3DSQA

Structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
278
Chain Sequence
PPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolysyl-tRNA synthetase
publication title Structure of Desulfitobacterium hafniense PylSc, a pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
total genus 80
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3dsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3dsqA02
1E22A 2DVEA 2PGGA 2E1HA 4K86A 3P8YA 4YCUA 1G51A 1SRYA 2ARUA 3PCOA 2DXTA 4KQEA 3CMQA 2XTIA 3A32A 1YFSA 2AMCB 2ZIOA 3UGQA 3REUA 2E10A 2CJAA 3A7AA 1EFWA 1LYLA 1NYRA 4BW9A 1H4VB 4ZTUB 4P73A 4LNSA 3HY0A 4XEOA 5HGQA 4Q15A 4Q6GA 1SETA 4H2XA 4K87A 1NJ6A 4TQDA 4YRIA 2ZNIA 2RQ6A 1RIQA 4P71A 4P73C 12ASA 2YI8A 2DQ3A 4OLFA 3QTCA 2AMCA 3LSSA 3A7RA 3KFUA 4O2DA 4P71C 1WQWA 4RQFA 4EO4A 3NELA 2ZINA 3RKWA 1NJ2A 2E5AA 3HXWA 2ZT5A 2DDZA 1BBWA 4BWAA 1EVLA 3VQVA 3HFZB 1NYQA 4UP8A 2ZZFA 4J15A 3V7CA 4P75A 1O9GA 5K1XA 3R07A 2QJ1A 2YIBA 1E24A 4H2VA 2DTOA 4HWPA 4HWTA 2PMEA 3A5ZA 1WU7A 4UPAA 1G6UA 1X01A 5C53B 2DEQA 4YPFA 3A31A 2DQ0A 2I4NA 4CH6A 4ZTZB 3PZCA 1KMMA 3HFZA 2JVDA 1X54A 2I4LA 1BIAA 3RL6A 1WNLA 4CH4A 4YRMA 5E3IA 2IY5B 3LSQA 1E1TA 2QHUA 2ODRC 4YCWA 3L1AA 4TQFA 4HWSA 4YRSA 1NJ1A 2PMFA 2EJGA 4YRGA 4XTYA 3WQZA 1FYFA 4PG3A 4XU3A 4CS2A 4HVCA 1W66A 4TVYA 2Q7EA 2CJBA 2DXUA 4UP9A 4ZIBA 3A74A 1WQ7A 2RHSB 2IY5A 1E1OA 1X55A 3E9IA 4EX5A 2RHQA 1QF6A 4HWRA 4YRRA 4H2WA 3V8JA 1EVKA 2PUSA 3A7UA 3UFGA 3FJPA 4OP0A 3E9HA 3NETA 1YB3A 2E65A 4P3NA 2CJ9A 1IL2A 1QE0A 1X2GA 3HXYA 2Q7GA 3HTZA 4CH5A 1WYDA 2EJ9A 1B7YB 4XU0A 4XTZA 1ADJA 1B70B 5K1PA 2RHSA 3TUPA 4TTVA 3M4QA 1G5IA 4TVAB 2DZ9A 3G1ZA 3RKYA 2ALYB 4YREA 3ZEDA 2QHTA 3V8KA 2ZGWA 1L0WA 1SESA 4XTWA 4WJ3M 4P72C 1H4TA 2DZCA 2ARTA 4RDXA 3A5YA 4P3PA 3OD1A 5F5WA 4YRFA 1G5HA 1HC7A 4YYEA 1B7YA 1B70A 3QNEA 3BHPA 2Q7HA 4XU2A 1C0AA 3DSQA 1YGBA 4G84A 4TVAA 4UP7A 3EFRA 4YP0A 1ASYA 3UH0A 4WF2A 1X2HA 1SERA 2R70A 3IG2A 3HY1A 3W3SA 2AKWB 1PYSB 2ZT6A 2EWNA 1GGMA 1KMNA 1ADYA 3MF2A 2YI9A 2QHVA 4XU1A 4YRQA 4RMFA 3I7FA 2P5IA 1NJ5A 1USYC 3QO5A 3QO8A 4HWOA 1X56A 2Q5IA 4H2YA 3VBBA 3RUXA 3TEHB 3PCOB 3IALA 2ZR3A 3EFSA 3MF1A 2E41A 4KR3A 1EIYB 4CS4A 2AKWA 1PYSA 2I4OA 4YRCA 4P3OA 3BJUA 2R72A 3HRKA 2ZTGA 1H4QA 3HFVA 3HXZA 2E3CA 4H2XB 3LC0A 3TEHA 3ERRA 4YRLA 4E51A 4KR2A 4WI1A 3VQYA 1EQRA 3HXXA 4P74C 2HNIA 2ZZEA 4AH6A 4YRJA 4XTVA 3IKLA 4DQ2A 3NEMA 1EIYA 4CS3A 3NENA 2EL9A 3L4GB 1EOVA 3QO7A 4PHCA 2CIMA 5KNNA 1BBUA 3BFMA 2RJZA 2EJFA 4H02A 4H2TA 3UGTA 4P72A 1B8AA 2I4MA 4XTUA 3V7SA 2DTHA 3RKXA 1KOGA 1B76A 2FYKA 2ZR2A 3HXVA 1BIBA 1ASZA 2Q5HA 2G4CA 4YRNA 3V8LA 2DU5A 1J5WA 4YRPA 3P8VA 4TVWA 2YIBD 3L4GA 3ICAA 4H2UA 3HRIA 5ELNA 2J3LA 3M4PA 4G85A 3RF1A 3RIRA 2YIAA 1JJCB 1YFRA 2P0LA 1N9WA 3RACA 3VQWA 4K88A 1HXDA 4YRKA 3HXUA 5C51B 1WLEA 2C7IA 2ZZGA 11ASA 2ODRD 3P8TA 2ALYA 1USYA 1WPYA 4YRTA 3RGLA 4H2SA 4WJ4A 2J3MA 4CH3A 4YROA 2ZCEA 4L87A 1O9HA 4X5OA 4XTXA 3VQXA 1HTTA 2XGTA 4XEMA 2EAYA 2HEPA 3TEGA 5C52B 2ZXFA 3V7RA 4NCXA 4P75C 1NNHA 4DPGA 1JJCA 5ELOA 4RQEA 2C8MA 2DKGA 1H4SA 4YDQA 2DU7A 1Z7NA 2ZT8A 3REXA 2ZIMA 2DTIA 4YCVA 1YFTA 2DJZA 3IKMB 4TWAA 2ARSA 2QHSA 3MEYA 2RHQB 2ZT7A 1Z7MA 2CGHA 4HA8A 2ZNJA 1VQZA 1ATIA 4P74A 3L2ZA 1NJ8A 2E64A
chains in the Genus database with same CATH superfamily
2ADQB 4MTXA 1P49A 1CEZA 4YCUA 1YTFB 4ZKIA 4JI1O 4N23A 3CRMA 3U11A 2HJFC 4LF8B 3PCOA 3UO3A 2DXTA 1DLBA 3D3IA 4O2AA 1GN2A 3C3TA 2MK3A 2ZIOA 1GH6A 2WLMA 1PL0A 1W2BU 3REUA 3EXAA 3H1IH 1TUEB 2E10A 3ABLC 4LFAO 1EFWA 4LBEC 2F4VB 1NYRA 2A0LA 4BW9A 4ZTUB 4XEOA 1DK1A 3RYIA 1FJGO 4FLZA 5HGQA 4Q6GA 3L72H 1NJ6A 1K33A 3BPZA 1FFXA 1VQNV 3E86A 5L3EA 4MS2A 2HHHB 1LUVA 1RIQA 3CMAV 2UUAB 2F93B 3OUSA 12ASA 2YI8A 5FPRA 5JCOC 2AMCA 3A7RA 3DXRA 3LSUA 4YIOA 2B1IA 5DN6G 3FKSG 4O2DA 3ASOB 2Q6AA 2QSAA 4E2LA 1FFTB 3OR6C 4EO4A 1XEQA 4H37A 3NELA 4DR4O 2ZINA 2UUCB 5IT9N 5E79Z 4DV4O 4HYOA 4DRXB 1NU1H 3FAVB 2IH3C 2VQEB 2DDZA 3ZHQA 4BR6A 4O2BA 4BWAA 4KUMA 4PJ0Z 2IJIA 4HNAB 3IJ4A 3HFZB 1NYQA 1KP3A 3K5OA 4P75A 1NTKH 2ETNA 3P30A 2B9ZA 5GTHZ 4RUEA 4DR2O 2YIBA 2RMKB 3ZIAG 4HWPA 4AILC 4E4EA 5EIBD 1Z5WA 5CA3A 3CCJV 1WB8A 2L6LA 1VQ6V 4DR5O 2ZE6A 3CCUV 1XMOO 2L35A 2EULA 5LBQA 2DYRC 2O57A 2WA4A 4YPFA 2DQ0A 3KZIZ 5B5EZ 1K5SA 2WA3A 1KD1W 1N32O 2JVDA 2NLJC 2OT5A 1BIAA 4ZHQA 3LNMB 3IGAC 1KQSU 1ZTEA 5BR8B 3BVOA 5E3IA 2IY5B 3AG3B 1S77D 2LFSA 2RCVA 2P4KA 4JYAB 1BE3H 1NJ1A 5IJ0A 1MOFA 2E76B 2P22C 1FYFA 5DEDA 5LHGA 2Q4PA 2WLIA 4DW1A 4LF6B 4JTCB 2EIKB 3K08A 4PHZA 1HNZO 3CCVV 1SQGA 4ZBMA 3JALB 3UQ8A 5J2UA 1EN4A 1R6KA 1KKCA 2NN4A 2ZDIC 2JGDA 4BAYA 2VQFO 4MVSA 4J11A 4X1IB 1H2GA 4FZ0A 2P6JA 1YSCA 5B3SB 5JQGB 1GRJA 2RHQA 2WLLB 3OMAB 4DV2B 4HWRA 3ABMC 4O4JA 4H2WA 1SZTA 2QWPB 5JCOA 3A7UA 1IBLB 3BEHA 3TETA 1F7YA 4OXSA 4OP0A 4UXNA 2GUZA 3DGEA 2JS5A 3NETA 2LJ2A 4G28B 4WFEA 3BAAA 4JI3B 4I4TA 1D5AA 5J2TB 4NXNB 2CJ9A 1QE0A 1NI8A 4GX2A 1BL8A 3HTZA 4CH5A 2LFRA 1K73W 1JJOA 1TAEA 2BSKB 4XU0A 2R9AA 4XTZA 2ZM6B 2FTKA 3AG1C 3G6BA 3M4QA 1G5IA 5LMNB 1D2DA 4TVAB 3AK1A 1JR9A 2IJHA 2PI4A 1QCEA 1FXKB 1RSOA 1OCRB 3RKYA 2ALYB 4DXWA 1WP8A 4JI7O 2A8EA 1UJWB 1SESA 1R3IC 5HFMA 3ZHRA 4P72C 3HKBA 5BMVB 5JH7A 5LP6B 1FXVA 4IT5A 4JTAB 4TV8A 1I5XA 2EJRA 3CB2A 3L71H 4YRFA 1DF4A 1QR9A 1PM9A 1XOUA 2W0FC 5IJ9A 3BHPA 3F5WC 4XU2A 4UB6Z 4PDMA 5JVDA 2HVJC 1YGBA 1V55B 3EFRA 1OZ0A 4WBNB 1BCCH 3UH0A 1X2HA 4DV6O 4G27B 1F23A 4FLYA 3IG2A 3SYQA 4ZOLB 1K4CC 3B8MA 4FLXA 1GGMA 2AXTZ 1KMNA 5JJEB 2OCHA 1TVKB 1PPJH 3E35A 4YHHB 3CCRV 1ADYA 3MF2A 1XNQO 4RMFA 3A2FA 1OCCB 3DC6A 2HJDA 1USYC 5CBGA 3QO5A 3QO8A 4HWOA 1IBMB 1K4DC 4DR1O 1AI7A 5EYPA 1AILA 2YEVA 4QE9A 5F2VO 1OCZC 2ZDIA 5IYBO 1Q5OA 3EFSA 4OPHA 3FYEB 3R65A 3JD3A 3MF1A 5L3DA 4LF7B 2Z3YA 4WFHA 2G38A 3RYHB 5KAIZ 4YRCA 2I4OA 3RFRA 1K97A 1N34B 1X4TA 2QKAA 2Y4UA 3E22B 5KX5B 3OMIB 2A9HA 4F6RA 5IWAO 1AJPA 3LC0A 4YRLA 1TGOA 4C7UA 3OFNG 1ZAUA 2QWQB 1NT2B 4W4KA 1EQRA 3GWOA 3OD4A 2HNIA 4K0KB 1AI5A 4ABMA 4AH6A 4XTVA 1BT8A 5H5NA 2YXHA 4DQ2A 1N36B 3NEMA 3ETGA 1P84F 2VS0A 2Y48A 2E5LB 1RPOA 3ZS8C 3SPCA 3L4GB 2CK3G 4AQYB 2GV9A 4J80A 1NKDA 3T1CA 3ZX6A 4DR3O 4LWSB 4B3MB 2MW2B 1A32A 3SPIA 5KHKA 4H2TA 4EFEA 5D5PA 4UVBA 3TXQA 4P72A 2ZE7A 4FLUA 2DTHA 1B76A 2V1DA 2FYKA 5ITZA 4FLWA 1ZWIC 1ASZA 1EZJA 4DV1B 1MMMA 4YRNA 3O65A 4MVQA 3P8VA 4DR7O 1SF9A 3X2QB 2B1GA 2QTSA 1KYOF 1VQ7V 1QVGU 4DO2A 4G85A 3CXCU 3RIRA 2F66C 1JJCB 1KUQA 5KMGA 5FNVB 1JVMA 2EZPA 1YFRA 1RM1B 1TUBB 4K88A 1HXDA 4UVAA 1Q3EA 4LH6A 1WLEA 2C7IA 3BA9A 1VQLV 2XNDG 3P8TA 1MSWD 5B1OA 1USYA 1WP7A 3RWRD 1WPYA 4KXRA 4TSFG 3T1HO 2A79B 1KU9A 1XBLA 3VQXA 3W7SA 4XTXA 1JCHA 1L8DA 4JGSA 1SQFA 4I9QA 3UKMA 5CB4B 1XQ8A 4JI8O 4JI0B 1W0KG 1H2KA 2C8MA 2DKGA 1NH2D 3NXSA 4LFCB 4B3RO 1H4SA 3MQZA 1Z7NA 3B8NA 4TUYB 2ZT8A 1VF5B 3REXA 2JS3A 1MABG 1YEWA 3E8HA 4KHPB 4YCVA 3CC2V 2D3OW 2ZKOA 3K59A 4MT8A 4TWAA 1AJQA 4X64B 1K5QA 4DR6O 2QHSA 1I5YA 3OT7A 3P3NA 4X20B 5CMUA 4GYCB 1Z7MA 1ZLZA 2XASA 5LA6A 4HA8A 2VWKA 4I0XA 4RWUA 2DVEA 4K86A 1GM7A 3P8YA 1SRYA 2EIJB 3MHHC 2CTRA 1N0JA 5LHIA 3CMQA 5A2QN 1YFSA 1B06A 1HDJA 3CWBH 4NKGB 5LMUO 5CBFA 4EFBA 1B3QA 4TT3G 2CJAA 3ABUA 1GO3F 3D3QA 1ZL8B 4LVMA 1H4VB 4P73A 4K8XA 2CTQA 5LXTB 1PNLA 4Q15A 3G4SV 1VQ9V 4UV9A 4H2XA 4K87A 4UFZA 4TQDA 3LDEA 4J7ZA 4NXMB 2RQ6A 4DUZB 4P71A 4NTXA 4JI5B 1SA0B 1HR0O 5GONB 3MAQA 2DQ3A 3L73H 4O4LA 3QTCA 1AJNA 3LSSA 2QTOA 2BTQB 3QVNA 3M99B 3KFUA 1IURA 1Q6IA 3DC5A 2ZXWC 2JDIG 1IDSA 2EIKC 1WQWA 4RQFA 4U7NA 1BMFG 2K1EA 3WU2Z 2E5AA 1XMQB 5IY5C 5AG2A 3SYAA 4UUJC 4DK0A 3HXWA 3CJHB 4NR1A 1Q81W 3CPWU 1EVLA 2DW4A 4PA4A 2GBOA 3VQVA 2P4VA 1S76D 3SPGA 2ZZFA 4J15A 1S5HC 3KG2A 5K1XA 1OHHG 4QPJA 3K3WA 5EBMC 2UXBO 2DTOA 2UXNA 4LC1A 3EFFK 2DYSB 3UT5B 1HP8A 2Q0OC 2Y4TA 3AG2C 5LGNA 4JZGA 3A5ZA 2CE4A 3HKEA 3B4SA 1T5EA 3ZRWB 4B08A 2XAHA 3TXSA 1MNGA 4UPAA 4DRXA 1G6UA 3FAVA 4ZI7A 2DEQA 2NNUA 1QR8A 4X8AA 1LR1A 4HNAA 1H2LA 1X54A 4IIJB 2I4LA 1FXKC 3HFZA 2WSSG 1NJIW 1FD9A 3MD0A 4NB5A 4YY3O 3CCMV 1M93A 4CH4A 2V4DA 4YRMA 1U97A 3LSQA 2ODRC 4YCWA 3K5LA 4L8JA 3L1AA 1H2NA 5L3GA 1I94B 4TQFA 5LOVB 4HWSA 3JD2A 3ZRXA 4LVLA 4XTYA 1XREA 2BTOA 1JQ0A 2PY5A 1EBOA 4JYCA 3T4ZA 1BQ0A 3RN4A 4CS2A 4HVCA 1W66A 2OTJV 3OUFA 1HNXB 1B6QA 3FB5C 4NVPA 2KQXA 4B3TO 4TVYA 1ROPA 1KBHA 4DK1A 2FMLA 3W7XA 4LFAB 2CJBA 3W7TA 1P7GA 1JPXA 1B04A 2KKWA 4ZIBA 4BIUA 4O4IB 2VWJA 2RHSB 2IY5A 1FJGB 5JJNB 1M90W 1E1OA 4FMTA 4P9OA 4AHCA 1X55A 3K0GA 2Y0PA 1SQXH 3RYCB 4F4LA 1OCCC 5E1AC 1CPYA 2EILB 4LNUB 5KHIA 3E9HA 1QU7A 3TK1A 2FL4A 3JSLA 2E65A 3JALA 3OM3B 5EC1C 5B1AB 3GWKC 3MDSA 2DOSA 2OCCB 4X1IA 2W6IG 2Q5ZA 3JSNA 4JI6O 4DR4B 2EJ9A 1M9NA 3M7MX 3N2GA 2F4VO 1B70B 2WLJA 5JQGA 2OYQA 1K3EA 1VQOV 2CH7B 3J81N 3TUPA 4DV4B 4WFFA 1IXMA 2WLLA 2RDCA 3JD0A 4F6EA 4RUFA 5BZBA 2Q73A 2HHHO 4YREA 1RFYA 3V8KA 2UUAO 1L0WA 4UCOA 1SQPH 2HR3A 4CBCA 5GTIZ 4GKKB 5J2TA 2DZCA 3U10A 3AK2A 3CMEV 1YHQV 2IH1C 3A5YA 4K35A 5JJJB 1S3JA 4JAUA 5F5WA 3H1JH 4YYEA 5CN0A 2PTMA 5C93A 2BSKA 1QLEB 3ZHSA 1XI1A 1J5EO 3ZN0A 2UUCO 1C0AA 1PNMA 2IJJA 1XMOB 4TVAA 3C90A 1NH2B 2BCCH 2VQEO 1FXKA 3SJAC 2DE0X 2UXDB 3SDLA 1N32B 3HY1A 2XUMA 3W3SA 2AKWB 4GKJB 2ZT6A 4DV0O 2P5OA 4Z2WA 5BMVA 5LP6A 4YRQA 1US6A 1ZX3A 5IYCO 4D6TH 4YXWG 2OTLV 1VQMV 2CUGA 2JK5C 5IDJA 3PCOB 4LVIA 4I7ZB 1Y76A 1HNZB 4WBNA 3JAMN 2WLNA 1L1FA 5H6RA 3CCSV 2VQFB 5EIBC 2FB5A 1EN5A 3H01A 1GN4A 1EIYB 5KUKA 4ZOLA 4ASUG 2PF4E 3BJUA 1AVMA 2JJ2G 1TVKA 4X66B 5KA5A 2UU9B 1DGSA 1H4QA 3HFVA 3JAKA 1I0HA 1YJNV 3EVKA 1XNRB 5KLVH 3B77A 4UVCA 5BXZA 3OTOB 3E2EA 3FD9A 1NTMH 1K7DA 1VF6A 4PELA 3T2MA 2RNBA 3WG7B 4I55A 4PI0A 4WI1A 4P74C 4YRJA 4LF6O 4MVRA 3B09A 4DV5B 4FPPA 2BOCC 3RYHA 2AW9A 4LF4B 2PYJA 3THOA 5B1BC 3BCCH 2EL9A 3KCYA 5DECA 2H8PC 5KNNA 1KB9F 1LUWA 2DJVA 5KX5A 4X1YB 4Q20A 2GTSA 3HKCB 4A5UB 3APQA 3C3SA 3K5MA 1IBLO 4XTUA 2IM9A 3HKDB 4JYYA 3V7SA 3RKXA 1VQPV 2EBOA 3P3PA 4IYHA 3MHSC 1MSDA 3HXVA 4JI3O 1QLNA 1N4CA 1BIBA 2Q5HA 4NXNO 2G4CA 4JYBA 1LNQA 4WFBV 1N33B 4FLTA 1S5LZ 4UB8Z 3RVYA 2IBZH 5LGTA 3L4GA 2P06A 2LQTA 1M1KW 4JI2O 1WA8B 4NTWA 3W7UA 4HT4A 2DWEC 3G67A 4H13B 2ZM6O 5ELNA 2LW7A 3M4PA 4LWSA 2F43G 2P0LA 1N9WA 3BY6A 3ABKC 4DV6B 1UFIA 4DV3O 5C51B 3HXUA 3CE2A 3U0ZA 2ZZGA 11ASA 2P67A 1VEWA 3ZHUA 4WJ4A 1ZUQA 4P2ZA 2XT9A 1K34A 4OX9O 4YROA 3WB2A 2UUBO 4X5OA 1NTZH 2GTAA 3I5DA 4LF9B 1HTTA 3ZMSA 3L75H 3TEGA 3V7RA 4DR1B 4NCXA 4TOIA 1NNHA 4QJFB 3FFQA 1JX9A 1JJCA 2HFEC 1P4RA 2PI5A 5B1NA 2WLIB 2M7WA 4R7CA 1PV0A 3ABLB 4TV9B 4LH7A 1TUBA 2DU7A 4J7JA 2H3OA 2Z5UA 3SGIA 1K92A 4JI4B 3L74H 2ZIMA 1H8HG 5EZYB 2DTIA 4J42A 3ASNC 2K9PA 4H0LB 4PDRA 1M5IA 4PA3A 4YHHO 5IYZB 1ZSPA 1HNWO 4P9PA 4JV5B 1GM8A 2W6JG 2RHQB 2QEXV 4O4JB 5H9CA 5IWAB 1KKDA 3A0RA 1QVFU 3SJQC 4P74A 4Z1VA 1IBMO 1AR4A 3OTFA 2E64A 5CB4A 2PGGA 2E1HA 4MW8A 3ZRSA 2Q68A 1G51A 1M4UA 4CZZA 2DYSC 4LP8A 4KQEA 3D8CA 4TUYA 3A32A 4LF7O 3UGQA 4U3JB 2HG5C 2ILMA 5LYJB 1W0JG 3PN1A 1N34O 3G6EV 2Y69B 2P90A 3A7AA 4X20A 2AZ0A 3SJCC 4LNSA 1L0LH 4P30A 3HY0A 3APOA 3ZBHA 4FM1A 1SETA 2QM8A 5BY1A 3LDCA 1R1BA 2XAJA 3JASB 3HR0A 3T1YO 3K9AA 2N04A 1YDXA 4P73C 3WB1A 3ZHTA 2W0XA 4LFBO 4B3SO 4OLFA 4I50B 1N36O 4DR7B 4TV8B 3E8FA 2E5LO 4X62B 1V9PA 3PJSK 4AQYO 3ZMUA 4P71C 1CXZB 5IJ9B 2AZ2A 1R6TA 3CRRA 2DYRB 3FB7C 2EINB 5JVDB 1ZL8A 1YF2A 4LF5B 4CC6A 1KP2A 2BE3A 1NJ2A 5LXTA 1NS1A 3HPLC 3JATA 4DV7B 1Y74A 5KHGA 1TA8A 4K3AA 1MA1A 4JPRA 1PP9H 1BBWA 2YXLA 3A0BZ 4JZ2A 5GONA 2A3QA 3N27A 1BSMA 1GTOA 2BTQA 4Z1MG 4X65O 2KG7B 4D7TA 4EKWA 3R07A 1E24A 4EB6B 4H2VA 4U7OA 1YZBA 2QWRB 3I56V 4JI8B 1JA8A 1QNMA 5KHJA 4KP4A 1GN6A 4LCUC 3L9DA 4B3RB 1XL6A 1IZ3A 3OR7C 2OCCC 3STLC 1WU7A 4UCRA 2EX3A 2WLKA 3ASOC 2BOBC 3S3WA 3CJHA 1X01A 5C53B 2YC0A 5CA1B 3A31A 3UCSC 3ABMB 2UXCO 3PZCA 5L3FA 2IW5A 1I7FA 4DUYO 4N21A 3E8GA 2N05A 3RL6A 2ATKC 1Q6UA 4GUNA 2PYLA 1X59A 2CAZC 1JFFB 4J9YB 1E1TA 3ZMZA 1Y4MA 1AB3A 3UT5A 2CGNA 2Q69A 1G4YB 1AR1B 4JI0O 2EJGA 4YRGA 3D36C 3ZRWA 5C8YB 3FB6C 4J10A 2ITCC 4WCEV 1NBMG 3AG1B 1F4MA 2Q7EA 5LMUB 3CS5A 4QE7A 4YJ3A 3OMNB 3SR2C 2DXUA 4UP9A 4IIJA 4UCSA 3A74A 4X64O 1XDCA 1SQVH 1WQ7A 3ETQA 1YJWV 3CD6V 4JAVA 3RYFB 4EX5A 3E9IA 1QF6A 5FPOA 4YRRA 3V8JA 4MW3A 5LOVA 1GAXA 2PUSA 5LHHA 3J7AU 2ODMA 3UFGA 3FJPA 3N2KB 4FFKA 2OWOA 3AG3C 3K5NA 4LR3A 3CCLV 3B2EE 4AI8A 4H33A 1NR7A 1YITV 4P3NA 2ZE5A 3SPHA 1X2GA 1XHZA 3HXYA 3CSXA 2Q7GA 2ZQMA 5L3CA 4EEQA 1B7YB 1Y66A 1ADJA 5K1PA 2RHSA 2Q9LA 2C2AA 4TTVA 2N74A 3JCUZ 4ICGA 1NR1A 3RYCA 1R3JC 2F1MA 3G71V 2DN9A 4LNUA 2QHTA 5B3SC 4DUZO 3AEIA 4KL1A 4JI5O 2ZGWA 5FLXN 4WFAV 4JTDB 3S3XA 4YJ2B 2YS8A 3K57A 1SKVA 4RAIA 2KSDA 4MVMA 4P3PA 1OCZB 3CEIA 3JAWB 5LL6Y 1IBKO 1HC7A 5EBLC 4FM2A 2HKOA 1B70A 3FYIB 4XDKA 2Q7HA 2DMXA 2CH7A 1AR5A 4G84A 4UP7A 5CA0B 4MTOA 3QF7A 1K8AW 2Y0IA 4FFBB 1Q8IA 3STZC 3DTUB 4UCUA 3A8TA 5KHHA 1PYSB 2NS6A 5FL7G 4GX0A 2YI9A 2QHVA 3I7FA 3GVMA 1OCRC 2P5IA 2QKSA 4FLVA 3D36A 2XAFA 3IAYA 4H2YA 3VBBA 3RUXA 3TEHB 1S5JA 5LP6C 3BFRA 4JI1B 2ZR3A 4B3TB 3ZHVA 2DWDC 4KR3A 2ZE8A 2NR5A 1EM1A 2AKWA 4P3OA 1V55C 3LNNA 3WB0A 3HRKA 2ZTGA 1F4NA 2QGNA 1BQZA 4O4HB 3IC7A 2Q67A 3OGCC 3EHBB 4H2XB 1I94O 5EK0A 4KR2A 3IC9A 3HXXA 4O4LB 1BZKA 4X1KB 2ZZEA 4X9QA 4LF8O 1HNXO 4FVMA 2HP8A 1IVSA 3JD4A 1EIYA 1VF6C 4HBNA 3LUTB 4JI6B 2FYUH 1RPRA 4IL6Z 2CIMA 3CX5F 5KAFZ 4IHJB 2GHYA 1BBUA 2QA4V 4BIZA 1BHAA 3ZRVA 2E75B 1QBZA 3CP1A 1KC8W 1XL4A 2RJZA 4H02A 1B8AA 2I4MA 3QG5A 2XAQA 1KOGA 1I08A 5H2FZ 1Q90D 1GM9A 4PI2A 4WF9V 1FS0G 1M57B 1SS3A 1BGYH 3VOUA 1HW7A 2JIZG 3V8LA 4DW0A 1J5WA 4DR2B 4QNHB 3JARB 1FAFA 2E74B 1J5EB 4J7KA 3HKEB 3HRIA 3RW0A 2J3LA 2LO1A 3RF1A 2YIAA 4CC5A 4X1YA 3HKCA 3RACA 4DR5B 4ZI7B 1ORQC 2Y69C 1NZ6A 3VQWA 1PNKA 3HKDA 2AGAA 1Q82W 4YRKA 1N8RW 1R6NA 4MVZA 4DV0B 2ALYA 4GX5A 4D7SA 4GKKO 3CYOA 2J3MA 3ETEA 2XTAA 1AI6A 4L87A 4PV1B 1FYJA 1WA8A 2ZXFA 3Q4HB 3G80A 1YI2V 4YIPA 4PDLA 1WAZA 1FXHA 5ELOA 1AI4A 3ZCCA 4H44B 4RQEA 1UPGA 3JYCA 4YDQA 3SYPA 3ML0A 2EINC 1VQ8V 4O2AB 3X2QC 2KB1A 2UXDO 3CRQA 2VRZA 1OV9A 4GKJO 1SQQH 3H9VA 2DJZA 1RM1C 4KFMA 1Q86W 2QDOA 2AHZA 2ARSA 3MEYA 3IFXA 3P32A 5BR8O 2ZNJA 1VQZA 3RYIB 3L2ZA 3CXHF 1NJ8A 3SYCA 1E22A 4JYAO 5LGUA 1FFXB 1PKXA 4I5SA 2ARUA 2ZXWB 1OJHA 1E79G 4UCTA 4TV9A 1M56B 2XTIA 2AMCB 3UO2A 1V54B 3DXRB 5EZYA 1Y6XA 1GN3A 5IY5B 4HAMA 1GK9A 3N2GB 1WPXA 5IYZA 4X66O 2UU9O 1LYLA 3E22A 1XNRO 1VF7A 1W59A 1KMIZ 3OTOO 4OPAA 4DV2O 2WPDG 2EIMB 2IJKA 4YRIA 4O2BB 2ZNIA 4BIOA 4GZRB 4JI7B 2YSUB 1AP5A 3AG2B 3ZJZA 2R9RB 2CGOA 4DV5O 3TGUH 4JF3A 4U3JA 3E89A 4JI2B 4LF4O 5LYJA 3WFVA 4WFGA 1NQTA 2EIJC 3AG4B 1MZFA 3NR7A 1U96A 3W7WA 4NYKA 3CRCA 2PZSA 1S72V 3RKWA 3AG7A 1HWYA 2HLDG 3E83A 5EC2C 3ZMTA 3I55V 1OCOB 2JEUA 4XBFA 5LMNO 2ZT5A 4DV3B 1D5NA 3JASA 1PD3A 1BS3A 1WNSA 1NVPB 4OX9B 4TWKA 2IU3A 3CHXA 4UP8A 3V7CA 4ZHQB 2UUBB 4I50A 3RVZA 1N33O 1O9GA 2X6BA 4NTYA 1XNQB 4LVKA 3ABTA 1DTOA 2QJ1A 2YICA 3CRAA 3K79A 2LP7A 4HWTA 1H2MA 2PMEA 5IJ0B 3B40A 1Y76B 1ENVA 5FNVA 2QWOB 1WN7A 2F95B 4PDVA 2Q0AA 5J2UB 2JGDB 2I4NA 4UCVA 4CH6A 3JD1A 5EBWC 4ZTZB 1MG1A 1G8MA 1HNWB 1KMMA 3K0DA 2Q8VA 1WNLA 3JAKB 4MVUA 2ZT9B 2KG7A 4EB6A 4LF9O 2QHUA 3RBZA 2CDYA 1H8EG 1YXBA 4YRSA 5J9PC 4I55B 4HZ3A 4R6ZA 2PMFA 1IX9A 4J9ZB 4RO2A 3OEHG 5IE9A 3WQZA 2GUZB 1VQ5V 4PD4F 4PG3A 5HFLA 4BW5A 1JOYA 4XU3A 2LGWA 3M8AA 2X6AA 4I4TB 3RT3C 4IGGA 4JI4O 5CA1A 1VMGA 3K06A 2EJ7A 4JV5O 3BRCA 4QGPA 1CP9A 1JFFA 3GB7C 4DR3B 1QHTA 3HB3B 2WLHA 1EVKA 3T1YB 3LDDA 3F7VC 2GSMB 3OAAG 1YTFD 1F51A 1RSOB 3H1HH 4LFBB 2XAGA 4B3SB 3K03A 1YB3A 3OW2U 5C8YA 1GMGA 3HKBB 2F23A 4K0KO 5JH7B 1IL2A 3CCEV 3KKYA 2QE7G 3F7YC 3FX7A 5D5QA 3TJTA 1WYDA 2LW1A 3E8BA 4QIWF 5KA6A 1Y67A 3RYFA 4XDLA 2DZ9A 3G1ZA 3T4DA 2P7TC 4B3MO 1JJ2U 3K04A 3N2KA 1BHBA 1VQKV 1FKAO 3ZEDA 3L70H 2JGUA 1MZEA 1RP3B 3OEEG 4XTWA 4WJ3M 4X65B 1H4TA 4R8CA 3T1HB 1SC5B 1SA0A 2ARTA 1YVWA 4RDXA 2M6YA 3AK3A 1VP7A 2JEXA 4DV1O 4FM0A 1H38A 4X62O 3OD1A 2A7WA 2EILC 1G5HA 4R50A 1B7YA 1Z2GA 3QNEA 4LF5O 2X0LA 5EYPB 1E1QG 5B1AC 2YEVB 2RN9A 3DSQA 2WAMA 4DV7O 4MTFA 4YP0A 3F5TA 1ASYA 4FIPC 4WF2A 1VQ4V 1Q6HA 1SERA 2R70A 2UXCB 1Q7YW 4DUYB 4I9WA 2EWNA 1N0NA 4PA6A 4YJ2A 2B5UA 1EZVH 1R3LC 4QPKA 4DR6B 4XU1A 4FJCC 2ZD9A 5CBHA 4K8ZA 1COWG 3JAWA 1NJ5A 2XOKG 3SYOA 4GLXA 1M57C 4F6RB 1X56A 2Q5IA 2GDSA 1JMKC 4MVOA 4U3FH 3K58A 5B1BB 2ITDC 1G1XB 5CA0A 3JCZA 3IALA 4LFCO 4FFBA 5GW7A 1QLEC 3OGIB 2E41A 1P7BA 1WB7A 1WPBA 4CS4A 1URFA 2OIEA 1PYSA 4UV8A 4KHPO 4G2KA 1R73A 2LGQA 2R72A 1SZXA 1PL4A 3TCUA 1YJ9V 1EN6A 3HXZA 1K9MW 1J95A 2E3CA 2AHYA 1KECA 3BABA 1AP6A 1Q43A 3TEHA 3ERRA 4E51A 4OGQB 5B66Z 3ZN1A 3VQYA 2QKCA 5ITZB 2CTPA 3K9SA 1HR0B 3CC4V 2IU0A 2XHBA 1YIJV 2FKXA 3IKLA 4CS3A 3NENA 4J41A 3ABKB 1EOVA 3QO7A 3FB8C 1GKFA 4PHCA 4FZ1A 1THZA 5TISZ 3ICXA 3JATB 4B7KA 1Y74B 4O4IA 5KMGB 4JAAA 4O4HA 3ZMVA 3BFMA 3CC7V 2EJFA 2HVKC 4JASA 3UGTA 2QM4A 2ZR2A 4X88A 1L0NH 2X6CA 4X1KA 4NXMO 2JRIA 2YIDA 3R66A 2QM7A 1S0VA 3A0HZ 2DU5A 1IBKB 2X7RB 4YRPA 4IYIA 4TVWA 3WG7C 2UXBB 3O9OA 2YIBD 3ICAA 2V7QG 1M56C 4H2UA 1DF5A 4IHJA 1SQBH 5H6QA 4B7EA 4FK5C 1V54C 5L3BA 5IYDO 3H1LH 1XUQA 3ASNB 2ARHA 3SJBC 1Z5VA 4X89A 2YUAA 4XDJA 1XMQO 2ADPA 3RGBA 1XHXA 1QQCA 2JJ1G 2ODRD 2QWNB 1NVPD 4YRTA 3RGLA 4H2SA 4DYLA 4GX1A 2EIMC 4CH3A 4YY3B 2ZCEA 2QR4A 3J80N 1O9HA 2UXXA 2YDEA 3BA8A 5DM6V 3JARA 1WJZA 4GCZA 4MSWC 5LA6B 1FPOA 4XEMA 2XGTA 2H94A 2EAYA 4I0XB 2HEPA 5C52B 1AROP 4P75C 2CTWA 2R9IA 4DPGA 1VARA 1YCIA 4MTGA 2EZOA 5KUMA 3AG4C 2Z0AA 1IXBA 4YJ3B 3SPJA 2WWWA 5A9GA 4GT1A 3H1KH 3UM7A 2D2CB 1EFRG 1OCOC 1YFTA 5JWPA 2YXYA 4LVJA 3IKMB 4PA9A 4W4LA 1R3KC 3CCQV 3KCXA 3ETDA 2ZT7A 3OE7G 2CGHA 2OIGA 1ATIA 1H2SB 1VIBA 4PA7A 1E1RG 2A06H 3Q4HA 1XILA
chains in the Genus database with same CATH topology
1E22A 5CB4A 2DVEA 2PGGA 1P49A 2E1HA 4K86A 1FFXB 3P8YA 4YCUA 1G51A 1SRYA 1M4UA 2ARUA 3U11A 4UCTA 4LF8B 3PCOA 4TV9A 2DXTA 4O2AA 4KQEA 3CMQA 4TUYA 2XTIA 3A32A 1YFSA 2AMCB 2ZIOA 3UGQA 3REUA 4U3JB 5EZYA 5LYJB 3PN1A 3N2GB 2E10A 4EFBA 5IYZA 2CJAA 3A7AA 1EFWA 1LYLA 4X20A 2F4VB 1NYRA 4LVMA 4BW9A 1H4VB 4ZTUB 3SJCC 4K8XA 4P73A 4LNSA 5LXTB 3HY0A 3E22A 4XEOA 3RYIA 4FM1A 1VF7A 4FLZA 5HGQA 4Q15A 4Q6GA 1KMIZ 1SETA 3JASB 4H2XA 4UFZA 4TQDA 1NJ6A 3BPZA 4K87A 1FFXA 4YRIA 4O2BB 2ZNIA 2HHHB 4NXMB 2RQ6A 1RIQA 4DUZB 2UUAB 4P73C 3WB1A 4P71A 4JI5B 1SA0B 2F93B 4JI7B 12ASA 2YI8A 5GONB 3MAQA 5FPRA 5JCOC 2DQ3A 4O4LA 4OLFA 3QTCA 4I50B 2AMCA 4P72C 3LSSA 4DR7B 2BTQB 3A7RA 3KFUA 4U3JA 4TV8B 4JI2B 4X62B 5LYJA 1V9PA 4O2DA 4P71C 5IJ9B 1WQWA 4RQFA 4EO4A 5JVDB 3NELA 2PZSA 4LF5B 2ZINA 2UUCB 4CC6A 3RKWA 1NJ2A 5LXTA 2E5AA 3JATA 1XMQB 4DV7B 5KHGA 1TA8A 4DK0A 4DRXB 3HXWA 2ZT5A 4DV3B 2VQEB 2DDZA 3JASA 1BBWA 2YXLA 4O2BA 4BWAA 1EVLA 1WNSA 3VQVA 4HNAB 5GONA 4OX9B 1NYQA 3K5OA 3HFZB 3CHXA 2ZZFA 4J15A 4UP8A 4ZHQB 2UUBB 4P75A 3V7CA 4I50A 2BTQA 1O9GA 4LVKA 4D7TA 1XNQB 5K1XA 3R07A 2QJ1A 2YIBA 1E24A 4EB6B 4H2VA 2DTOA 3UT5B 4HWPA 4JI8B 4HWTA 4AILC 5KHJA 2PMEA 5IJ0B 5EIBD 3A5ZA 4B3RB 3HKEA 1T5EA 1Z5WA 4B08A 1WU7A 4UCRA 2EX3A 5FNVA 4UPAA 4DRXA 1G6UA 1X01A 5C53B 4ZI7A 2DEQA 1WN7A 2F95B 5CA1B 4YPFA 5J2UB 2Q0AA 3A31A 2DQ0A 2I4NA 4UCVA 4CH6A 4ZTZB 4HNAA 1HNWB 3PZCA 1KMMA 3HFZA 2JVDA 4IIJB 1X54A 2I4LA 1BIAA 1I7FA 4ZHQA 3RL6A 1WNLA 3JAKB 2PYLA 5C51B 5BR8B 1M93A 2CAZC 4CH4A 2V4DA 4YRMA 1JFFB 5E3IA 2IY5B 3LSQA 4EB6A 1E1TA 2QHUA 2ODRC 4YCWA 3UT5A 4L8JA 3K5LA 3L1AA 4JYAB 1I94B 4TQFA 5LOVB 4I55B 4HWSA 1NJ1A 5IJ0A 4YRSA 2PMFA 4LVLA 2EJGA 4YRGA 4XTYA 2BTOA 2P22C 3WQZA 1FYFA 2PY5A 4PG3A 4XU3A 4I4TB 4LF6B 4CS2A 4HVCA 5C8YB 1W66A 4PHZA 1HNXB 4NVPA 4TVYA 1SQGA 4DK1A 3JALB 2Q7EA 5CA1A 3UQ8A 5J2UA 5LMUB 4YJ3A 3SR2C 4LFAB 2CJBA 2DXUA 4UP9A 4X1IB 4IIJA 4UCSA 1B04A 2KKWA 4ZIBA 3A74A 4O4IB 2VWJA 3BRCA 1WQ7A 3ETQA 5JQGB 1JFFA 2RHSB 2IY5A 1FJGB 5JJNB 1E1OA 3RYFB 4AHCA 4DR3B 1X55A 1QHTA 3E9IA 2RHQA 4EX5A 1QF6A 4DV2B 5FPOA 4HWRA 4O4JA 4H2WA 4YRRA 3V8JA 1EVKA 3T1YB 3RYCB 5LOVA 2PUSA 3A7UA 5JCOA 3UFGA 1IBLB 3FJPA 3N2KB 4OP0A 2OWOA 4LFBB 4LNUB 2JS5A 4B3SB 5KHIA 3E9HA 3NETA 3BAAA 4LR3A 3K5NA 1YB3A 3B2EE 4JI3B 4I4TA 5C8YA 3JSLA 1D5AA 3HKBB 5J2TB 4NXNB 2E65A 5JH7B 4P3NA 2CJ9A 1IL2A 1QE0A 1X2GA 3JALA 1XHZA 3HXYA 5D5QA 3CSXA 2Q7GA 3HTZA 4CH5A 4X1IA 1WYDA 3JSNA 4EEQA 1JJOA 1TAEA 4DR4B 1B7YB 3M7MX 2EJ9A 4XU0A 2R9AA 4XTZA 2ZM6B 1ADJA 3N2GA 1B70B 5K1PA 5JQGA 2OYQA 2RHSA 3TUPA 4DV4B 4TTVA 3M4QA 3RYFA 1G5IA 5LMNB 4TVAB 2DZ9A 3G1ZA 3RYCA 2F1MA 1RSOA 3N2KA 3RKYA 2ALYB 4YREA 3ZEDA 4LNUA 2QHTA 3V8KA 2JGUA 2ZGWA 4KL1A 1L0WA 2A8EA 4UCOA 1SESA 4XTWA 4WJ3M 4X65B 1H4TA 4YJ2B 4GKKB 3HKBA 5J2TA 3T1HB 1SA0A 2ARTA 2DZCA 5BMVB 5JH7A 4RDXA 3U10A 5LP6B 1SKVA 3K57A 3A5YA 5JJJB 4FM0A 4P3PA 3OD1A 3JAWB 5F5WA 4TV8A 1G5HA 3CB2A 2PTMA 1HC7A 4YRFA 4YYEA 1B7YA 1XI1A 4FM2A 1B70A 5IJ9A 3QNEA 3BHPA 5EYPB 2Q7HA 4XU2A 1C0AA 5JVDA 3DSQA 1YGBA 4G84A 1XMOB 5CA0B 3EFRA 4TVAA 4UP7A 4YP0A 3QF7A 4WBNB 1ASYA 4FFBB 1Q8IA 3UH0A 4WF2A 1X2HA 3SJAC 2UXDB 1SERA 2R70A 2UXCB 1N32B 4UCUA 4FLYA 3IG2A 3HY1A 4ZOLB 5KHHA 3W3SA 2AKWB 4DUYB 1PYSB 4GKJB 2NS6A 2ZT6A 2EWNA 4FLXA 1GGMA 4YJ2A 1KMNA 5JJEB 2P5OA 1TVKB 5BMVA 4YHHB 1ADYA 3MF2A 4DR6B 5LP6A 2YI9A 2QHVA 4XU1A 4YRQA 4RMFA 3A2FA 3I7FA 4K8ZA 2P5IA 3JAWA 4FLVA 1NJ5A 1USYC 3IAYA 4GLXA 4F6RB 3QO5A 3QO8A 4HWOA 1X56A 2Q5IA 4H2YA 1JMKC 1IBMB 3VBBA 3K58A 3RUXA 3TEHB 1S5JA 5EYPA 3PCOB 5LP6C 4LVIA 4JI1B 5CA0A 3IALA 1HNZB 4WBNA 4B3TB 2ZR3A 1Q5OA 3EFSA 4FFBA 3MF1A 2VQFB 2E41A 5EIBC 4LF7B 4KR3A 1WPBA 3RYHB 4CS4A 1EIYB 4ZOLA 2AKWA 1PYSA 2I4OA 4YRCA 3RFRA 4P3OA 1N34B 3BJUA 1X4TA 2R72A 1TVKA 3LNNA 4X66B 3WB0A 3HRKA 2ZTGA 2UU9B 3E22B 1DGSA 1H4QA 3HFVA 3HXZA 5KX5B 3JAKA 4O4HB 4F6RA 2E3CA 1XNRB 4H2XB 3LC0A 3OTOB 3BABA 1Q43A 3TEHA 3ERRA 4YRLA 4E51A 4KR2A 1TGOA 4I55A 4PI0A 1ZAUA 4WI1A 1NT2B 3VQYA 1EQRA 3HXXA 4O4LB 4P74C 5ITZB 2HNIA 4X1KB 4K0KB 2ZZEA 4AH6A 4YRJA 1HR0B 2XHBA 4XTVA 3IKLA 4DQ2A 4FVMA 4DV5B 1N36B 3NEMA 3RYHA 1EIYA 4LF4B 2PYJA 4HBNA 4CS3A 4JI6B 3THOA 2E5LB 3NENA 2EL9A 3ZS8C 3L4GB 1EOVA 3QO7A 4AQYB 4PHCA 2CIMA 2GV9A 4IHJB 5KNNA 1BBUA 3ICXA 3JATB 5KX5A 4O4IA 5KMGB 4X1YB 3HKCB 4O4HA 3BFMA 4B3MB 2RJZA 2EJFA 5KHKA 3K5MA 4H02A 4H2TA 4EFEA 3UGTA 5D5PA 4P72A 1B8AA 2I4MA 4XTUA 2QM4A 4FLUA 2IM9A 3HKDB 3QG5A 3V7SA 2DTHA 3RKXA 1KOGA 1B76A 2FYKA 2ZR2A 5ITZA 3HXVA 4X1KA 4PI2A 4FLWA 1BIBA 1ASZA 2Q5HA 4DV1B 2G4CA 1HW7A 4YRNA 3V8LA 2DU5A 1N33B 4FLTA 1IBKB 1J5WA 4YRPA 3P8VA 4DR2B 3JARB 4TVWA 2UXBB 2YIBD 3L4GA 3ICAA 1J5EB 4H2UA 4HT4A 3HKEB 3HRIA 4IHJA 5ELNA 2J3LA 3M4PA 4G85A 3RF1A 3RIRA 2YIAA 2F66C 1JJCB 4CC5A 5KMGA 4X1YA 5FNVB 3HKCA 1YFRA 3SJBC 4DR5B 1N9WA 4ZI7B 1Z5VA 2P0LA 3RACA 4DV6B 3VQWA 1TUBB 4K88A 3RGBA 3HKDA 1HXDA 4YRKA 1Q3EA 3HXUA 4LH6A 1XHXA 3U0ZA 1QQCA 1WLEA 2C7IA 3BA9A 2ZZGA 11ASA 2ODRD 3P8TA 4DV0B 2ALYA 1USYA 3RWRD 4D7SA 1WPYA 4YRTA 3RGLA 4H2SA 4WJ4A 2J3MA 4CH3A 4YY3B 4YROA 2ZCEA 3WB2A 4L87A 1O9HA 3BA8A 4X5OA 1KU9A 3JARA 5LA6B 4LF9B 3VQXA 1HTTA 2XGTA 4XEMA 4XTXA 2EAYA 2HEPA 3TEGA 5C52B 2ZXFA 4DR1B 3V7RA 4NCXA 1L8DA 4P75C 4TOIA 1SQFA 1NNHA 4I9QA 4DPGA 5CB4B 1XQ8A 3FFQA 4JI0B 1JJCA 5ELOA 4RQEA 2C8MA 2DKGA 4LFCB 1H4SA 4TV9B 4YDQA 4LH7A 1TUBA 2DU7A 3MQZA 1Z7NA 4O2AB 4YJ3B 3SGIA 4TUYB 2ZT8A 4JI4B 3REXA 1YEWA 4KHPB 2ZIMA 5EZYB 2DTIA 4YCVA 1YFTA 1M5IA 4LVJA 2DJZA 3K59A 3IKMB 5IYZB 4TWAA 4X64B 2ARSA 4JV5B 2QHSA 4X20B 3MEYA 2RHQB 2ZT7A 4GYCB 1Z7MA 4O4JB 2CGHA 5IWAB 5LA6A 4HA8A 2VWKA 2ZNJA 1VQZA 1ATIA 1H2SB 3RYIB 4P74A 3L2ZA 1NJ8A 3OTFA 2E64A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E22 A;  2DVE A;  2PGG A;  2E1H A;  4K86 A;  3P8Y A;  4YCU A;  1G51 A;  1SRY A;  2ARU A;  3PCO A;  2DXT A;  4KQE A;  3CMQ A;  2XTI A;  3A32 A;  1YFS A;  2AMC B;  2ZIO A;  3UGQ A;  3REU A;  2E10 A;  2CJA A;  3A7A A;  1EFW A;  1LYL A;  1NYR A;  4BW9 A;  1H4V B;  4ZTU B;  4P73 A;  4LNS A;  3HY0 A;  4XEO A;  5HGQ A;  4Q15 A;  4Q6G A;  1SET A;  4H2X A;  4K87 A;  1NJ6 A;  4TQD A;  4YRI A;  2ZNI A;  2RQ6 A;  1RIQ A;  4P71 A;  4P73 C;  12AS A;  2YI8 A;  2DQ3 A;  4OLF A;  3QTC A;  2AMC A;  3LSS A;  3A7R A;  3KFU A;  4O2D A;  4P71 C;  1WQW A;  4RQF A;  4EO4 A;  3NEL A;  2ZIN A;  3RKW A;  1NJ2 A;  2E5A A;  3HXW A;  2ZT5 A;  2DDZ A;  1BBW A;  4BWA A;  1EVL A;  3VQV A;  3HFZ B;  1NYQ A;  4UP8 A;  2ZZF A;  4J15 A;  3V7C A;  4P75 A;  1O9G A;  5K1X A;  3R07 A;  2QJ1 A;  2YIB A;  1E24 A;  4H2V A;  2DTO A;  4HWP A;  4HWT A;  2PME A;  3A5Z A;  1WU7 A;  4UPA A;  1G6U A;  1X01 A;  5C53 B;  2DEQ A;  4YPF A;  3A31 A;  2DQ0 A;  2I4N A;  4CH6 A;  4ZTZ B;  3PZC A;  1KMM A;  3HFZ A;  2JVD A;  1X54 A;  2I4L A;  1BIA A;  3RL6 A;  1WNL A;  4CH4 A;  4YRM A;  5E3I A;  2IY5 B;  3LSQ A;  1E1T A;  2QHU A;  2ODR C;  4YCW A;  3L1A A;  4TQF A;  4HWS A;  4YRS A;  1NJ1 A;  2PMF A;  2EJG A;  4YRG A;  4XTY A;  3WQZ A;  1FYF A;  4PG3 A;  4XU3 A;  4CS2 A;  4HVC A;  1W66 A;  4TVY A;  2Q7E A;  2CJB A;  2DXU A;  4UP9 A;  4ZIB A;  3A74 A;  1WQ7 A;  2RHS B;  2IY5 A;  1E1O A;  1X55 A;  3E9I A;  4EX5 A;  2RHQ A;  1QF6 A;  4HWR A;  4YRR A;  4H2W A;  3V8J A;  1EVK A;  2PUS A;  3A7U A;  3UFG A;  3FJP A;  4OP0 A;  3E9H A;  3NET A;  1YB3 A;  2E65 A;  4P3N A;  2CJ9 A;  1IL2 A;  1QE0 A;  1X2G A;  3HXY A;  2Q7G A;  3HTZ A;  4CH5 A;  1WYD A;  2EJ9 A;  1B7Y B;  4XU0 A;  4XTZ A;  1ADJ A;  1B70 B;  5K1P A;  2RHS A;  3TUP A;  4TTV A;  3M4Q A;  1G5I A;  4TVA B;  2DZ9 A;  3G1Z A;  3RKY A;  2ALY B;  4YRE A;  3ZED A;  2QHT A;  3V8K A;  2ZGW A;  1L0W A;  1SES A;  4XTW A;  4WJ3 M;  4P72 C;  1H4T A;  2DZC A;  2ART A;  4RDX A;  3A5Y A;  4P3P A;  3OD1 A;  5F5W A;  4YRF A;  1G5H A;  1HC7 A;  4YYE A;  1B7Y A;  1B70 A;  3QNE A;  3BHP A;  2Q7H A;  4XU2 A;  1C0A A;  3DSQ A;  1YGB A;  4G84 A;  4TVA A;  4UP7 A;  3EFR A;  4YP0 A;  1ASY A;  3UH0 A;  4WF2 A;  1X2H A;  1SER A;  2R70 A;  3IG2 A;  3HY1 A;  3W3S A;  2AKW B;  1PYS B;  2ZT6 A;  2EWN A;  1GGM A;  1KMN A;  1ADY A;  3MF2 A;  2YI9 A;  2QHV A;  4XU1 A;  4YRQ A;  4RMF A;  3I7F A;  2P5I A;  1NJ5 A;  1USY C;  3QO5 A;  3QO8 A;  4HWO A;  1X56 A;  2Q5I A;  4H2Y A;  3VBB A;  3RUX A;  3TEH B;  3PCO B;  3IAL A;  2ZR3 A;  3EFS A;  3MF1 A;  2E41 A;  4KR3 A;  1EIY B;  4CS4 A;  2AKW A;  1PYS A;  2I4O A;  4YRC A;  4P3O A;  3BJU A;  2R72 A;  3HRK A;  2ZTG A;  1H4Q A;  3HFV A;  3HXZ A;  2E3C A;  4H2X B;  3LC0 A;  3TEH A;  3ERR A;  4YRL A;  4E51 A;  4KR2 A;  4WI1 A;  3VQY A;  1EQR A;  3HXX A;  4P74 C;  2HNI A;  2ZZE A;  4AH6 A;  4YRJ A;  4XTV A;  3IKL A;  4DQ2 A;  3NEM A;  1EIY A;  4CS3 A;  3NEN A;  2EL9 A;  3L4G B;  1EOV A;  3QO7 A;  4PHC A;  2CIM A;  5KNN A;  1BBU A;  3BFM A;  2RJZ A;  2EJF A;  4H02 A;  4H2T A;  3UGT A;  4P72 A;  1B8A A;  2I4M A;  4XTU A;  3V7S A;  2DTH A;  3RKX A;  1KOG A;  1B76 A;  2FYK A;  2ZR2 A;  3HXV A;  1BIB A;  1ASZ A;  2Q5H A;  2G4C A;  4YRN A;  3V8L A;  2DU5 A;  1J5W A;  4YRP A;  3P8V A;  4TVW A;  2YIB D;  3L4G A;  3ICA A;  4H2U A;  3HRI A;  5ELN A;  2J3L A;  3M4P A;  4G85 A;  3RF1 A;  3RIR A;  2YIA A;  1JJC B;  1YFR A;  2P0L A;  1N9W A;  3RAC A;  3VQW A;  4K88 A;  1HXD A;  4YRK A;  3HXU A;  5C51 B;  1WLE A;  2C7I A;  2ZZG A;  11AS A;  2ODR D;  3P8T A;  2ALY A;  1USY A;  1WPY A;  4YRT A;  3RGL A;  4H2S A;  4WJ4 A;  2J3M A;  4CH3 A;  4YRO A;  2ZCE A;  4L87 A;  1O9H A;  4X5O A;  4XTX A;  3VQX A;  1HTT A;  2XGT A;  4XEM A;  2EAY A;  2HEP A;  3TEG A;  5C52 B;  2ZXF A;  3V7R A;  4NCX A;  4P75 C;  1NNH A;  4DPG A;  1JJC A;  5ELO A;  4RQE A;  2C8M A;  2DKG A;  1H4S A;  4YDQ A;  2DU7 A;  1Z7N A;  2ZT8 A;  3REX A;  2ZIM A;  2DTI A;  4YCV A;  1YFT A;  2DJZ A;  3IKM B;  4TWA A;  2ARS A;  2QHS A;  3MEY A;  2RHQ B;  2ZT7 A;  1Z7M A;  2CGH A;  4HA8 A;  2ZNJ A;  1VQZ A;  1ATI A;  4P74 A;  3L2Z A;  1NJ8 A;  2E64 A; 
#chains in the Genus database with same CATH topology
 2ADQ B;  4MTX A;  1P49 A;  1CEZ A;  4YCU A;  1YTF B;  4ZKI A;  4JI1 O;  4N23 A;  3CRM A;  3U11 A;  2HJF C;  4LF8 B;  3PCO A;  3UO3 A;  2DXT A;  1DLB A;  3D3I A;  4O2A A;  1GN2 A;  3C3T A;  2MK3 A;  2ZIO A;  1GH6 A;  2WLM A;  1PL0 A;  1W2B U;  3REU A;  3EXA A;  3H1I H;  1TUE B;  2E10 A;  3ABL C;  4LFA O;  1EFW A;  4LBE C;  2F4V B;  1NYR A;  2A0L A;  4BW9 A;  4ZTU B;  4XEO A;  1DK1 A;  3RYI A;  1FJG O;  4FLZ A;  5HGQ A;  4Q6G A;  3L72 H;  1NJ6 A;  1K33 A;  3BPZ A;  1FFX A;  1VQN V;  3E86 A;  5L3E A;  4MS2 A;  2HHH B;  1LUV A;  1RIQ A;  3CMA V;  2UUA B;  2F93 B;  3OUS A;  12AS A;  2YI8 A;  5FPR A;  5JCO C;  2AMC A;  3A7R A;  3DXR A;  3LSU A;  4YIO A;  2B1I A;  5DN6 G;  3FKS G;  4O2D A;  3ASO B;  2Q6A A;  2QSA A;  4E2L A;  1FFT B;  3OR6 C;  4EO4 A;  1XEQ A;  4H37 A;  3NEL A;  4DR4 O;  2ZIN A;  2UUC B;  5IT9 N;  5E79 Z;  4DV4 O;  4HYO A;  4DRX B;  1NU1 H;  3FAV B;  2IH3 C;  2VQE B;  2DDZ A;  3ZHQ A;  4BR6 A;  4O2B A;  4BWA A;  4KUM A;  4PJ0 Z;  2IJI A;  4HNA B;  3IJ4 A;  3HFZ B;  1NYQ A;  1KP3 A;  3K5O A;  4P75 A;  1NTK H;  2ETN A;  3P30 A;  2B9Z A;  5GTH Z;  4RUE A;  4DR2 O;  2YIB A;  2RMK B;  3ZIA G;  4HWP A;  4AIL C;  4E4E A;  5EIB D;  1Z5W A;  5CA3 A;  3CCJ V;  1WB8 A;  2L6L A;  1VQ6 V;  4DR5 O;  2ZE6 A;  3CCU V;  1XMO O;  2L35 A;  2EUL A;  5LBQ A;  2DYR C;  2O57 A;  2WA4 A;  4YPF A;  2DQ0 A;  3KZI Z;  5B5E Z;  1K5S A;  2WA3 A;  1KD1 W;  1N32 O;  2JVD A;  2NLJ C;  2OT5 A;  1BIA A;  4ZHQ A;  3LNM B;  3IGA C;  1KQS U;  1ZTE A;  5BR8 B;  3BVO A;  5E3I A;  2IY5 B;  3AG3 B;  1S77 D;  2LFS A;  2RCV A;  2P4K A;  4JYA B;  1BE3 H;  1NJ1 A;  5IJ0 A;  1MOF A;  2E76 B;  2P22 C;  1FYF A;  5DED A;  5LHG A;  2Q4P A;  2WLI A;  4DW1 A;  4LF6 B;  4JTC B;  2EIK B;  3K08 A;  4PHZ A;  1HNZ O;  3CCV V;  1SQG A;  4ZBM A;  3JAL B;  3UQ8 A;  5J2U A;  1EN4 A;  1R6K A;  1KKC A;  2NN4 A;  2ZDI C;  2JGD A;  4BAY A;  2VQF O;  4MVS A;  4J11 A;  4X1I B;  1H2G A;  4FZ0 A;  2P6J A;  1YSC A;  5B3S B;  5JQG B;  1GRJ A;  2RHQ A;  2WLL B;  3OMA B;  4DV2 B;  4HWR A;  3ABM C;  4O4J A;  4H2W A;  1SZT A;  2QWP B;  5JCO A;  3A7U A;  1IBL B;  3BEH A;  3TET A;  1F7Y A;  4OXS A;  4OP0 A;  4UXN A;  2GUZ A;  3DGE A;  2JS5 A;  3NET A;  2LJ2 A;  4G28 B;  4WFE A;  3BAA A;  4JI3 B;  4I4T A;  1D5A A;  5J2T B;  4NXN B;  2CJ9 A;  1QE0 A;  1NI8 A;  4GX2 A;  1BL8 A;  3HTZ A;  4CH5 A;  2LFR A;  1K73 W;  1JJO A;  1TAE A;  2BSK B;  4XU0 A;  2R9A A;  4XTZ A;  2ZM6 B;  2FTK A;  3AG1 C;  3G6B A;  3M4Q A;  1G5I A;  5LMN B;  1D2D A;  4TVA B;  3AK1 A;  1JR9 A;  2IJH A;  2PI4 A;  1QCE A;  1FXK B;  1RSO A;  1OCR B;  3RKY A;  2ALY B;  4DXW A;  1WP8 A;  4JI7 O;  2A8E A;  1UJW B;  1SES A;  1R3I C;  5HFM A;  3ZHR A;  4P72 C;  3HKB A;  5BMV B;  5JH7 A;  5LP6 B;  1FXV A;  4IT5 A;  4JTA B;  4TV8 A;  1I5X A;  2EJR A;  3CB2 A;  3L71 H;  4YRF A;  1DF4 A;  1QR9 A;  1PM9 A;  1XOU A;  2W0F C;  5IJ9 A;  3BHP A;  3F5W C;  4XU2 A;  4UB6 Z;  4PDM A;  5JVD A;  2HVJ C;  1YGB A;  1V55 B;  3EFR A;  1OZ0 A;  4WBN B;  1BCC H;  3UH0 A;  1X2H A;  4DV6 O;  4G27 B;  1F23 A;  4FLY A;  3IG2 A;  3SYQ A;  4ZOL B;  1K4C C;  3B8M A;  4FLX A;  1GGM A;  2AXT Z;  1KMN A;  5JJE B;  2OCH A;  1TVK B;  1PPJ H;  3E35 A;  4YHH B;  3CCR V;  1ADY A;  3MF2 A;  1XNQ O;  4RMF A;  3A2F A;  1OCC B;  3DC6 A;  2HJD A;  1USY C;  5CBG A;  3QO5 A;  3QO8 A;  4HWO A;  1IBM B;  1K4D C;  4DR1 O;  1AI7 A;  5EYP A;  1AIL A;  2YEV A;  4QE9 A;  5F2V O;  1OCZ C;  2ZDI A;  5IYB O;  1Q5O A;  3EFS A;  4OPH A;  3FYE B;  3R65 A;  3JD3 A;  3MF1 A;  5L3D A;  4LF7 B;  2Z3Y A;  4WFH A;  2G38 A;  3RYH B;  5KAI Z;  4YRC A;  2I4O A;  3RFR A;  1K97 A;  1N34 B;  1X4T A;  2QKA A;  2Y4U A;  3E22 B;  5KX5 B;  3OMI B;  2A9H A;  4F6R A;  5IWA O;  1AJP A;  3LC0 A;  4YRL A;  1TGO A;  4C7U A;  3OFN G;  1ZAU A;  2QWQ B;  1NT2 B;  4W4K A;  1EQR A;  3GWO A;  3OD4 A;  2HNI A;  4K0K B;  1AI5 A;  4ABM A;  4AH6 A;  4XTV A;  1BT8 A;  5H5N A;  2YXH A;  4DQ2 A;  1N36 B;  3NEM A;  3ETG A;  1P84 F;  2VS0 A;  2Y48 A;  2E5L B;  1RPO A;  3ZS8 C;  3SPC A;  3L4G B;  2CK3 G;  4AQY B;  2GV9 A;  4J80 A;  1NKD A;  3T1C A;  3ZX6 A;  4DR3 O;  4LWS B;  4B3M B;  2MW2 B;  1A32 A;  3SPI A;  5KHK A;  4H2T A;  4EFE A;  5D5P A;  4UVB A;  3TXQ A;  4P72 A;  2ZE7 A;  4FLU A;  2DTH A;  1B76 A;  2V1D A;  2FYK A;  5ITZ A;  4FLW A;  1ZWI C;  1ASZ A;  1EZJ A;  4DV1 B;  1MMM A;  4YRN A;  3O65 A;  4MVQ A;  3P8V A;  4DR7 O;  1SF9 A;  3X2Q B;  2B1G A;  2QTS A;  1KYO F;  1VQ7 V;  1QVG U;  4DO2 A;  4G85 A;  3CXC U;  3RIR A;  2F66 C;  1JJC B;  1KUQ A;  5KMG A;  5FNV B;  1JVM A;  2EZP A;  1YFR A;  1RM1 B;  1TUB B;  4K88 A;  1HXD A;  4UVA A;  1Q3E A;  4LH6 A;  1WLE A;  2C7I A;  3BA9 A;  1VQL V;  2XND G;  3P8T A;  1MSW D;  5B1O A;  1USY A;  1WP7 A;  3RWR D;  1WPY A;  4KXR A;  4TSF G;  3T1H O;  2A79 B;  1KU9 A;  1XBL A;  3VQX A;  3W7S A;  4XTX A;  1JCH A;  1L8D A;  4JGS A;  1SQF A;  4I9Q A;  3UKM A;  5CB4 B;  1XQ8 A;  4JI8 O;  4JI0 B;  1W0K G;  1H2K A;  2C8M A;  2DKG A;  1NH2 D;  3NXS A;  4LFC B;  4B3R O;  1H4S A;  3MQZ A;  1Z7N A;  3B8N A;  4TUY B;  2ZT8 A;  1VF5 B;  3REX A;  2JS3 A;  1MAB G;  1YEW A;  3E8H A;  4KHP B;  4YCV A;  3CC2 V;  2D3O W;  2ZKO A;  3K59 A;  4MT8 A;  4TWA A;  1AJQ A;  4X64 B;  1K5Q A;  4DR6 O;  2QHS A;  1I5Y A;  3OT7 A;  3P3N A;  4X20 B;  5CMU A;  4GYC B;  1Z7M A;  1ZLZ A;  2XAS A;  5LA6 A;  4HA8 A;  2VWK A;  4I0X A;  4RWU A;  2DVE A;  4K86 A;  1GM7 A;  3P8Y A;  1SRY A;  2EIJ B;  3MHH C;  2CTR A;  1N0J A;  5LHI A;  3CMQ A;  5A2Q N;  1YFS A;  1B06 A;  1HDJ A;  3CWB H;  4NKG B;  5LMU O;  5CBF A;  4EFB A;  1B3Q A;  4TT3 G;  2CJA A;  3ABU A;  1GO3 F;  3D3Q A;  1ZL8 B;  4LVM A;  1H4V B;  4P73 A;  4K8X A;  2CTQ A;  5LXT B;  1PNL A;  4Q15 A;  3G4S V;  1VQ9 V;  4UV9 A;  4H2X A;  4K87 A;  4UFZ A;  4TQD A;  3LDE A;  4J7Z A;  4NXM B;  2RQ6 A;  4DUZ B;  4P71 A;  4NTX A;  4JI5 B;  1SA0 B;  1HR0 O;  5GON B;  3MAQ A;  2DQ3 A;  3L73 H;  4O4L A;  3QTC A;  1AJN A;  3LSS A;  2QTO A;  2BTQ B;  3QVN A;  3M99 B;  3KFU A;  1IUR A;  1Q6I A;  3DC5 A;  2ZXW C;  2JDI G;  1IDS A;  2EIK C;  1WQW A;  4RQF A;  4U7N A;  1BMF G;  2K1E A;  3WU2 Z;  2E5A A;  1XMQ B;  5IY5 C;  5AG2 A;  3SYA A;  4UUJ C;  4DK0 A;  3HXW A;  3CJH B;  4NR1 A;  1Q81 W;  3CPW U;  1EVL A;  2DW4 A;  4PA4 A;  2GBO A;  3VQV A;  2P4V A;  1S76 D;  3SPG A;  2ZZF A;  4J15 A;  1S5H C;  3KG2 A;  5K1X A;  1OHH G;  4QPJ A;  3K3W A;  5EBM C;  2UXB O;  2DTO A;  2UXN A;  4LC1 A;  3EFF K;  2DYS B;  3UT5 B;  1HP8 A;  2Q0O C;  2Y4T A;  3AG2 C;  5LGN A;  4JZG A;  3A5Z A;  2CE4 A;  3HKE A;  3B4S A;  1T5E A;  3ZRW B;  4B08 A;  2XAH A;  3TXS A;  1MNG A;  4UPA A;  4DRX A;  1G6U A;  3FAV A;  4ZI7 A;  2DEQ A;  2NNU A;  1QR8 A;  4X8A A;  1LR1 A;  4HNA A;  1H2L A;  1X54 A;  4IIJ B;  2I4L A;  1FXK C;  3HFZ A;  2WSS G;  1NJI W;  1FD9 A;  3MD0 A;  4NB5 A;  4YY3 O;  3CCM V;  1M93 A;  4CH4 A;  2V4D A;  4YRM A;  1U97 A;  3LSQ A;  2ODR C;  4YCW A;  3K5L A;  4L8J A;  3L1A A;  1H2N A;  5L3G A;  1I94 B;  4TQF A;  5LOV B;  4HWS A;  3JD2 A;  3ZRX A;  4LVL A;  4XTY A;  1XRE A;  2BTO A;  1JQ0 A;  2PY5 A;  1EBO A;  4JYC A;  3T4Z A;  1BQ0 A;  3RN4 A;  4CS2 A;  4HVC A;  1W66 A;  2OTJ V;  3OUF A;  1HNX B;  1B6Q A;  3FB5 C;  4NVP A;  2KQX A;  4B3T O;  4TVY A;  1ROP A;  1KBH A;  4DK1 A;  2FML A;  3W7X A;  4LFA B;  2CJB A;  3W7T A;  1P7G A;  1JPX A;  1B04 A;  2KKW A;  4ZIB A;  4BIU A;  4O4I B;  2VWJ A;  2RHS B;  2IY5 A;  1FJG B;  5JJN B;  1M90 W;  1E1O A;  4FMT A;  4P9O A;  4AHC A;  1X55 A;  3K0G A;  2Y0P A;  1SQX H;  3RYC B;  4F4L A;  1OCC C;  5E1A C;  1CPY A;  2EIL B;  4LNU B;  5KHI A;  3E9H A;  1QU7 A;  3TK1 A;  2FL4 A;  3JSL A;  2E65 A;  3JAL A;  3OM3 B;  5EC1 C;  5B1A B;  3GWK C;  3MDS A;  2DOS A;  2OCC B;  4X1I A;  2W6I G;  2Q5Z A;  3JSN A;  4JI6 O;  4DR4 B;  2EJ9 A;  1M9N A;  3M7M X;  3N2G A;  2F4V O;  1B70 B;  2WLJ A;  5JQG A;  2OYQ A;  1K3E A;  1VQO V;  2CH7 B;  3J81 N;  3TUP A;  4DV4 B;  4WFF A;  1IXM A;  2WLL A;  2RDC A;  3JD0 A;  4F6E A;  4RUF A;  5BZB A;  2Q73 A;  2HHH O;  4YRE A;  1RFY A;  3V8K A;  2UUA O;  1L0W A;  4UCO A;  1SQP H;  2HR3 A;  4CBC A;  5GTI Z;  4GKK B;  5J2T A;  2DZC A;  3U10 A;  3AK2 A;  3CME V;  1YHQ V;  2IH1 C;  3A5Y A;  4K35 A;  5JJJ B;  1S3J A;  4JAU A;  5F5W A;  3H1J H;  4YYE A;  5CN0 A;  2PTM A;  5C93 A;  2BSK A;  1QLE B;  3ZHS A;  1XI1 A;  1J5E O;  3ZN0 A;  2UUC O;  1C0A A;  1PNM A;  2IJJ A;  1XMO B;  4TVA A;  3C90 A;  1NH2 B;  2BCC H;  2VQE O;  1FXK A;  3SJA C;  2DE0 X;  2UXD B;  3SDL A;  1N32 B;  3HY1 A;  2XUM A;  3W3S A;  2AKW B;  4GKJ B;  2ZT6 A;  4DV0 O;  2P5O A;  4Z2W A;  5BMV A;  5LP6 A;  4YRQ A;  1US6 A;  1ZX3 A;  5IYC O;  4D6T H;  4YXW G;  2OTL V;  1VQM V;  2CUG A;  2JK5 C;  5IDJ A;  3PCO B;  4LVI A;  4I7Z B;  1Y76 A;  1HNZ B;  4WBN A;  3JAM N;  2WLN A;  1L1F A;  5H6R A;  3CCS V;  2VQF B;  5EIB C;  2FB5 A;  1EN5 A;  3H01 A;  1GN4 A;  1EIY B;  5KUK A;  4ZOL A;  4ASU G;  2PF4 E;  3BJU A;  1AVM A;  2JJ2 G;  1TVK A;  4X66 B;  5KA5 A;  2UU9 B;  1DGS A;  1H4Q A;  3HFV A;  3JAK A;  1I0H A;  1YJN V;  3EVK A;  1XNR B;  5KLV H;  3B77 A;  4UVC A;  5BXZ A;  3OTO B;  3E2E A;  3FD9 A;  1NTM H;  1K7D A;  1VF6 A;  4PEL A;  3T2M A;  2RNB A;  3WG7 B;  4I55 A;  4PI0 A;  4WI1 A;  4P74 C;  4YRJ A;  4LF6 O;  4MVR A;  3B09 A;  4DV5 B;  4FPP A;  2BOC C;  3RYH A;  2AW9 A;  4LF4 B;  2PYJ A;  3THO A;  5B1B C;  3BCC H;  2EL9 A;  3KCY A;  5DEC A;  2H8P C;  5KNN A;  1KB9 F;  1LUW A;  2DJV A;  5KX5 A;  4X1Y B;  4Q20 A;  2GTS A;  3HKC B;  4A5U B;  3APQ A;  3C3S A;  3K5M A;  1IBL O;  4XTU A;  2IM9 A;  3HKD B;  4JYY A;  3V7S A;  3RKX A;  1VQP V;  2EBO A;  3P3P A;  4IYH A;  3MHS C;  1MSD A;  3HXV A;  4JI3 O;  1QLN A;  1N4C A;  1BIB A;  2Q5H A;  4NXN O;  2G4C A;  4JYB A;  1LNQ A;  4WFB V;  1N33 B;  4FLT A;  1S5L Z;  4UB8 Z;  3RVY A;  2IBZ H;  5LGT A;  3L4G A;  2P06 A;  2LQT A;  1M1K W;  4JI2 O;  1WA8 B;  4NTW A;  3W7U A;  4HT4 A;  2DWE C;  3G67 A;  4H13 B;  2ZM6 O;  5ELN A;  2LW7 A;  3M4P A;  4LWS A;  2F43 G;  2P0L A;  1N9W A;  3BY6 A;  3ABK C;  4DV6 B;  1UFI A;  4DV3 O;  5C51 B;  3HXU A;  3CE2 A;  3U0Z A;  2ZZG A;  11AS A;  2P67 A;  1VEW A;  3ZHU A;  4WJ4 A;  1ZUQ A;  4P2Z A;  2XT9 A;  1K34 A;  4OX9 O;  4YRO A;  3WB2 A;  2UUB O;  4X5O A;  1NTZ H;  2GTA A;  3I5D A;  4LF9 B;  1HTT A;  3ZMS A;  3L75 H;  3TEG A;  3V7R A;  4DR1 B;  4NCX A;  4TOI A;  1NNH A;  4QJF B;  3FFQ A;  1JX9 A;  1JJC A;  2HFE C;  1P4R A;  2PI5 A;  5B1N A;  2WLI B;  2M7W A;  4R7C A;  1PV0 A;  3ABL B;  4TV9 B;  4LH7 A;  1TUB A;  2DU7 A;  4J7J A;  2H3O A;  2Z5U A;  3SGI A;  1K92 A;  4JI4 B;  3L74 H;  2ZIM A;  1H8H G;  5EZY B;  2DTI A;  4J42 A;  3ASN C;  2K9P A;  4H0L B;  4PDR A;  1M5I A;  4PA3 A;  4YHH O;  5IYZ B;  1ZSP A;  1HNW O;  4P9P A;  4JV5 B;  1GM8 A;  2W6J G;  2RHQ B;  2QEX V;  4O4J B;  5H9C A;  5IWA B;  1KKD A;  3A0R A;  1QVF U;  3SJQ C;  4P74 A;  4Z1V A;  1IBM O;  1AR4 A;  3OTF A;  2E64 A;  5CB4 A;  2PGG A;  2E1H A;  4MW8 A;  3ZRS A;  2Q68 A;  1G51 A;  1M4U A;  4CZZ A;  2DYS C;  4LP8 A;  4KQE A;  3D8C A;  4TUY A;  3A32 A;  4LF7 O;  3UGQ A;  4U3J B;  2HG5 C;  2ILM A;  5LYJ B;  1W0J G;  3PN1 A;  1N34 O;  3G6E V;  2Y69 B;  2P90 A;  3A7A A;  4X20 A;  2AZ0 A;  3SJC C;  4LNS A;  1L0L H;  4P30 A;  3HY0 A;  3APO A;  3ZBH A;  4FM1 A;  1SET A;  2QM8 A;  5BY1 A;  3LDC A;  1R1B A;  2XAJ A;  3JAS B;  3HR0 A;  3T1Y O;  3K9A A;  2N04 A;  1YDX A;  4P73 C;  3WB1 A;  3ZHT A;  2W0X A;  4LFB O;  4B3S O;  4OLF A;  4I50 B;  1N36 O;  4DR7 B;  4TV8 B;  3E8F A;  2E5L O;  4X62 B;  1V9P A;  3PJS K;  4AQY O;  3ZMU A;  4P71 C;  1CXZ B;  5IJ9 B;  2AZ2 A;  1R6T A;  3CRR A;  2DYR B;  3FB7 C;  2EIN B;  5JVD B;  1ZL8 A;  1YF2 A;  4LF5 B;  4CC6 A;  1KP2 A;  2BE3 A;  1NJ2 A;  5LXT A;  1NS1 A;  3HPL C;  3JAT A;  4DV7 B;  1Y74 A;  5KHG A;  1TA8 A;  4K3A A;  1MA1 A;  4JPR A;  1PP9 H;  1BBW A;  2YXL A;  3A0B Z;  4JZ2 A;  5GON A;  2A3Q A;  3N27 A;  1BSM A;  1GTO A;  2BTQ A;  4Z1M G;  4X65 O;  2KG7 B;  4D7T A;  4EKW A;  3R07 A;  1E24 A;  4EB6 B;  4H2V A;  4U7O A;  1YZB A;  2QWR B;  3I56 V;  4JI8 B;  1JA8 A;  1QNM A;  5KHJ A;  4KP4 A;  1GN6 A;  4LCU C;  3L9D A;  4B3R B;  1XL6 A;  1IZ3 A;  3OR7 C;  2OCC C;  3STL C;  1WU7 A;  4UCR A;  2EX3 A;  2WLK A;  3ASO C;  2BOB C;  3S3W A;  3CJH A;  1X01 A;  5C53 B;  2YC0 A;  5CA1 B;  3A31 A;  3UCS C;  3ABM B;  2UXC O;  3PZC A;  5L3F A;  2IW5 A;  1I7F A;  4DUY O;  4N21 A;  3E8G A;  2N05 A;  3RL6 A;  2ATK C;  1Q6U A;  4GUN A;  2PYL A;  1X59 A;  2CAZ C;  1JFF B;  4J9Y B;  1E1T A;  3ZMZ A;  1Y4M A;  1AB3 A;  3UT5 A;  2CGN A;  2Q69 A;  1G4Y B;  1AR1 B;  4JI0 O;  2EJG A;  4YRG A;  3D36 C;  3ZRW A;  5C8Y B;  3FB6 C;  4J10 A;  2ITC C;  4WCE V;  1NBM G;  3AG1 B;  1F4M A;  2Q7E A;  5LMU B;  3CS5 A;  4QE7 A;  4YJ3 A;  3OMN B;  3SR2 C;  2DXU A;  4UP9 A;  4IIJ A;  4UCS A;  3A74 A;  4X64 O;  1XDC A;  1SQV H;  1WQ7 A;  3ETQ A;  1YJW V;  3CD6 V;  4JAV A;  3RYF B;  4EX5 A;  3E9I A;  1QF6 A;  5FPO A;  4YRR A;  3V8J A;  4MW3 A;  5LOV A;  1GAX A;  2PUS A;  5LHH A;  3J7A U;  2ODM A;  3UFG A;  3FJP A;  3N2K B;  4FFK A;  2OWO A;  3AG3 C;  3K5N A;  4LR3 A;  3CCL V;  3B2E E;  4AI8 A;  4H33 A;  1NR7 A;  1YIT V;  4P3N A;  2ZE5 A;  3SPH A;  1X2G A;  1XHZ A;  3HXY A;  3CSX A;  2Q7G A;  2ZQM A;  5L3C A;  4EEQ A;  1B7Y B;  1Y66 A;  1ADJ A;  5K1P A;  2RHS A;  2Q9L A;  2C2A A;  4TTV A;  2N74 A;  3JCU Z;  4ICG A;  1NR1 A;  3RYC A;  1R3J C;  2F1M A;  3G71 V;  2DN9 A;  4LNU A;  2QHT A;  5B3S C;  4DUZ O;  3AEI A;  4KL1 A;  4JI5 O;  2ZGW A;  5FLX N;  4WFA V;  4JTD B;  3S3X A;  4YJ2 B;  2YS8 A;  3K57 A;  1SKV A;  4RAI A;  2KSD A;  4MVM A;  4P3P A;  1OCZ B;  3CEI A;  3JAW B;  5LL6 Y;  1IBK O;  1HC7 A;  5EBL C;  4FM2 A;  2HKO A;  1B70 A;  3FYI B;  4XDK A;  2Q7H A;  2DMX A;  2CH7 A;  1AR5 A;  4G84 A;  4UP7 A;  5CA0 B;  4MTO A;  3QF7 A;  1K8A W;  2Y0I A;  4FFB B;  1Q8I A;  3STZ C;  3DTU B;  4UCU A;  3A8T A;  5KHH A;  1PYS B;  2NS6 A;  5FL7 G;  4GX0 A;  2YI9 A;  2QHV A;  3I7F A;  3GVM A;  1OCR C;  2P5I A;  2QKS A;  4FLV A;  3D36 A;  2XAF A;  3IAY A;  4H2Y A;  3VBB A;  3RUX A;  3TEH B;  1S5J A;  5LP6 C;  3BFR A;  4JI1 B;  2ZR3 A;  4B3T B;  3ZHV A;  2DWD C;  4KR3 A;  2ZE8 A;  2NR5 A;  1EM1 A;  2AKW A;  4P3O A;  1V55 C;  3LNN A;  3WB0 A;  3HRK A;  2ZTG A;  1F4N A;  2QGN A;  1BQZ A;  4O4H B;  3IC7 A;  2Q67 A;  3OGC C;  3EHB B;  4H2X B;  1I94 O;  5EK0 A;  4KR2 A;  3IC9 A;  3HXX A;  4O4L B;  1BZK A;  4X1K B;  2ZZE A;  4X9Q A;  4LF8 O;  1HNX O;  4FVM A;  2HP8 A;  1IVS A;  3JD4 A;  1EIY A;  1VF6 C;  4HBN A;  3LUT B;  4JI6 B;  2FYU H;  1RPR A;  4IL6 Z;  2CIM A;  3CX5 F;  5KAF Z;  4IHJ B;  2GHY A;  1BBU A;  2QA4 V;  4BIZ A;  1BHA A;  3ZRV A;  2E75 B;  1QBZ A;  3CP1 A;  1KC8 W;  1XL4 A;  2RJZ A;  4H02 A;  1B8A A;  2I4M A;  3QG5 A;  2XAQ A;  1KOG A;  1I08 A;  5H2F Z;  1Q90 D;  1GM9 A;  4PI2 A;  4WF9 V;  1FS0 G;  1M57 B;  1SS3 A;  1BGY H;  3VOU A;  1HW7 A;  2JIZ G;  3V8L A;  4DW0 A;  1J5W A;  4DR2 B;  4QNH B;  3JAR B;  1FAF A;  2E74 B;  1J5E B;  4J7K A;  3HKE B;  3HRI A;  3RW0 A;  2J3L A;  2LO1 A;  3RF1 A;  2YIA A;  4CC5 A;  4X1Y A;  3HKC A;  3RAC A;  4DR5 B;  4ZI7 B;  1ORQ C;  2Y69 C;  1NZ6 A;  3VQW A;  1PNK A;  3HKD A;  2AGA A;  1Q82 W;  4YRK A;  1N8R W;  1R6N A;  4MVZ A;  4DV0 B;  2ALY A;  4GX5 A;  4D7S A;  4GKK O;  3CYO A;  2J3M A;  3ETE A;  2XTA A;  1AI6 A;  4L87 A;  4PV1 B;  1FYJ A;  1WA8 A;  2ZXF A;  3Q4H B;  3G80 A;  1YI2 V;  4YIP A;  4PDL A;  1WAZ A;  1FXH A;  5ELO A;  1AI4 A;  3ZCC A;  4H44 B;  4RQE A;  1UPG A;  3JYC A;  4YDQ A;  3SYP A;  3ML0 A;  2EIN C;  1VQ8 V;  4O2A B;  3X2Q C;  2KB1 A;  2UXD O;  3CRQ A;  2VRZ A;  1OV9 A;  4GKJ O;  1SQQ H;  3H9V A;  2DJZ A;  1RM1 C;  4KFM A;  1Q86 W;  2QDO A;  2AHZ A;  2ARS A;  3MEY A;  3IFX A;  3P32 A;  5BR8 O;  2ZNJ A;  1VQZ A;  3RYI B;  3L2Z A;  3CXH F;  1NJ8 A;  3SYC A;  1E22 A;  4JYA O;  5LGU A;  1FFX B;  1PKX A;  4I5S A;  2ARU A;  2ZXW B;  1OJH A;  1E79 G;  4UCT A;  4TV9 A;  1M56 B;  2XTI A;  2AMC B;  3UO2 A;  1V54 B;  3DXR B;  5EZY A;  1Y6X A;  1GN3 A;  5IY5 B;  4HAM A;  1GK9 A;  3N2G B;  1WPX A;  5IYZ A;  4X66 O;  2UU9 O;  1LYL A;  3E22 A;  1XNR O;  1VF7 A;  1W59 A;  1KMI Z;  3OTO O;  4OPA A;  4DV2 O;  2WPD G;  2EIM B;  2IJK A;  4YRI A;  4O2B B;  2ZNI A;  4BIO A;  4GZR B;  4JI7 B;  2YSU B;  1AP5 A;  3AG2 B;  3ZJZ A;  2R9R B;  2CGO A;  4DV5 O;  3TGU H;  4JF3 A;  4U3J A;  3E89 A;  4JI2 B;  4LF4 O;  5LYJ A;  3WFV A;  4WFG A;  1NQT A;  2EIJ C;  3AG4 B;  1MZF A;  3NR7 A;  1U96 A;  3W7W A;  4NYK A;  3CRC A;  2PZS A;  1S72 V;  3RKW A;  3AG7 A;  1HWY A;  2HLD G;  3E83 A;  5EC2 C;  3ZMT A;  3I55 V;  1OCO B;  2JEU A;  4XBF A;  5LMN O;  2ZT5 A;  4DV3 B;  1D5N A;  3JAS A;  1PD3 A;  1BS3 A;  1WNS A;  1NVP B;  4OX9 B;  4TWK A;  2IU3 A;  3CHX A;  4UP8 A;  3V7C A;  4ZHQ B;  2UUB B;  4I50 A;  3RVZ A;  1N33 O;  1O9G A;  2X6B A;  4NTY A;  1XNQ B;  4LVK A;  3ABT A;  1DTO A;  2QJ1 A;  2YIC A;  3CRA A;  3K79 A;  2LP7 A;  4HWT A;  1H2M A;  2PME A;  5IJ0 B;  3B40 A;  1Y76 B;  1ENV A;  5FNV A;  2QWO B;  1WN7 A;  2F95 B;  4PDV A;  2Q0A A;  5J2U B;  2JGD B;  2I4N A;  4UCV A;  4CH6 A;  3JD1 A;  5EBW C;  4ZTZ B;  1MG1 A;  1G8M A;  1HNW B;  1KMM A;  3K0D A;  2Q8V A;  1WNL A;  3JAK B;  4MVU A;  2ZT9 B;  2KG7 A;  4EB6 A;  4LF9 O;  2QHU A;  3RBZ A;  2CDY A;  1H8E G;  1YXB A;  4YRS A;  5J9P C;  4I55 B;  4HZ3 A;  4R6Z A;  2PMF A;  1IX9 A;  4J9Z B;  4RO2 A;  3OEH G;  5IE9 A;  3WQZ A;  2GUZ B;  1VQ5 V;  4PD4 F;  4PG3 A;  5HFL A;  4BW5 A;  1JOY A;  4XU3 A;  2LGW A;  3M8A A;  2X6A A;  4I4T B;  3RT3 C;  4IGG A;  4JI4 O;  5CA1 A;  1VMG A;  3K06 A;  2EJ7 A;  4JV5 O;  3BRC A;  4QGP A;  1CP9 A;  1JFF A;  3GB7 C;  4DR3 B;  1QHT A;  3HB3 B;  2WLH A;  1EVK A;  3T1Y B;  3LDD A;  3F7V C;  2GSM B;  3OAA G;  1YTF D;  1F51 A;  1RSO B;  3H1H H;  4LFB B;  2XAG A;  4B3S B;  3K03 A;  1YB3 A;  3OW2 U;  5C8Y A;  1GMG A;  3HKB B;  2F23 A;  4K0K O;  5JH7 B;  1IL2 A;  3CCE V;  3KKY A;  2QE7 G;  3F7Y C;  3FX7 A;  5D5Q A;  3TJT A;  1WYD A;  2LW1 A;  3E8B A;  4QIW F;  5KA6 A;  1Y67 A;  3RYF A;  4XDL A;  2DZ9 A;  3G1Z A;  3T4D A;  2P7T C;  4B3M O;  1JJ2 U;  3K04 A;  3N2K A;  1BHB A;  1VQK V;  1FKA O;  3ZED A;  3L70 H;  2JGU A;  1MZE A;  1RP3 B;  3OEE G;  4XTW A;  4WJ3 M;  4X65 B;  1H4T A;  4R8C A;  3T1H B;  1SC5 B;  1SA0 A;  2ART A;  1YVW A;  4RDX A;  2M6Y A;  3AK3 A;  1VP7 A;  2JEX A;  4DV1 O;  4FM0 A;  1H38 A;  4X62 O;  3OD1 A;  2A7W A;  2EIL C;  1G5H A;  4R50 A;  1B7Y A;  1Z2G A;  3QNE A;  4LF5 O;  2X0L A;  5EYP B;  1E1Q G;  5B1A C;  2YEV B;  2RN9 A;  3DSQ A;  2WAM A;  4DV7 O;  4MTF A;  4YP0 A;  3F5T A;  1ASY A;  4FIP C;  4WF2 A;  1VQ4 V;  1Q6H A;  1SER A;  2R70 A;  2UXC B;  1Q7Y W;  4DUY B;  4I9W A;  2EWN A;  1N0N A;  4PA6 A;  4YJ2 A;  2B5U A;  1EZV H;  1R3L C;  4QPK A;  4DR6 B;  4XU1 A;  4FJC C;  2ZD9 A;  5CBH A;  4K8Z A;  1COW G;  3JAW A;  1NJ5 A;  2XOK G;  3SYO A;  4GLX A;  1M57 C;  4F6R B;  1X56 A;  2Q5I A;  2GDS A;  1JMK C;  4MVO A;  4U3F H;  3K58 A;  5B1B B;  2ITD C;  1G1X B;  5CA0 A;  3JCZ A;  3IAL A;  4LFC O;  4FFB A;  5GW7 A;  1QLE C;  3OGI B;  2E41 A;  1P7B A;  1WB7 A;  1WPB A;  4CS4 A;  1URF A;  2OIE A;  1PYS A;  4UV8 A;  4KHP O;  4G2K A;  1R73 A;  2LGQ A;  2R72 A;  1SZX A;  1PL4 A;  3TCU A;  1YJ9 V;  1EN6 A;  3HXZ A;  1K9M W;  1J95 A;  2E3C A;  2AHY A;  1KEC A;  3BAB A;  1AP6 A;  1Q43 A;  3TEH A;  3ERR A;  4E51 A;  4OGQ B;  5B66 Z;  3ZN1 A;  3VQY A;  2QKC A;  5ITZ B;  2CTP A;  3K9S A;  1HR0 B;  3CC4 V;  2IU0 A;  2XHB A;  1YIJ V;  2FKX A;  3IKL A;  4CS3 A;  3NEN A;  4J41 A;  3ABK B;  1EOV A;  3QO7 A;  3FB8 C;  1GKF A;  4PHC A;  4FZ1 A;  1THZ A;  5TIS Z;  3ICX A;  3JAT B;  4B7K A;  1Y74 B;  4O4I A;  5KMG B;  4JAA A;  4O4H A;  3ZMV A;  3BFM A;  3CC7 V;  2EJF A;  2HVK C;  4JAS A;  3UGT A;  2QM4 A;  2ZR2 A;  4X88 A;  1L0N H;  2X6C A;  4X1K A;  4NXM O;  2JRI A;  2YID A;  3R66 A;  2QM7 A;  1S0V A;  3A0H Z;  2DU5 A;  1IBK B;  2X7R B;  4YRP A;  4IYI A;  4TVW A;  3WG7 C;  2UXB B;  3O9O A;  2YIB D;  3ICA A;  2V7Q G;  1M56 C;  4H2U A;  1DF5 A;  4IHJ A;  1SQB H;  5H6Q A;  4B7E A;  4FK5 C;  1V54 C;  5L3B A;  5IYD O;  3H1L H;  1XUQ A;  3ASN B;  2ARH A;  3SJB C;  1Z5V A;  4X89 A;  2YUA A;  4XDJ A;  1XMQ O;  2ADP A;  3RGB A;  1XHX A;  1QQC A;  2JJ1 G;  2ODR D;  2QWN B;  1NVP D;  4YRT A;  3RGL A;  4H2S A;  4DYL A;  4GX1 A;  2EIM C;  4CH3 A;  4YY3 B;  2ZCE A;  2QR4 A;  3J80 N;  1O9H A;  2UXX A;  2YDE A;  3BA8 A;  5DM6 V;  3JAR A;  1WJZ A;  4GCZ A;  4MSW C;  5LA6 B;  1FPO A;  4XEM A;  2XGT A;  2H94 A;  2EAY A;  4I0X B;  2HEP A;  5C52 B;  1ARO P;  4P75 C;  2CTW A;  2R9I A;  4DPG A;  1VAR A;  1YCI A;  4MTG A;  2EZO A;  5KUM A;  3AG4 C;  2Z0A A;  1IXB A;  4YJ3 B;  3SPJ A;  2WWW A;  5A9G A;  4GT1 A;  3H1K H;  3UM7 A;  2D2C B;  1EFR G;  1OCO C;  1YFT A;  5JWP A;  2YXY A;  4LVJ A;  3IKM B;  4PA9 A;  4W4L A;  1R3K C;  3CCQ V;  3KCX A;  3ETD A;  2ZT7 A;  3OE7 G;  2CGH A;  2OIG A;  1ATI A;  1H2S B;  1VIB A;  4PA7 A;  1E1R G;  2A06 H;  3Q4H A;  1XIL A; 
#chains in the Genus database with same CATH homology
 1E22 A;  5CB4 A;  2DVE A;  2PGG A;  1P49 A;  2E1H A;  4K86 A;  1FFX B;  3P8Y A;  4YCU A;  1G51 A;  1SRY A;  1M4U A;  2ARU A;  3U11 A;  4UCT A;  4LF8 B;  3PCO A;  4TV9 A;  2DXT A;  4O2A A;  4KQE A;  3CMQ A;  4TUY A;  2XTI A;  3A32 A;  1YFS A;  2AMC B;  2ZIO A;  3UGQ A;  3REU A;  4U3J B;  5EZY A;  5LYJ B;  3PN1 A;  3N2G B;  2E10 A;  4EFB A;  5IYZ A;  2CJA A;  3A7A A;  1EFW A;  1LYL A;  4X20 A;  2F4V B;  1NYR A;  4LVM A;  4BW9 A;  1H4V B;  4ZTU B;  3SJC C;  4K8X A;  4P73 A;  4LNS A;  5LXT B;  3HY0 A;  3E22 A;  4XEO A;  3RYI A;  4FM1 A;  1VF7 A;  4FLZ A;  5HGQ A;  4Q15 A;  4Q6G A;  1KMI Z;  1SET A;  3JAS B;  4H2X A;  4UFZ A;  4TQD A;  1NJ6 A;  3BPZ A;  4K87 A;  1FFX A;  4YRI A;  4O2B B;  2ZNI A;  2HHH B;  4NXM B;  2RQ6 A;  1RIQ A;  4DUZ B;  2UUA B;  4P73 C;  3WB1 A;  4P71 A;  4JI5 B;  1SA0 B;  2F93 B;  4JI7 B;  12AS A;  2YI8 A;  5GON B;  3MAQ A;  5FPR A;  5JCO C;  2DQ3 A;  4O4L A;  4OLF A;  3QTC A;  4I50 B;  2AMC A;  4P72 C;  3LSS A;  4DR7 B;  2BTQ B;  3A7R A;  3KFU A;  4U3J A;  4TV8 B;  4JI2 B;  4X62 B;  5LYJ A;  1V9P A;  4O2D A;  4P71 C;  5IJ9 B;  1WQW A;  4RQF A;  4EO4 A;  5JVD B;  3NEL A;  2PZS A;  4LF5 B;  2ZIN A;  2UUC B;  4CC6 A;  3RKW A;  1NJ2 A;  5LXT A;  2E5A A;  3JAT A;  1XMQ B;  4DV7 B;  5KHG A;  1TA8 A;  4DK0 A;  4DRX B;  3HXW A;  2ZT5 A;  4DV3 B;  2VQE B;  2DDZ A;  3JAS A;  1BBW A;  2YXL A;  4O2B A;  4BWA A;  1EVL A;  1WNS A;  3VQV A;  4HNA B;  5GON A;  4OX9 B;  1NYQ A;  3K5O A;  3HFZ B;  3CHX A;  2ZZF A;  4J15 A;  4UP8 A;  4ZHQ B;  2UUB B;  4P75 A;  3V7C A;  4I50 A;  2BTQ A;  1O9G A;  4LVK A;  4D7T A;  1XNQ B;  5K1X A;  3R07 A;  2QJ1 A;  2YIB A;  1E24 A;  4EB6 B;  4H2V A;  2DTO A;  3UT5 B;  4HWP A;  4JI8 B;  4HWT A;  4AIL C;  5KHJ A;  2PME A;  5IJ0 B;  5EIB D;  3A5Z A;  4B3R B;  3HKE A;  1T5E A;  1Z5W A;  4B08 A;  1WU7 A;  4UCR A;  2EX3 A;  5FNV A;  4UPA A;  4DRX A;  1G6U A;  1X01 A;  5C53 B;  4ZI7 A;  2DEQ A;  1WN7 A;  2F95 B;  5CA1 B;  4YPF A;  5J2U B;  2Q0A A;  3A31 A;  2DQ0 A;  2I4N A;  4UCV A;  4CH6 A;  4ZTZ B;  4HNA A;  1HNW B;  3PZC A;  1KMM A;  3HFZ A;  2JVD A;  4IIJ B;  1X54 A;  2I4L A;  1BIA A;  1I7F A;  4ZHQ A;  3RL6 A;  1WNL A;  3JAK B;  2PYL A;  5C51 B;  5BR8 B;  1M93 A;  2CAZ C;  4CH4 A;  2V4D A;  4YRM A;  1JFF B;  5E3I A;  2IY5 B;  3LSQ A;  4EB6 A;  1E1T A;  2QHU A;  2ODR C;  4YCW A;  3UT5 A;  4L8J A;  3K5L A;  3L1A A;  4JYA B;  1I94 B;  4TQF A;  5LOV B;  4I55 B;  4HWS A;  1NJ1 A;  5IJ0 A;  4YRS A;  2PMF A;  4LVL A;  2EJG A;  4YRG A;  4XTY A;  2BTO A;  2P22 C;  3WQZ A;  1FYF A;  2PY5 A;  4PG3 A;  4XU3 A;  4I4T B;  4LF6 B;  4CS2 A;  4HVC A;  5C8Y B;  1W66 A;  4PHZ A;  1HNX B;  4NVP A;  4TVY A;  1SQG A;  4DK1 A;  3JAL B;  2Q7E A;  5CA1 A;  3UQ8 A;  5J2U A;  5LMU B;  4YJ3 A;  3SR2 C;  4LFA B;  2CJB A;  2DXU A;  4UP9 A;  4X1I B;  4IIJ A;  4UCS A;  1B04 A;  2KKW A;  4ZIB A;  3A74 A;  4O4I B;  2VWJ A;  3BRC A;  1WQ7 A;  3ETQ A;  5JQG B;  1JFF A;  2RHS B;  2IY5 A;  1FJG B;  5JJN B;  1E1O A;  3RYF B;  4AHC A;  4DR3 B;  1X55 A;  1QHT A;  3E9I A;  2RHQ A;  4EX5 A;  1QF6 A;  4DV2 B;  5FPO A;  4HWR A;  4O4J A;  4H2W A;  4YRR A;  3V8J A;  1EVK A;  3T1Y B;  3RYC B;  5LOV A;  2PUS A;  3A7U A;  5JCO A;  3UFG A;  1IBL B;  3FJP A;  3N2K B;  4OP0 A;  2OWO A;  4LFB B;  4LNU B;  2JS5 A;  4B3S B;  5KHI A;  3E9H A;  3NET A;  3BAA A;  4LR3 A;  3K5N A;  1YB3 A;  3B2E E;  4JI3 B;  4I4T A;  5C8Y A;  3JSL A;  1D5A A;  3HKB B;  5J2T B;  4NXN B;  2E65 A;  5JH7 B;  4P3N A;  2CJ9 A;  1IL2 A;  1QE0 A;  1X2G A;  3JAL A;  1XHZ A;  3HXY A;  5D5Q A;  3CSX A;  2Q7G A;  3HTZ A;  4CH5 A;  4X1I A;  1WYD A;  3JSN A;  4EEQ A;  1JJO A;  1TAE A;  4DR4 B;  1B7Y B;  3M7M X;  2EJ9 A;  4XU0 A;  2R9A A;  4XTZ A;  2ZM6 B;  1ADJ A;  3N2G A;  1B70 B;  5K1P A;  5JQG A;  2OYQ A;  2RHS A;  3TUP A;  4DV4 B;  4TTV A;  3M4Q A;  3RYF A;  1G5I A;  5LMN B;  4TVA B;  2DZ9 A;  3G1Z A;  3RYC A;  2F1M A;  1RSO A;  3N2K A;  3RKY A;  2ALY B;  4YRE A;  3ZED A;  4LNU A;  2QHT A;  3V8K A;  2JGU A;  2ZGW A;  4KL1 A;  1L0W A;  2A8E A;  4UCO A;  1SES A;  4XTW A;  4WJ3 M;  4X65 B;  1H4T A;  4YJ2 B;  4GKK B;  3HKB A;  5J2T A;  3T1H B;  1SA0 A;  2ART A;  2DZC A;  5BMV B;  5JH7 A;  4RDX A;  3U10 A;  5LP6 B;  1SKV A;  3K57 A;  3A5Y A;  5JJJ B;  4FM0 A;  4P3P A;  3OD1 A;  3JAW B;  5F5W A;  4TV8 A;  1G5H A;  3CB2 A;  2PTM A;  1HC7 A;  4YRF A;  4YYE A;  1B7Y A;  1XI1 A;  4FM2 A;  1B70 A;  5IJ9 A;  3QNE A;  3BHP A;  5EYP B;  2Q7H A;  4XU2 A;  1C0A A;  5JVD A;  3DSQ A;  1YGB A;  4G84 A;  1XMO B;  5CA0 B;  3EFR A;  4TVA A;  4UP7 A;  4YP0 A;  3QF7 A;  4WBN B;  1ASY A;  4FFB B;  1Q8I A;  3UH0 A;  4WF2 A;  1X2H A;  3SJA C;  2UXD B;  1SER A;  2R70 A;  2UXC B;  1N32 B;  4UCU A;  4FLY A;  3IG2 A;  3HY1 A;  4ZOL B;  5KHH A;  3W3S A;  2AKW B;  4DUY B;  1PYS B;  4GKJ B;  2NS6 A;  2ZT6 A;  2EWN A;  4FLX A;  1GGM A;  4YJ2 A;  1KMN A;  5JJE B;  2P5O A;  1TVK B;  5BMV A;  4YHH B;  1ADY A;  3MF2 A;  4DR6 B;  5LP6 A;  2YI9 A;  2QHV A;  4XU1 A;  4YRQ A;  4RMF A;  3A2F A;  3I7F A;  4K8Z A;  2P5I A;  3JAW A;  4FLV A;  1NJ5 A;  1USY C;  3IAY A;  4GLX A;  4F6R B;  3QO5 A;  3QO8 A;  4HWO A;  1X56 A;  2Q5I A;  4H2Y A;  1JMK C;  1IBM B;  3VBB A;  3K58 A;  3RUX A;  3TEH B;  1S5J A;  5EYP A;  3PCO B;  5LP6 C;  4LVI A;  4JI1 B;  5CA0 A;  3IAL A;  1HNZ B;  4WBN A;  4B3T B;  2ZR3 A;  1Q5O A;  3EFS A;  4FFB A;  3MF1 A;  2VQF B;  2E41 A;  5EIB C;  4LF7 B;  4KR3 A;  1WPB A;  3RYH B;  4CS4 A;  1EIY B;  4ZOL A;  2AKW A;  1PYS A;  2I4O A;  4YRC A;  3RFR A;  4P3O A;  1N34 B;  3BJU A;  1X4T A;  2R72 A;  1TVK A;  3LNN A;  4X66 B;  3WB0 A;  3HRK A;  2ZTG A;  2UU9 B;  3E22 B;  1DGS A;  1H4Q A;  3HFV A;  3HXZ A;  5KX5 B;  3JAK A;  4O4H B;  4F6R A;  2E3C A;  1XNR B;  4H2X B;  3LC0 A;  3OTO B;  3BAB A;  1Q43 A;  3TEH A;  3ERR A;  4YRL A;  4E51 A;  4KR2 A;  1TGO A;  4I55 A;  4PI0 A;  1ZAU A;  4WI1 A;  1NT2 B;  3VQY A;  1EQR A;  3HXX A;  4O4L B;  4P74 C;  5ITZ B;  2HNI A;  4X1K B;  4K0K B;  2ZZE A;  4AH6 A;  4YRJ A;  1HR0 B;  2XHB A;  4XTV A;  3IKL A;  4DQ2 A;  4FVM A;  4DV5 B;  1N36 B;  3NEM A;  3RYH A;  1EIY A;  4LF4 B;  2PYJ A;  4HBN A;  4CS3 A;  4JI6 B;  3THO A;  2E5L B;  3NEN A;  2EL9 A;  3ZS8 C;  3L4G B;  1EOV A;  3QO7 A;  4AQY B;  4PHC A;  2CIM A;  2GV9 A;  4IHJ B;  5KNN A;  1BBU A;  3ICX A;  3JAT B;  5KX5 A;  4O4I A;  5KMG B;  4X1Y B;  3HKC B;  4O4H A;  3BFM A;  4B3M B;  2RJZ A;  2EJF A;  5KHK A;  3K5M A;  4H02 A;  4H2T A;  4EFE A;  3UGT A;  5D5P A;  4P72 A;  1B8A A;  2I4M A;  4XTU A;  2QM4 A;  4FLU A;  2IM9 A;  3HKD B;  3QG5 A;  3V7S A;  2DTH A;  3RKX A;  1KOG A;  1B76 A;  2FYK A;  2ZR2 A;  5ITZ A;  3HXV A;  4X1K A;  4PI2 A;  4FLW A;  1BIB A;  1ASZ A;  2Q5H A;  4DV1 B;  2G4C A;  1HW7 A;  4YRN A;  3V8L A;  2DU5 A;  1N33 B;  4FLT A;  1IBK B;  1J5W A;  4YRP A;  3P8V A;  4DR2 B;  3JAR B;  4TVW A;  2UXB B;  2YIB D;  3L4G A;  3ICA A;  1J5E B;  4H2U A;  4HT4 A;  3HKE B;  3HRI A;  4IHJ A;  5ELN A;  2J3L A;  3M4P A;  4G85 A;  3RF1 A;  3RIR A;  2YIA A;  2F66 C;  1JJC B;  4CC5 A;  5KMG A;  4X1Y A;  5FNV B;  3HKC A;  1YFR A;  3SJB C;  4DR5 B;  1N9W A;  4ZI7 B;  1Z5V A;  2P0L A;  3RAC A;  4DV6 B;  3VQW A;  1TUB B;  4K88 A;  3RGB A;  3HKD A;  1HXD A;  4YRK A;  1Q3E A;  3HXU A;  4LH6 A;  1XHX A;  3U0Z A;  1QQC A;  1WLE A;  2C7I A;  3BA9 A;  2ZZG A;  11AS A;  2ODR D;  3P8T A;  4DV0 B;  2ALY A;  1USY A;  3RWR D;  4D7S A;  1WPY A;  4YRT A;  3RGL A;  4H2S A;  4WJ4 A;  2J3M A;  4CH3 A;  4YY3 B;  4YRO A;  2ZCE A;  3WB2 A;  4L87 A;  1O9H A;  3BA8 A;  4X5O A;  1KU9 A;  3JAR A;  5LA6 B;  4LF9 B;  3VQX A;  1HTT A;  2XGT A;  4XEM A;  4XTX A;  2EAY A;  2HEP A;  3TEG A;  5C52 B;  2ZXF A;  4DR1 B;  3V7R A;  4NCX A;  1L8D A;  4P75 C;  4TOI A;  1SQF A;  1NNH A;  4I9Q A;  4DPG A;  5CB4 B;  1XQ8 A;  3FFQ A;  4JI0 B;  1JJC A;  5ELO A;  4RQE A;  2C8M A;  2DKG A;  4LFC B;  1H4S A;  4TV9 B;  4YDQ A;  4LH7 A;  1TUB A;  2DU7 A;  3MQZ A;  1Z7N A;  4O2A B;  4YJ3 B;  3SGI A;  4TUY B;  2ZT8 A;  4JI4 B;  3REX A;  1YEW A;  4KHP B;  2ZIM A;  5EZY B;  2DTI A;  4YCV A;  1YFT A;  1M5I A;  4LVJ A;  2DJZ A;  3K59 A;  3IKM B;  5IYZ B;  4TWA A;  4X64 B;  2ARS A;  4JV5 B;  2QHS A;  4X20 B;  3MEY A;  2RHQ B;  2ZT7 A;  4GYC B;  1Z7M A;  4O4J B;  2CGH A;  5IWA B;  5LA6 A;  4HA8 A;  2VWK A;  2ZNJ A;  1VQZ A;  1ATI A;  1H2S B;  3RYI B;  4P74 A;  3L2Z A;  1NJ8 A;  3OTF A;  2E64 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...