4CH5A 4LF7B 1FFXB 3JAWA 5J2UB 1B70B 1TA8A 4CS2A 2YI9A 5KX5B 1QF6A 2E3CA 1USYA 4B08A 2R72A 4I9QA 3EFRA 4XTYA 2E5LB 2ZINA 3V7SA 2CGHA 5E3IA 4D7TA 1Z5VA 4X1YB 3RYIB 2ZT7A 3JAKB 1SESA 2Q5HA 3JARA 2RHSB 3QG5A 4YJ3B 4LF5B 4O2AA 5IYZB 1G6UA 2DTIA 3PCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJ4 A;  3FJP A;  3HXV A;  4P73 C;  2YIB A;  4CH3 A;  2ZT8 A;  4YRE A;  2I4O A;  3V8J A;  2ZZE A;  4HWS A;  2RJZ A;  4YRI A;  1JJC A;  4P3O A;  4G84 A;  4ZTZ B;  1ADY A;  5C51 B;  2DVE A;  2ZGW A;  5HGQ A;  2AMC A;  3L4G B;  2R70 A;  4K87 A;  3LSS A;  2EWN A;  4YPF A;  2PGG A;  2YI8 A;  1NJ5 A;  4YRM A;  3DSQ A;  4TWA A;  3REU A;  3P8V A;  1B70 A;  4E51 A;  3A7A A;  1BIA A;  3IKM B;  1HTT A;  1KMM A;  4Q15 A;  3VBB A;  2Q7E A;  2RHS A;  2DJZ A;  2P5I A;  2CJB A;  2QJ1 A;  2DZC A;  1X2G A;  3A32 A;  3BFM A;  4UP7 A;  3HRK A;  5K1P A;  3UH0 A;  1X56 A;  4XEO A;  4TTV A;  4YCU A;  1SER A;  3IAL A;  2PUS A;  1NNH A;  4H2U A;  3LSQ A;  4CH4 A;  2FYK A;  1EFW A;  3QTC A;  3L4G A;  3VQY A;  2ZCE A;  1WQ7 A;  1LYL A;  3EFS A;  2ZIM A;  1L0W A;  2ZTG A;  2E65 A;  4EO4 A;  1HC7 A;  11AS A;  2RQ6 A;  3M4P A;  2EJG A;  1WPY A;  3REX A;  1H4S A;  4G85 A;  1KOG A;  2ZT5 A;  4YRK A;  4HA8 A;  1X55 A;  3NEN A;  1Z7N A;  1ASZ A;  3RGL A;  2ART A;  4P75 A;  4XTU A;  2QHS A;  3VQW A;  3R07 A;  1X54 A;  4XTV A;  3ICA A;  3V8L A;  4XTW A;  4UP9 A;  1EQR A;  1ASY A;  4KQE A;  2PME A;  3QNE A;  2ZIO A;  2E10 A;  2Q7H A;  4ZIB A;  12AS A;  1VQZ A;  4TVA B;  2DXU A;  2DU7 A;  1N9W A;  5K1X A;  1NJ2 A;  1WYD A;  2I4M A;  3RKY A;  4YRJ A;  4H2W A;  2HEP A;  4PG3 A;  4RQE A;  3HTZ A;  4P73 A;  1YFT A;  4YRF A;  2EL9 A;  4PHC A;  2G4C A;  4P74 A;  4HWO A;  3NEM A;  4OP0 A;  2DZ9 A;  4TVY A;  1G51 A;  4RQF A;  1YFR A;  2Q5I A;  4XU1 A;  5C53 B;  4UPA A;  2DTO A;  3OD1 A;  2J3L A;  3L2Z A;  4YRO A;  2EAY A;  3ZED A;  1SRY A;  3BHP A;  4YRP A;  3RL6 A;  3UGT A;  4YRS A;  4TVW A;  3QO5 A;  2DQ3 A;  4TVA A;  3TEH B;  3KFU A;  4P71 A;  1E24 A;  3HXW A;  2RHQ B;  4ZTU B;  4EX5 A;  2C7I A;  1ATI A;  3HY1 A;  1WLE A;  3RF1 A;  4P72 A;  1H4Q A;  1WQW A;  4UP8 A;  3QO8 A;  2DU5 A;  3E9H A;  2ZZG A;  3MEY A;  3E9I A;  1EIY B;  4WJ3 M;  2HNI A;  4YYE A;  4BWA A;  4YCW A;  4KR3 A;  1GGM A;  3HFZ B;  4H2T A;  4HWR A;  4NCX A;  4HVC A;  2XTI A;  1QE0 A;  2Q7G A;  4L87 A;  4P3P A;  1E22 A;  3HXY A;  1B76 A;  1WU7 A;  4DQ2 A;  5C52 B;  2ALY B;  5F5W A;  3HRI A;  3RUX A;  3P8Y A;  1NJ8 A;  4H2X B;  3TEH A;  4YRN A;  3A7U A;  2J3M A;  4H02 A;  4YRT A;  2RHQ A;  1B7Y B;  4WI1 A;  1X2H A;  1WNL A;  1E1O A;  4XTX A;  2EJF A;  4YCV A;  3HXU A;  3HXX A;  3M4Q A;  2E5A A;  3A5Y A;  3MF1 A;  2DEQ A;  4Q6G A;  3RKW A;  1YB3 A;  3UFG A;  2ARS A;  1EIY A;  3V7R A;  3A74 A;  3IKL A;  3TUP A;  3V8K A;  3PZC A;  4BW9 A;  3HFZ A;  4CS4 A;  1NYR A;  5KNN A;  1BBW A;  3CMQ A;  2ZZF A;  4YDQ A;  1H4T A;  2ALY A;  3G1Z A;  4H2X A;  4CS3 A;  1BBU A;  2ZR2 A;  3NET A;  4YRL A;  2E41 A;  2CJA A;  1B7Y A;  3W3S A;  2CIM A;  4J15 A;  2XGT A;  1PYS B;  3P8T A;  4AH6 A;  4YRG A;  3VQV A;  2ODR C;  1USY C;  1EOV A;  4KR2 A;  2ZNI A;  4TQF A;  4DPG A;  1O9H A;  3QO7 A;  1NYQ A;  2DDZ A;  5ELN A;  3L1A A;  4P74 C;  1YFS A;  1SET A;  4O2D A;  2ARU A;  1E1T A;  1HXD A;  2ZT6 A;  4WF2 A;  3NEL A;  2ODR D;  1RIQ A;  1C0A A;  3A31 A;  2QHU A;  4RDX A;  4XEM A;  4RMF A;  3A7R A;  2CJ9 A;  3BJU A;  2AKW B;  3A5Z A;  2ZR3 A;  2DTH A;  1EVL A;  2YIB D;  1B8A A;  4P71 C;  1PYS A;  1FYF A;  4P3N A;  3RAC A;  3ERR A;  3HFV A;  3TEG A;  4LNS A;  4H2Y A;  1YGB A;  4P72 C;  1IL2 A;  2E64 A;  3VQX A;  2DXT A;  1W66 A;  1ADJ A;  2IY5 B;  1G5I A;  3LC0 A;  1H4V B;  2P0L A;  4XU3 A;  4X5O A;  4YRQ A;  4H2S A;  3RIR A;  2JVD A;  3RKX A;  4YRC A;  1X01 A;  2ZNJ A;  2DKG A;  2C8M A;  2YIA A;  2PMF A;  2I4L A;  3MF2 A;  4YP0 A;  2AKW A;  2I4N A;  4YRR A;  2ZXF A;  2E1H A;  4HWP A;  3PCO B;  5ELO A;  2QHV A;  3HY0 A;  2QHT A;  4CH6 A;  4HWT A;  1EVK A;  1JJC B;  3HXZ A;  1KMN A;  1BIB A;  1G5H A;  1O9G A;  1NJ6 A;  4H2V A;  4XU0 A;  3WQZ A;  4XU2 A;  4K86 A;  2EJ9 A;  4TQD A;  2AMC B;  4P75 C;  4K88 A;  1J5W A;  2IY5 A;  4OLF A;  2DQ0 A;  3UGQ A;  3V7C A;  1NJ1 A;  1Z7M A;  3IG2 A;  3I7F A;  4XTZ A;  4CH5 A;  1B70 B;  4CS2 A;  2YI9 A;  1QF6 A;  2E3C A;  1USY A;  3EFR A;  2R72 A;  4XTY A;  2ZIN A;  3V7S A;  2CGH A;  5E3I A;  2ZT7 A;  1SES A;  2Q5H A;  2RHS B;  1G6U A;  2DTI A;  3PCO A; 
#chains in the Genus database with same CATH topology
 3F7Y C;  2IH1 C;  2JIZ G;  2WLM A;  2F95 B;  3H1I H;  1H2L A;  4P73 C;  2YIB A;  2WA4 A;  3L71 H;  4CH3 A;  4ZKI A;  2ZT8 A;  5E79 Z;  3ZMV A;  1XL6 A;  3QVN A;  3RYC A;  4HWS A;  4XDJ A;  4TOI A;  5JCO C;  4UB8 Z;  1JJC A;  4ASU G;  4G84 A;  4ZTZ B;  3SR2 C;  3CCE V;  4O4I A;  2AXT Z;  2XAF A;  3P3N A;  1KEC A;  1HWY A;  1JVM A;  5HGQ A;  2AMC A;  3L4G B;  2XTA A;  4QPK A;  4P2Z A;  3RWR D;  3CRQ A;  1HNZ B;  2R9I A;  2EWN A;  1MMM A;  3CP1 A;  4X1I A;  1I7F A;  2YI8 A;  1WP8 A;  3DSQ A;  4JI2 O;  5LA6 B;  4B3T B;  3REU A;  4MVR A;  4UCV A;  1HR0 B;  5J2U A;  1B70 A;  4GT1 A;  4LFB O;  4MT8 A;  3W7T A;  2F43 G;  2DWE C;  1SS3 A;  5HFM A;  1KU9 A;  1YIT V;  1KMM A;  3SPJ A;  4X65 O;  4Q15 A;  3RYI A;  1XMO O;  2Q7E A;  1V54 C;  3WB1 A;  2RHS A;  1PP9 H;  2O57 A;  4LF8 O;  2P5I A;  4LFA B;  5LL6 Y;  4H0L B;  2R9A A;  4UP7 A;  4I0X B;  3HRK A;  2VS0 A;  4WFH A;  2Y48 A;  1N4C A;  2Q6A A;  2GUZ A;  4UVC A;  2EZO A;  1M5I A;  5EZY B;  1GAX A;  1X59 A;  3N2G A;  1HNW B;  1IZ3 A;  3QTC A;  1NR1 A;  3KKY A;  1GRJ A;  1ZL8 B;  1XNR O;  1SQF A;  5LYJ A;  3WU2 Z;  1SQQ H;  4MVM A;  4XDK A;  3IC7 A;  2ZTG A;  2YXL A;  4EO4 A;  1K4C C;  3F5T A;  11AS A;  4X64 B;  1QCE A;  1YVW A;  2EJG A;  3M4P A;  4X89 A;  4GX2 A;  2ZT5 A;  4YRK A;  1LR1 A;  5D5P A;  3LNM B;  4CBC A;  1X55 A;  4DR4 B;  4FPP A;  3T1H B;  1ASZ A;  3RGL A;  1ZUQ A;  2CGO A;  4PDM A;  2ART A;  4P75 A;  4PEL A;  4X1K A;  1FJG O;  3R07 A;  4YY3 B;  1BE3 H;  1NQT A;  1COW G;  1ASY A;  2LGW A;  1KKD A;  4DRX A;  4E4E A;  3CEI A;  2Q7H A;  2HR3 A;  2WPD G;  4ZIB A;  4DR5 B;  2UUA O;  2QEX V;  3T1Y O;  2DXU A;  1B3Q A;  4EKW A;  3P3P A;  1BCC H;  3OM3 B;  5K1X A;  4JI0 B;  3MQZ A;  3RKY A;  2B1I A;  3PJS K;  5IYD O;  1NR7 A;  4I4T B;  1EN5 A;  2KKW A;  1FXH A;  2E5L O;  2B9Z A;  4LNU B;  5LGN A;  2EL9 A;  1VIB A;  3OTF A;  1H2N A;  3AG2 B;  2DZ9 A;  3EFF K;  1G51 A;  2XAG A;  1GKF A;  4XU1 A;  3APO A;  3M99 B;  4BR6 A;  3OGC C;  5C53 B;  1Q86 W;  2JS5 A;  5GW7 A;  4UPA A;  1QNM A;  3OAA G;  3CPW U;  5EBM C;  3JAM N;  4RWU A;  2DOS A;  3H1K H;  2EAY A;  1YIJ V;  1G1X B;  2Q5Z A;  3ZMZ A;  1OCO C;  2F1M A;  3FB7 C;  1AI4 A;  4DR1 B;  3QO5 A;  3G4S V;  5LGU A;  2DQ3 A;  1VQN V;  2VQF B;  1PL0 A;  4JI5 B;  4IIJ B;  4P71 A;  2QM4 A;  5TIS Z;  1KC8 W;  1A32 A;  4ZTU B;  4EX5 A;  2EIN B;  5J2T A;  2LP7 A;  3IAY A;  4FLY A;  2C7I A;  3HY1 A;  4B3T O;  1HR0 O;  1H4Q A;  5LP6 A;  4UP8 A;  1GN3 A;  3QO8 A;  1VQ6 V;  4QIW F;  4N23 A;  3HB3 B;  4FLV A;  1Q82 W;  4DW1 A;  2ZZG A;  2LFR A;  2Y0I A;  1YJN V;  4ZOL B;  5DED A;  3TJT A;  1OCR B;  5DEC A;  3CCV V;  3E9I A;  4UV9 A;  1GM8 A;  4FM1 A;  2AHY A;  1Z5W A;  2HFE C;  4O4H B;  4BWA A;  1M56 B;  1VQL V;  2JRI A;  2N04 A;  2WLJ A;  4B3R B;  2ITC C;  3UT5 A;  3JD4 A;  1PD3 A;  2XTI A;  2NNU A;  4DK1 A;  4ZI7 B;  1QE0 A;  3OUS A;  3HXY A;  3DXR A;  3IFX A;  4DQ2 A;  2ITD C;  1XEQ A;  3ASO C;  1MZF A;  1NJ8 A;  1N33 O;  4X8A A;  1AI7 A;  1IUR A;  4H02 A;  5JQG A;  1NS1 A;  4YRT A;  1G4Y B;  1B7Y B;  4GLX A;  4WI1 A;  3CXC U;  4LWS A;  3K9A A;  1Y76 A;  1TAE A;  1WNL A;  5IWA O;  1OCZ B;  4W4L A;  1M93 A;  1WA8 B;  3J80 N;  3T2M A;  2E5A A;  1MZE A;  1US6 A;  3AEI A;  4JI7 B;  1DF4 A;  2BE3 A;  1NVP B;  1S3J A;  1JPX A;  1PV0 A;  1QHT A;  1YEW A;  1YB3 A;  2HVJ C;  4KL1 A;  4F6E A;  4YY3 O;  3IKL A;  2F93 B;  4UB6 Z;  3TUP A;  3UM7 A;  4HZ3 A;  2IBZ H;  4ZBM A;  1GMG A;  4BW9 A;  3CME V;  1VQ7 V;  1I08 A;  5KNN A;  1NTK H;  1BBW A;  4DR5 O;  3CMQ A;  4MVO A;  2QSA A;  4LVI A;  3OFN G;  1H4T A;  5JH7 A;  4RAI A;  1MG1 A;  4TT3 G;  2ALY A;  3G1Z A;  4FJC C;  4WFG A;  2DN9 A;  2ZR2 A;  3NET A;  4MVZ A;  2OTJ V;  4O2B B;  4LF4 B;  5JCO A;  2ZXW B;  2OT5 A;  2CIM A;  4J15 A;  1PYS B;  4UVB A;  4YRG A;  3VQV A;  2PI5 A;  4LC1 A;  4FLU A;  2ZNI A;  3HKB A;  2RDC A;  3L74 H;  4DXW A;  3B8M A;  5KHH A;  3SJQ C;  2CUG A;  1TVK A;  4NYK A;  3B77 A;  4P74 C;  4GKK O;  3W7U A;  3AK2 A;  1E1T A;  4WF2 A;  4JAA A;  4PD4 F;  3RVY A;  1YSC A;  2UUC O;  5GON B;  4DR1 O;  2ODR D;  2IH3 C;  2EUL A;  4FK5 C;  2VQF O;  3A31 A;  4JI5 O;  1CEZ A;  2UU9 B;  1R3L C;  1QU7 A;  2QWN B;  1CP9 A;  3BJU A;  2EBO A;  4U3J A;  4JAV A;  3STL C;  3OE7 G;  1NJI W;  1M4U A;  5LOV A;  1MSW D;  3E22 A;  4J80 A;  4FFK A;  5IE9 A;  3L72 H;  1FXK A;  4P3N A;  3D3I A;  1V9P A;  3ERR A;  1R3K C;  2C2A A;  4H2Y A;  4P72 C;  1IL2 A;  2Q0O C;  5FNV B;  4QPJ A;  5B3S B;  2DXT A;  4BIO A;  4U7O A;  3LC0 A;  5A9G A;  1VQK V;  4XU3 A;  3KG2 A;  4QE9 A;  3BAA A;  4WBN A;  2XAS A;  1AJQ A;  3ABL B;  3RKX A;  1IX9 A;  2YIA A;  1G8M A;  1NBM G;  3MAQ A;  2JJ1 G;  2I4N A;  2ZXF A;  1PNM A;  3E2E A;  1OHH G;  2E1H A;  3OUF A;  2QHV A;  4WFB V;  4H33 A;  4UCT A;  1GN6 A;  3A0B Z;  4QE7 A;  1AR1 B;  4JYA O;  3DGE A;  2CH7 A;  3ZN1 A;  1N36 B;  4JI7 O;  1F23 A;  4KP4 A;  1EVK A;  1KMN A;  3TK1 A;  2ZE7 A;  2W0F C;  2RN9 A;  4JI3 O;  4HNA A;  3LNN A;  4FMT A;  3CC2 V;  3WQZ A;  1FAF A;  5KAI Z;  2EJ9 A;  4TQD A;  3RYF B;  3FB8 C;  1MNG A;  4JTA B;  4WF9 V;  1Y74 A;  4P75 C;  2DYR B;  1J5W A;  2IY5 A;  3JAS B;  4DV0 B;  3V7C A;  3ETE A;  2EJ7 A;  2XND G;  1RSO A;  3B4S A;  3W7S A;  4OPH A;  4LF7 B;  5EC2 C;  2WLI A;  2H8P C;  3ZHV A;  3RW0 A;  1SZT A;  5KX5 B;  3ZHU A;  4OGQ B;  2WLH A;  5H2F Z;  2CGH A;  4LF4 O;  2OCC B;  1R73 A;  2HP8 A;  4W4K A;  3AG3 B;  5IYZ B;  1AJP A;  3PCO A;  2WLK A;  4H44 B;  5BXZ A;  1RP3 B;  3FJP A;  2Y4U A;  2GV9 A;  4QJF B;  3JD1 A;  5DM6 V;  2BSK B;  2RJZ A;  3RN4 A;  3OTO O;  2ZGW A;  2Y69 B;  4K87 A;  2DYS C;  1AP6 A;  3LSU A;  2PGG A;  4YRM A;  5F2V O;  1Q5O A;  3BY6 A;  4TV8 A;  4YXW G;  4X65 B;  2AW9 A;  1FFX A;  4JI6 B;  1XMO B;  3AG4 B;  4LF8 B;  2X6B A;  1BIA A;  4GYC B;  3CD6 V;  4B3S O;  3W7W A;  4X1Y A;  5JJJ B;  5B1O A;  4AQY O;  2WLN A;  2CJB A;  2QJ1 A;  1PKX A;  1B6Q A;  4DV5 O;  1P4R A;  1X2G A;  1NVP D;  5LP6 C;  3A32 A;  1D5N A;  4PI2 A;  1TUB A;  2IJI A;  1YHQ V;  4TV9 A;  4XEO A;  4O4L B;  5IJ9 B;  4FVM A;  1BT8 A;  2CTW A;  2PUS A;  4DK0 A;  4G28 B;  1JCH A;  4H2U A;  3O9O A;  4CH4 A;  4IHJ A;  2UXB B;  1SC5 B;  2Q68 A;  2QE7 G;  4DV4 O;  2WLL A;  4O4J B;  2HLD G;  2EIK B;  2ZCE A;  1WQ7 A;  1LYL A;  3EFS A;  1Q6H A;  2QKC A;  2UUB B;  1NH2 D;  2GSM B;  3A8T A;  4MW8 A;  2G38 A;  1HC7 A;  2BTO A;  1OJH A;  2RQ6 A;  4JI4 B;  1PNK A;  1WPY A;  3TXQ A;  3REX A;  1H4S A;  4FZ0 A;  1ZTE A;  2XT9 A;  3FX7 A;  4GX1 A;  4G85 A;  1KOG A;  3SYO A;  3U11 A;  1FJG B;  5KUM A;  2Q8V A;  3GWO A;  2HJF C;  1BHB A;  3CC7 V;  1N36 O;  3CRC A;  3ZHQ A;  3OMI B;  5CA1 A;  4XTV A;  1GN2 A;  3ICA A;  3V8L A;  5LHH A;  4UP9 A;  5H6Q A;  3NXS A;  2PME A;  3QNE A;  4DUZ O;  1N32 O;  2ZIO A;  2A7W A;  12AS A;  4Q20 A;  2E76 B;  3B40 A;  4FLT A;  4DV0 O;  1N9W A;  4EB6 B;  3TCU A;  1V54 B;  1M1K W;  1WYD A;  3ZIA G;  4HYO A;  1VAR A;  5E1A C;  3ZRW A;  4LF7 O;  4YRJ A;  4JZG A;  4H2W A;  2QM7 A;  2D3O W;  5KHI A;  3F7V C;  3WG7 B;  2L6L A;  1YFT A;  2G4C A;  3Q4H A;  4P74 A;  4NTX A;  4TVY A;  4Z1V A;  4PA3 A;  4J7Z A;  4I55 A;  4KFM A;  1IDS A;  1UJW B;  3G71 V;  2CK3 G;  3OGI B;  4DV1 B;  3ZED A;  5C8Y B;  2AZ2 A;  3UGT A;  4YRS A;  3AK1 A;  2EX3 A;  1VQM V;  4TVW A;  4D6T H;  1DTO A;  1V55 C;  3E35 A;  1SA0 A;  2FB5 A;  2H94 A;  4JV5 B;  1BGY H;  4JZ2 A;  4TVA A;  3KFU A;  1QVF U;  2WAM A;  1VMG A;  1Q6I A;  1QLE C;  2RHQ B;  2P4V A;  5IT9 N;  1FS0 G;  4H13 B;  2P22 C;  3CRA A;  3ZRX A;  4X20 A;  1WLE A;  5CA3 A;  4P72 A;  4JI6 O;  2OYQ A;  1WQW A;  3CCJ V;  2DU5 A;  1Q6U A;  4DYL A;  3E9H A;  4C7U A;  5CA0 B;  1QVG U;  1NZ6 A;  1Y66 A;  1WAZ A;  2UXN A;  4YJ2 A;  5L3E A;  3ZMS A;  1W0K G;  3G67 A;  4JTC B;  1AJN A;  1K9M W;  3RYH A;  2HKO A;  4WJ3 M;  3E8H A;  4P30 A;  1YF2 A;  1R6T A;  4YCW A;  3JAL B;  2PYL A;  3SYP A;  3SPH A;  1FXK C;  4J7J A;  1GGM A;  5JVD B;  1NTM H;  2UXC O;  3T4Z A;  5BMV A;  1N33 B;  4L87 A;  2Q7G A;  2QTO A;  5IJ0 B;  4DV7 B;  3EVK A;  2ADQ B;  3IGA C;  2UXB O;  1OV9 A;  2OIE A;  5F5W A;  3P8Y A;  1MSD A;  2D2C B;  3CCR V;  3TEH A;  4YRN A;  3A7U A;  3HKE B;  4AHC A;  1VQ9 V;  5IWA B;  4GUN A;  1YJW V;  2UUB O;  1WB8 A;  3HKC A;  2ZDI A;  5LXT A;  3C90 A;  3J81 N;  4WCE V;  1L1F A;  4JI4 O;  1PNL A;  4IGG A;  2W6I G;  4B7E A;  4YCV A;  4DR2 O;  3HXU A;  2E74 B;  1OCO B;  3ZMU A;  2PY5 A;  1K3E A;  1CXZ B;  3LUT B;  1CPY A;  3CCU V;  2ARS A;  2CTP A;  1EIY A;  5IYB O;  3CCM V;  3V7R A;  4KXR A;  4QNH B;  3CE2 A;  3PZC A;  3HFZ A;  3LDD A;  1SQV H;  2WA3 A;  4YIP A;  2ZZF A;  1M90 W;  2ZQM A;  1KD1 W;  5GTI Z;  1KP3 A;  1I5X A;  4YDQ A;  1XIL A;  3NR7 A;  3ZJZ A;  4H2X A;  1BZK A;  3N27 A;  1BQ0 A;  2NR5 A;  2N74 A;  1FKA O;  1DGS A;  2CJA A;  1X4T A;  2YS8 A;  5JJN B;  3B09 A;  4FLW A;  1XHX A;  4PA4 A;  3P8T A;  3E8B A;  4UCU A;  3ZHR A;  2ODR C;  2KG7 B;  2Z3Y A;  1EOV A;  4KR2 A;  4D7S A;  1BSM A;  4TQF A;  4GKK B;  1SF9 A;  2A8E A;  3KCY A;  3ASO B;  4R8C A;  3GWK C;  3L73 H;  2UUC B;  4DV1 O;  1RM1 C;  5ITZ B;  3BA8 A;  1SET A;  2ARU A;  2IU3 A;  3NEL A;  2JGU A;  2ADP A;  2EIL B;  3CCS V;  2FML A;  4JV5 O;  4XEM A;  4X62 B;  2EIJ B;  3N2K A;  4RMF A;  3A7R A;  2CJ9 A;  5KHJ A;  3FKS G;  1H2G A;  4PA6 A;  1I94 O;  1JQ0 A;  2XOK G;  1MAB G;  2RCV A;  1EFR G;  1EVL A;  3FAV A;  2BTQ B;  1NI8 A;  2QWP B;  3CRM A;  4HT4 A;  1ARO P;  3CCL V;  1ROP A;  5AG2 A;  4YHH B;  5CB4 A;  4LR3 A;  4I50 B;  4LNS A;  1BS3 A;  2A9H A;  4XDL A;  3VQX A;  3HKD B;  2ZT9 B;  1W66 A;  1ADJ A;  1G5I A;  4JF3 A;  5EYP B;  3ETD A;  1AR5 A;  4FFB A;  3AG2 C;  2P0L A;  4PA7 A;  4TUY B;  1H38 A;  4DV7 O;  3APQ A;  2LQT A;  3JAW B;  4H2S A;  3RIR A;  3FFQ A;  2ZM6 O;  4YRC A;  2ZNJ A;  3H01 A;  4R6Z A;  2C8M A;  4LF9 O;  2AKW A;  3ZRS A;  1IXM A;  4O2A B;  1K4D C;  4JYA B;  5ELO A;  3D36 A;  2FL4 A;  3HY0 A;  1THZ A;  4JTD B;  4TSF G;  4ZHQ A;  4HWT A;  3ABM C;  4JI3 B;  2HHH B;  4MVQ A;  3JSN A;  3RYC B;  1N0J A;  1EM1 A;  1JJC B;  2EIN C;  3HXZ A;  4LVJ A;  2RMK B;  4O4I B;  4XU0 A;  2A79 B;  1WNS A;  2Y0P A;  2QDO A;  4J10 A;  2YIC A;  4TWK A;  4XU2 A;  2AMC B;  1QR8 A;  2QKA A;  4F6R A;  2GTS A;  2DQ0 A;  3UGQ A;  1NJ1 A;  4X1I B;  1FPO A;  3S3W A;  1I0H A;  2MW2 B;  1IVS A;  4RO2 A;  1OCR C;  5J2U B;  1B70 B;  5B66 Z;  4XTY A;  5L3B A;  4B08 A;  4I9Q A;  2V1D A;  3UO3 A;  3V7S A;  2YEV A;  5E3I A;  1L0N H;  3RYI B;  2ZT7 A;  1SES A;  1Y67 A;  3ABK B;  3JAR A;  4E2L A;  3QG5 A;  2RHS B;  4U7N A;  2DTI A;  2YXH A;  1D5A A;  2JGD A;  1B04 A;  3HXV A;  4Z2W A;  1FYJ A;  2EIM C;  5KUK A;  3OTO B;  2GUZ B;  1S77 D;  4PDR A;  2PZS A;  4YRI A;  4NR1 A;  1EN4 A;  1YXB A;  4P3O A;  2HVK C;  1JFF A;  2QM8 A;  1ADY A;  2IJK A;  5C51 B;  3N2G B;  5L3G A;  1OCZ C;  3CCQ V;  1ZWI C;  1DK1 A;  3OMN B;  2R70 A;  5LYJ B;  1JOY A;  4LVK A;  3LSS A;  3JAT A;  1S5J A;  3SJA C;  4X62 O;  1K92 A;  4GZR B;  5KMG A;  2Z5U A;  4B3S B;  2Y4T A;  1WN7 A;  1M57 C;  3BPZ A;  4AQY B;  1OZ0 A;  3A7A A;  3SJC C;  3IKM B;  5B1B C;  4MVS A;  4DV5 B;  3WB0 A;  3FD9 A;  1HTT A;  5IY5 B;  1AVM A;  1XNQ B;  5EK0 A;  4BIZ A;  2HJD A;  1JX9 A;  3JAK A;  4YJ3 A;  4LCU C;  1TUE B;  2DZC A;  4X66 B;  4PJ0 Z;  3CJH A;  4YHH O;  1XBL A;  4X1K B;  4FM2 A;  3BFM A;  2Q9L A;  1K34 A;  2P5O A;  5K1P A;  1X56 A;  2F23 A;  4NVP A;  1SER A;  2F66 C;  3K08 A;  4DRX B;  3IAL A;  1AI6 A;  3MD0 A;  4DV4 B;  5BZB A;  3ZHS A;  2UXD B;  2FYK A;  1H2M A;  4MTX A;  1VQ5 V;  3L4G A;  1W0J G;  4MS2 A;  4X9Q A;  3VQY A;  4DR3 B;  4DV6 O;  4EEQ A;  1T5E A;  1L0W A;  5LHI A;  2E65 A;  3K04 A;  5LA6 A;  3LDE A;  1AIL A;  3AG1 C;  2GDS A;  1LUW A;  2IJJ A;  4HA8 A;  2A3Q A;  4LF6 O;  2XAJ A;  2X7R B;  1E79 G;  2ZDI C;  3NEN A;  1Z7N A;  2CGN A;  3FB6 C;  3HPL C;  2M6Y A;  1SQP H;  1P49 A;  2HHH O;  3JCZ A;  5LGT A;  2DYS B;  4XTU A;  4DUZ B;  1N32 B;  2NN4 A;  3SDL A;  1YJ9 V;  3VQW A;  1X54 A;  4I0X A;  4XTW A;  2VRZ A;  1R1B A;  5EZY A;  1VQZ A;  3W7X A;  3JAL A;  2ATK C;  1DLB A;  2DU7 A;  2P6J A;  3X2Q B;  5J2T B;  2QWR B;  1YI2 V;  2I4M A;  1M9N A;  2JEX A;  3L70 H;  1ZL8 A;  1XI1 A;  2Q67 A;  2HEP A;  5LP6 B;  4PG3 A;  2WSS G;  3ZCC A;  4K0K O;  1OCC B;  4RQE A;  4YRF A;  5B3S C;  4PHC A;  5BY1 A;  4HWO A;  2OCH A;  4OP0 A;  3K59 A;  3CC4 V;  4DV2 B;  3I56 V;  2CTQ A;  2OWO A;  2Q5I A;  3GB7 C;  1R6N A;  3L9D A;  4DO2 A;  5LBQ A;  3ABL C;  2J3L A;  3L2Z A;  4YRP A;  1SRY A;  1GN4 A;  3RL6 A;  4K3A A;  3UT5 B;  2JJ2 G;  4DR7 B;  5B1A C;  4MSW C;  1S5L Z;  3DXR B;  1EZV H;  4DR6 B;  2IJH A;  4RUE A;  1JJO A;  1UPG A;  1QBZ A;  2BOC C;  3HXW A;  5JQG B;  3OR6 C;  4LWS B;  1Y76 B;  1ATI A;  3RF1 A;  3RT3 C;  4I4T A;  5LMN B;  3KCX A;  4N21 A;  5KAF Z;  4LNU A;  3SYC A;  3CMA V;  5FL7 G;  1XNQ O;  2DYR C;  2JK5 C;  1IXB A;  1HNX O;  4LH7 A;  4MTG A;  2DWD C;  4X66 O;  3STZ C;  3SPC A;  3GVM A;  2UXC B;  1Y4M A;  4LVM A;  2X6C A;  5DN6 G;  1RPO A;  4DUY B;  3QF7 A;  1D2D A;  4YYE A;  2P90 A;  4HAM A;  4H2T A;  3ZRV A;  4HVC A;  2UXX A;  3LDC A;  2OCC C;  3AG3 C;  2MK3 A;  2H3O A;  2UXD O;  1B76 A;  1WB7 A;  1E22 A;  1WU7 A;  4K8X A;  5JH7 B;  2RNB A;  2ALY B;  3I5D A;  4DR3 O;  4IIJ A;  1QQC A;  2LO1 A;  2J3M A;  4B7K A;  1KMI Z;  2AZ0 A;  4DR2 B;  5CMU A;  2FKX A;  2QR4 A;  1Q81 W;  2OTL V;  1RFY A;  2Q0A A;  4J41 A;  3T1C A;  1W2B U;  2PYJ A;  4JGS A;  2F4V B;  3M4Q A;  2FTK A;  3ASN C;  3HKB B;  4P9O A;  2LFS A;  4IYH A;  2DEQ A;  2IM9 A;  4Q6G A;  3RKW A;  2X0L A;  4ZOL A;  1TVK B;  4JYB A;  4G27 B;  3D36 C;  1IBK O;  4DW0 A;  1KKC A;  1ZAU A;  1QLN A;  4O4H A;  2QA4 V;  3AG4 C;  3K5O A;  3V8K A;  1S72 V;  1EN6 A;  4PDL A;  1PL4 A;  1NYR A;  1S76 D;  3JD0 A;  4ZI7 A;  3CRR A;  4U3J B;  3OEH G;  5KHK A;  1FD9 A;  1VF7 A;  2GTA A;  5LOV B;  3E22 B;  4XBF A;  2OIG A;  4LP8 A;  4YRL A;  5D5Q A;  2E41 A;  3RVZ A;  3OD4 A;  1B7Y A;  3H1H H;  5EIB D;  2E75 B;  1FXK B;  1J95 A;  1VQP V;  1XDC A;  2V4D A;  1XMQ O;  4YIO A;  1WA8 A;  4UUJ C;  4DV2 O;  5H5N A;  2VQE O;  1VF5 B;  2EIK C;  1SQG A;  3K5N A;  1O9H A;  3QO7 A;  1NYQ A;  3ZHT A;  2NLJ C;  3L1A A;  5C93 A;  1YFS A;  1HW7 A;  4DR7 O;  1HXD A;  2JS3 A;  2DE0 X;  4WBN B;  2PTM A;  4DR6 O;  1C0A A;  1IBL O;  1I94 B;  2QHU A;  4R50 A;  1PPJ H;  1SQB H;  3UO2 A;  1IBM O;  2VWJ A;  3OEE G;  4OX9 O;  4ICG A;  4J9Z B;  3A5Z A;  2DTH A;  2ETN A;  4LVL A;  4O2B A;  5LMN O;  2ILM A;  3K57 A;  1P7B A;  2ZE8 A;  2LW1 A;  1B8A A;  2CH7 B;  1PYS A;  3E8F A;  2B5U A;  3RAC A;  3HFV A;  2CE4 A;  1R6K A;  2Q73 A;  4WFE A;  3TEG A;  2EZP A;  5LHG A;  3A2F A;  4HNA B;  4DUY O;  2K9P A;  4FZ1 A;  4JYC A;  2E64 A;  2XHB A;  4PI0 A;  3WG7 C;  1L0L H;  2DMX A;  1Y74 B;  2QTS A;  2YXY A;  3C3S A;  3M7M X;  2IY5 B;  3SYQ A;  1H4V B;  1ZX3 A;  2ZM6 B;  2QWO B;  1RSO B;  5GON A;  1JJ2 U;  2WLI B;  2IU0 A;  4LF9 B;  4NTY A;  4FIP C;  1YCI A;  1X01 A;  3BRC A;  5JWP A;  1J5E B;  2PMF A;  1F4N A;  1K8A W;  3S3X A;  4YRR A;  4L8J A;  1S0V A;  3PCO B;  1RM1 B;  4B3M B;  4NKG B;  2F4V O;  3A0H Z;  5KHG A;  2QHT A;  1FXV A;  2N05 A;  4I5S A;  1ORQ C;  1VF6 C;  3RGB A;  1XHZ A;  3JCU Z;  1BIB A;  1G5H A;  2ZE5 A;  1K97 A;  1O9G A;  1NJ6 A;  4H2V A;  2IW5 A;  5FNV A;  1EBO A;  3SYA A;  4K86 A;  3E86 A;  3CYO A;  4J42 A;  2XUM A;  1YTF B;  1JMK C;  3CB2 A;  4OLF A;  1KBH A;  1Z7M A;  3IG2 A;  3SGI A;  4KHP B;  2DJV A;  1XRE A;  3R66 A;  3DC5 A;  5L3F A;  4TV8 B;  4CH5 A;  1Q7Y W;  1FFX B;  3EHB B;  2E3C A;  1USY A;  3EFR A;  1W59 A;  2ZIN A;  4PA9 A;  3UCS C;  4X1Y B;  2YID A;  3C3T A;  1BHA A;  2Q5H A;  1GM7 A;  2M7W A;  1Y6X A;  3OW2 U;  4LF5 B;  1G6U A;  2KQX A;  4UFZ A;  2JEU A;  3RFR A;  4WJ4 A;  2ARH A;  1TUB B;  3FYE B;  4EFE A;  2GBO A;  1WPB A;  5EBL C;  5CBG A;  4TV9 B;  4UV8 A;  1VEW A;  4YRE A;  3P30 A;  2I4O A;  5CN0 A;  3V8J A;  3ABU A;  2ZZE A;  1N8R W;  3BAB A;  1B06 A;  1H2K A;  2X6A A;  3BCC H;  1URF A;  4IHJ B;  2DVE A;  1H8E G;  3WB2 A;  3JD3 A;  2WLL B;  3RYF A;  3D3Q A;  1EZJ A;  2CAZ C;  3JAS A;  4BIU A;  4YPF A;  1NJ5 A;  4JAS A;  3SPG A;  4TWA A;  3ABM B;  1HNZ O;  1GTO A;  3P8V A;  5KX5 A;  4E51 A;  1AI5 A;  2YUA A;  1BQZ A;  3VBB A;  4MVU A;  2P67 A;  3DC6 A;  2DJZ A;  5IYZ A;  5IYC O;  1BMF G;  5J9P C;  5CA1 B;  3UH0 A;  4LFA O;  3B8N A;  3TET A;  3R65 A;  4CC6 A;  4TTV A;  4YCU A;  1NTZ H;  5EC1 C;  2BSK A;  4IT5 A;  4DV6 B;  1NNH A;  1P7G A;  3LSQ A;  1K7D A;  5EBW C;  1EFW A;  3MHS C;  1JR9 A;  3ZRW B;  3ICX A;  3K5L A;  5GTH Z;  1XUQ A;  2LW7 A;  2ZIM A;  2A0L A;  1HNW O;  4OPA A;  3OMA B;  2EIM B;  3Q4H B;  1J5E O;  4LF6 B;  2AHZ A;  5BR8 B;  2BCC H;  3ZS8 C;  1HP8 A;  3MDS A;  4MTO A;  2Z0A A;  4I55 B;  2P4K A;  4B3M O;  3PN1 A;  3CHX A;  4X64 O;  2EIL C;  1E1Q G;  2HG5 C;  5H9C A;  4PV1 B;  1K33 A;  2EIJ C;  3CWB H;  2QHS A;  4DR4 O;  3T1H O;  4NXM B;  3OT7 A;  1DF5 A;  3AG7 A;  1EQR A;  4LH6 A;  4KQE A;  3K0G A;  4O4L A;  5IJ9 A;  3CS5 A;  2E10 A;  3OR7 C;  1M57 B;  1SA0 B;  1XQ8 A;  4TVA B;  4WFF A;  5B1B B;  1NU1 H;  1NJ2 A;  3L75 H;  4K0K B;  4KHP O;  1M56 C;  4X20 B;  3T4D A;  4O4J A;  3ZN0 A;  1SQX H;  4FM0 A;  1N0N A;  5FPO A;  3FB5 C;  3P32 A;  4JI0 O;  3HTZ A;  4P73 A;  1ZSP A;  1I5Y A;  5KLV H;  1LNQ A;  1NH2 B;  2QGN A;  4Z1M G;  3NEM A;  4YJ2 B;  3ABT A;  3I55 V;  4LF5 O;  3M8A A;  4RQF A;  1YFR A;  3RYH B;  1GO3 F;  4JI1 B;  3AK3 A;  4R7C A;  4U3F H;  3K3W A;  2DTO A;  1F4M A;  3OD1 A;  2KSD A;  3BFR A;  4YRO A;  3E83 A;  3BHP A;  3E89 A;  5KA5 A;  1LUV A;  5BMV B;  1VQ4 V;  1FFT B;  4JPR A;  3AG1 B;  2YDE A;  4LFC B;  1MOF A;  3TEH B;  2W0X A;  4UVA A;  1E24 A;  1KUQ A;  3U0Z A;  1U97 A;  3HKC B;  4EB6 A;  4AI8 A;  1R3J C;  5LXT B;  1SKV A;  3WFV A;  3A0R A;  1KYO F;  2WWW A;  1HNX B;  2A06 H;  1AP5 A;  1NT2 B;  4IL6 Z;  2DW4 A;  2CTR A;  1L8D A;  1K5Q A;  3MEY A;  4WFA V;  4GKJ B;  2L35 A;  1XOU A;  5LMU B;  1EIY B;  1WP7 A;  3K06 A;  3K79 A;  2HNI A;  4K8Z A;  1P84 F;  2ZXW C;  1MA1 A;  4NXN B;  4KR3 A;  3HFZ B;  1QR9 A;  5C8Y A;  4HWR A;  4NCX A;  4BAY A;  3E8G A;  1N34 B;  2B1G A;  4BW5 A;  3ABK C;  4P3P A;  1YTF D;  4KUM A;  4UCR A;  1YDX A;  4UCS A;  4B3R O;  5C52 B;  1Q8I A;  3HRI A;  3RUX A;  5CBF A;  3D8C A;  3JYC A;  4GCZ A;  4H2X B;  2NS6 A;  4CZZ A;  3TGU H;  5JJE B;  1VF6 A;  4JI8 B;  4PDV A;  3CX5 F;  2RHQ A;  4HBN A;  3H1L H;  5BR8 O;  1X2H A;  3K03 A;  1E1O A;  4XTX A;  2EJF A;  4J9Y B;  5B1A B;  5CA0 A;  2ZKO A;  3HXX A;  3TXS A;  1XL4 A;  1U96 A;  1IBK B;  3A5Y A;  3ETG A;  3MF1 A;  1F51 A;  2QWQ B;  2Q69 A;  1VQ8 V;  3G80 A;  1PM9 A;  4UXN A;  3UFG A;  1UFI A;  2ODM A;  3ZX6 A;  2W6J G;  4J7K A;  3A74 A;  4NXM O;  3HR0 A;  2FYU H;  3MHH C;  4I7Z B;  3RBZ A;  4DV3 B;  5JVD A;  4CS4 A;  5EIB C;  4MW3 A;  5IY5 C;  3N2K B;  1VP7 A;  5IJ0 A;  3G6E V;  3ETQ A;  3BEH A;  4PHZ A;  4CC5 A;  4CS3 A;  5A2Q N;  1BBU A;  1XMQ B;  3HKE A;  3FAV B;  2PI4 A;  2CDY A;  1GM9 A;  2ZD9 A;  3W3S A;  2VQE B;  2YC0 A;  4GX5 A;  2XGT A;  5FPR A;  5L3C A;  1Q90 D;  2KB1 A;  2R9R B;  2V7Q G;  4AH6 A;  4LBE C;  1USY C;  5CB4 B;  1BL8 A;  2XAH A;  4JI1 O;  4DPG A;  4MTF A;  2LJ2 A;  3G6B A;  4QGP A;  2DDZ A;  5ELN A;  3FYI B;  2XAQ A;  1Z2G A;  5L3D A;  1IBL B;  4FFB B;  4O2D A;  2ZT6 A;  3ZBH A;  1IBM B;  1SZX A;  4OX9 B;  4JYY A;  2YSU B;  2LGQ A;  4LFC O;  1RIQ A;  4RDX A;  1TGO A;  5IDJ A;  1WPX A;  1KP2 A;  4FLZ A;  3ASN B;  4JI2 B;  2AKW B;  4IYI A;  3ZMT A;  4LFB B;  2UU9 O;  1S5H C;  2ZR3 A;  3K58 A;  1ZLZ A;  3CXH F;  2YIB D;  3DTU B;  3K9S A;  3UQ8 A;  1GH6 A;  1F7Y A;  4AIL C;  1VQO V;  4ZHQ B;  4H37 A;  1AR4 A;  4P71 C;  4I9W A;  1FYF A;  4JAU A;  4NB5 A;  4GKJ O;  1ENV A;  1RPR A;  3X2Q C;  3H9V A;  2KG7 A;  2Q4P A;  5B5E Z;  1K5S A;  5LMU O;  1YGB A;  1HDJ A;  3K0D A;  3UKM A;  1H8H G;  3BVO A;  1KQS U;  3CSX A;  4NXN O;  1R3I C;  1OCC C;  4NTW A;  2BOB C;  4F6R B;  1Q3E A;  1WJZ A;  5ITZ A;  1N34 O;  3H1J H;  5HFL A;  1Q43 A;  3JD2 A;  4X5O A;  4P9P A;  4EFB A;  4K35 A;  4OXS A;  2K1E A;  3B2E E;  1GK9 A;  1KB9 F;  1XNR B;  4YRQ A;  1H2S B;  2JVD A;  3IC9 A;  2DKG A;  2YEV B;  4JI8 O;  2I4L A;  3MF2 A;  4YP0 A;  3F5W C;  2VWK A;  3JAR B;  4J11 A;  4HWP A;  2Y69 C;  1AB3 A;  4UCO A;  1V55 B;  3BA9 A;  5CBH A;  1NKD A;  4F4L A;  2BTQ A;  3KZI Z;  2JGD B;  3THO A;  3U10 A;  5B1N A;  3SPI A;  2PF4 E;  3SJB C;  4CH6 A;  4ABM A;  1QLE B;  3JSL A;  3O65 A;  3K5M A;  2ZE6 A;  1JFF B;  2EJR A;  4A5U B;  4I50 A;  2P7T C;  2QKS A;  3EXA A;  4X88 A;  5H6R A;  3HKD A;  2UUA B;  4FLX A;  4DV3 O;  3T1Y B;  3ML0 A;  4K88 A;  3JAT B;  5EYP A;  1E1R G;  3J7A U;  3I7F A;  4GX0 A;  4TUY A;  4G2K A;  5KMG B;  1YZB A;  4XTZ A;  3IJ4 A;  3JAW A;  1TA8 A;  4CS2 A;  2YI9 A;  1QF6 A;  2P06 A;  2R72 A;  5FLX N;  2JDI G;  2E5L B;  3VOU A;  4D7T A;  1JA8 A;  1Z5V A;  4RUF A;  5KA6 A;  3JAK B;  2GHY A;  2AGA A;  4YJ3 B;  4O2A A;  1K73 W;  3CJH B; 
#chains in the Genus database with same CATH homology
 4UFZ A;  3RFR A;  4WJ4 A;  1TUB B;  2F95 B;  1D5A A;  4EFE A;  3FJP A;  1B04 A;  3HXV A;  4P73 C;  1WPB A;  2YIB A;  3OTO B;  4CH3 A;  2ZT8 A;  2GV9 A;  4TV9 B;  4YRE A;  2I4O A;  3RYC A;  3V8J A;  2ZZE A;  4HWS A;  2PZS A;  2RJZ A;  4YRI A;  4TOI A;  5JCO C;  3BAB A;  1JJC A;  4P3O A;  4G84 A;  4ZTZ B;  1JFF A;  3SR2 C;  1ADY A;  4O4I A;  5C51 B;  2DVE A;  3N2G B;  4IHJ B;  2ZGW A;  3WB2 A;  5HGQ A;  2AMC A;  3L4G B;  3RYF A;  2R70 A;  3RWR D;  5LYJ B;  2CAZ C;  3JAS A;  1HNZ B;  3LSS A;  2EWN A;  4K87 A;  3JAT A;  4LVK A;  1S5J A;  3SJA C;  4X1I A;  4YPF A;  1I7F A;  2PGG A;  2YI8 A;  1NJ5 A;  4YRM A;  3DSQ A;  5KMG A;  5LA6 B;  1Q5O A;  4TWA A;  4TV8 A;  4B3S B;  4B3T B;  3REU A;  4UCV A;  1WN7 A;  4X65 B;  1FFX A;  4JI6 B;  5J2U A;  1XMO B;  1HR0 B;  1B70 A;  3P8V A;  3BPZ A;  5KX5 A;  4LF8 B;  4AQY B;  4E51 A;  3A7A A;  3SJC C;  1BIA A;  3IKM B;  4DV5 B;  4GYC B;  3WB0 A;  1KU9 A;  1HTT A;  1KMM A;  1XNQ B;  4X1Y A;  3RYI A;  5JJJ B;  3JAK A;  2Q7E A;  3WB1 A;  4Q15 A;  3VBB A;  2RHS A;  4YJ3 A;  2DJZ A;  2P5I A;  4LFA B;  2CJB A;  2QJ1 A;  5IYZ A;  2DZC A;  4X66 B;  1X2G A;  5LP6 C;  3A32 A;  4X1K B;  2R9A A;  4PI2 A;  5CA1 B;  4FM2 A;  1TUB A;  3BFM A;  4UP7 A;  2P5O A;  3HRK A;  5K1P A;  3UH0 A;  1X56 A;  4TV9 A;  4CC6 A;  4O4L B;  5IJ9 B;  4NVP A;  4TTV A;  4XEO A;  4YCU A;  1SER A;  2F66 C;  4FVM A;  4DRX B;  3IAL A;  2PUS A;  4DV4 B;  4DK0 A;  1M5I A;  5EZY B;  4DV6 B;  2UXD B;  1NNH A;  4H2U A;  3LSQ A;  4CH4 A;  2FYK A;  3N2G A;  4IHJ A;  2UXB B;  1HNW B;  1EFW A;  3QTC A;  4O4J B;  3L4G A;  3VQY A;  4DR3 B;  2ZCE A;  3ICX A;  4EEQ A;  1SQF A;  1T5E A;  5LYJ A;  3K5L A;  1LYL A;  1WQ7 A;  3EFS A;  2ZIM A;  2UUB B;  1L0W A;  2ZTG A;  2YXL A;  2E65 A;  4EO4 A;  1HC7 A;  4LF6 B;  5LA6 A;  2BTO A;  5BR8 B;  11AS A;  4X64 B;  2RQ6 A;  4JI4 B;  3ZS8 C;  2EJG A;  3M4P A;  1WPY A;  3REX A;  1H4S A;  4I55 B;  4G85 A;  1KOG A;  2ZT5 A;  4YRK A;  4HA8 A;  3PN1 A;  5D5P A;  3U11 A;  3CHX A;  1FJG B;  1X55 A;  4DR4 B;  3NEN A;  1Z7N A;  3T1H B;  1ASZ A;  3RGL A;  2ART A;  1P49 A;  4P75 A;  4XTU A;  4DUZ B;  1N32 B;  2QHS A;  4X1K A;  3VQW A;  5CA1 A;  1X54 A;  3R07 A;  4XTV A;  3ICA A;  4YY3 B;  3V8L A;  4NXM B;  4XTW A;  4UP9 A;  1EQR A;  1ASY A;  4LH6 A;  4KQE A;  4O4L A;  5IJ9 A;  2PME A;  4DRX A;  3QNE A;  2ZIO A;  2E10 A;  2Q7H A;  1SA0 B;  1XQ8 A;  5EZY A;  4ZIB A;  4DR5 B;  12AS A;  1VQZ A;  4TVA B;  2DXU A;  3JAL A;  4FLT A;  2DU7 A;  1N9W A;  5K1X A;  4EB6 B;  1NJ2 A;  4K0K B;  5J2T B;  4JI0 B;  3MQZ A;  4X20 B;  1WYD A;  4O4J A;  2I4M A;  3RKY A;  4YRJ A;  1XI1 A;  4FM0 A;  4H2W A;  2HEP A;  4I4T B;  5LP6 B;  2KKW A;  5KHI A;  4PG3 A;  5FPO A;  4RQE A;  3HTZ A;  4P73 A;  1YFT A;  4LNU B;  4YRF A;  2EL9 A;  4PHC A;  2G4C A;  4P74 A;  4HWO A;  3NEM A;  3OTF A;  4YJ2 B;  4OP0 A;  2DZ9 A;  4TVY A;  1G51 A;  3K59 A;  4RQF A;  4DV2 B;  1YFR A;  2OWO A;  4I55 A;  2Q5I A;  4XU1 A;  3RYH B;  5C53 B;  2JS5 A;  4JI1 B;  4UPA A;  2DTO A;  3OD1 A;  2J3L A;  3L2Z A;  4YRO A;  2EAY A;  4DV1 B;  3ZED A;  5C8Y B;  3BHP A;  1SRY A;  3UT5 B;  4YRP A;  3RL6 A;  3UGT A;  5BMV B;  4YRS A;  4DR7 B;  2EX3 A;  2F1M A;  4DR1 B;  4TVW A;  3QO5 A;  4LFC B;  4DR6 B;  2DQ3 A;  1SA0 A;  2VQF B;  4JI5 B;  1JJO A;  4JV5 B;  4TVA A;  3TEH B;  3KFU A;  4IIJ B;  4P71 A;  1E24 A;  3HXW A;  2QM4 A;  5JQG B;  3U0Z A;  2RHQ B;  3HKC B;  4EB6 A;  4ZTU B;  4EX5 A;  5J2T A;  2P22 C;  3IAY A;  4X20 A;  5LXT B;  1SKV A;  4FLY A;  2C7I A;  1ATI A;  3HY1 A;  1WLE A;  3RF1 A;  4P72 A;  2OYQ A;  1H4Q A;  4I4T A;  5LP6 A;  1WQW A;  1HNX B;  4UP8 A;  3QO8 A;  1NT2 B;  2DU5 A;  5LMN B;  3E9H A;  5CA0 B;  4LNU A;  4FLV A;  1L8D A;  4YJ2 A;  2ZZG A;  3MEY A;  4LH7 A;  4GKJ B;  4ZOL B;  3RYH A;  2UXC B;  3E9I A;  5LMU B;  1EIY B;  4WJ3 M;  4LVM A;  4FM1 A;  4DUY B;  1Z5W A;  2HNI A;  3QF7 A;  4O4H B;  4BWA A;  4K8Z A;  4YYE A;  4YCW A;  3JAL B;  2PYL A;  4NXN B;  4KR3 A;  1GGM A;  3HFZ B;  4H2T A;  5JVD B;  4B3R B;  5C8Y A;  4HWR A;  4NCX A;  3UT5 A;  4HVC A;  1N34 B;  2XTI A;  5BMV A;  1N33 B;  4DK1 A;  4ZI7 B;  2Q7G A;  1QE0 A;  4L87 A;  4P3P A;  1B76 A;  1E22 A;  5IJ0 B;  4DV7 B;  3HXY A;  1WU7 A;  4UCR A;  4K8X A;  4DQ2 A;  4UCS A;  5JH7 B;  5C52 B;  2ALY B;  5F5W A;  1Q8I A;  3HRI A;  3RUX A;  3P8Y A;  1NJ8 A;  4H2X B;  3TEH A;  2NS6 A;  4IIJ A;  1QQC A;  4YRN A;  3A7U A;  3HKE B;  2J3M A;  4AHC A;  4H02 A;  5IWA B;  5JQG A;  5JJE B;  4YRT A;  4JI8 B;  1KMI Z;  2RHQ A;  3HKC A;  4HBN A;  1B7Y B;  4GLX A;  4DR2 B;  4WI1 A;  5LXT A;  1X2H A;  1TAE A;  1WNL A;  1M93 A;  2Q0A A;  1E1O A;  4XTX A;  2EJF A;  2PYJ A;  4YCV A;  3HXU A;  5CA0 A;  3HXX A;  2F4V B;  3M4Q A;  2E5A A;  3HKB B;  1IBK B;  2PY5 A;  4JI7 B;  3A5Y A;  3MF1 A;  2DEQ A;  2IM9 A;  4Q6G A;  3RKW A;  1QHT A;  4ZOL A;  1YEW A;  1YB3 A;  3UFG A;  2ARS A;  1TVK B;  4KL1 A;  1EIY A;  1ZAU A;  3V7R A;  3A74 A;  4O4H A;  2F93 B;  3IKL A;  3TUP A;  3K5O A;  3V8K A;  3PZC A;  4BW9 A;  4DV3 B;  5JVD A;  3HFZ A;  4CS4 A;  1NYR A;  5EIB C;  5KNN A;  1BBW A;  3CMQ A;  3N2K B;  4ZI7 A;  2ZZF A;  5IJ0 A;  4LVI A;  4U3J B;  4YDQ A;  1H4T A;  3ETQ A;  5JH7 A;  5KHK A;  2ALY A;  3G1Z A;  4PHZ A;  1VF7 A;  4CC5 A;  4H2X A;  4CS3 A;  5LOV B;  1BBU A;  3E22 B;  1XMQ B;  2ZR2 A;  3HKE A;  3NET A;  4YRL A;  1DGS A;  5D5Q A;  2E41 A;  4O2B B;  4LF4 B;  5JCO A;  2CJA A;  1X4T A;  1B7Y A;  3W3S A;  5JJN B;  2CIM A;  2VQE B;  4FLW A;  4J15 A;  5EIB D;  1XHX A;  2XGT A;  5FPR A;  1PYS B;  3P8T A;  2V4D A;  4UCU A;  4AH6 A;  4YRG A;  3VQV A;  2ODR C;  1USY C;  5CB4 B;  4FLU A;  1EOV A;  4KR2 A;  4D7S A;  2ZNI A;  3HKB A;  4TQF A;  4DPG A;  4GKK B;  1SQG A;  2A8E A;  3K5N A;  1O9H A;  5KHH A;  3QO7 A;  1NYQ A;  2DDZ A;  2UUC B;  5ELN A;  1TVK A;  3L1A A;  4P74 C;  5ITZ B;  1IBL B;  1YFS A;  1HW7 A;  3BA8 A;  4FFB B;  1SET A;  4O2D A;  2ARU A;  1E1T A;  1HXD A;  2ZT6 A;  4WF2 A;  1IBM B;  3NEL A;  5GON B;  2JGU A;  4OX9 B;  2ODR D;  4WBN B;  2PTM A;  1RIQ A;  1C0A A;  1I94 B;  3A31 A;  2QHU A;  4RDX A;  1TGO A;  2UU9 B;  4X62 B;  3N2K A;  4FLZ A;  4RMF A;  4XEM A;  3A7R A;  2CJ9 A;  2VWJ A;  3BJU A;  4JI2 B;  4U3J A;  5KHJ A;  2AKW B;  1M4U A;  4LFB B;  3A5Z A;  5LOV A;  2ZR3 A;  3E22 A;  3K58 A;  2DTH A;  1EVL A;  2YIB D;  4LVL A;  2BTQ B;  4O2B A;  3UQ8 A;  3K57 A;  4AIL C;  4HT4 A;  1B8A A;  4ZHQ B;  4P71 C;  1PYS A;  1FYF A;  4P3N A;  4YHH B;  1V9P A;  3RAC A;  3ERR A;  5CB4 A;  3HFV A;  4LR3 A;  3TEG A;  4I50 B;  4LNS A;  4H2Y A;  3A2F A;  1YGB A;  4HNA B;  4P72 C;  1IL2 A;  5FNV B;  3CSX A;  2E64 A;  3VQX A;  2XHB A;  3HKD B;  4PI0 A;  2DXT A;  1W66 A;  3M7M X;  4F6R B;  1ADJ A;  2IY5 B;  1Q3E A;  1G5I A;  5ITZ A;  5EYP B;  3LC0 A;  1H4V B;  4FFB A;  2ZM6 B;  2P0L A;  4XU3 A;  4TUY B;  1Q43 A;  4X5O A;  4EFB A;  5GON A;  3B2E E;  3BAA A;  4LF9 B;  4WBN A;  3JAW B;  1XNR B;  4YRQ A;  1H2S B;  4H2S A;  3FFQ A;  3RIR A;  2JVD A;  3RKX A;  4YRC A;  1X01 A;  2ZNJ A;  3BRC A;  2DKG A;  2C8M A;  1J5E B;  2YIA A;  2PMF A;  2I4L A;  3MAQ A;  3MF2 A;  2AKW A;  4YP0 A;  2VWK A;  3JAR B;  2I4N A;  4YRR A;  4L8J A;  2ZXF A;  4O2A B;  2E1H A;  4HWP A;  4JYA B;  3PCO B;  4UCO A;  4B3M B;  5ELO A;  2QHV A;  3BA9 A;  2BTQ A;  4UCT A;  3THO A;  3U10 A;  5KHG A;  3HY0 A;  3SJB C;  4CH6 A;  2QHT A;  4ZHQ A;  4HWT A;  4JI3 B;  1N36 B;  2HHH B;  3JSN A;  3RYC B;  3JSL A;  1EVK A;  3RGB A;  1XHZ A;  3K5M A;  1JJC B;  3HXZ A;  1KMN A;  4LVJ A;  1JFF B;  1BIB A;  1G5H A;  4I50 A;  1O9G A;  4O4I B;  1NJ6 A;  4H2V A;  4XU0 A;  1WNS A;  4HNA A;  3LNN A;  3WQZ A;  5FNV A;  4XU2 A;  4K86 A;  2EJ9 A;  4TQD A;  2AMC B;  3HKD A;  3RYF B;  2UUA B;  4FLX A;  3T1Y B;  4P75 C;  4F6R A;  4K88 A;  1J5W A;  2IY5 A;  4OLF A;  1JMK C;  3CB2 A;  3JAS B;  4DV0 B;  3JAT B;  5EYP A;  2DQ0 A;  3UGQ A;  1NJ1 A;  4X1I B;  3V7C A;  1Z7M A;  3IG2 A;  3SGI A;  3I7F A;  4KHP B;  4TUY A;  1RSO A;  5KMG B;  4TV8 B;  4XTZ A;  4CH5 A;  4LF7 B;  1FFX B;  3JAW A;  5J2U B;  1B70 B;  1TA8 A;  4CS2 A;  2YI9 A;  5KX5 B;  1QF6 A;  2E3C A;  1USY A;  4B08 A;  2R72 A;  4I9Q A;  3EFR A;  4XTY A;  2E5L B;  2ZIN A;  3V7S A;  2CGH A;  5E3I A;  4D7T A;  1Z5V A;  4X1Y B;  3RYI B;  2ZT7 A;  3JAK B;  1SES A;  2Q5H A;  3JAR A;  2RHS B;  3QG5 A;  4YJ3 B;  4LF5 B;  4O2A A;  5IYZ B;  1G6U A;  2DTI A;  3PCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...