3DSQA

Structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
278
Chain Sequence
b'PPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolysyl-tRNA synthetase
publication title Structure of Desulfitobacterium hafniense PylSc, a pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
total genus 80
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3dsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3dsqA02
4TVAA 2AKWB 4TWAA 1B7YA 4P73A 4X5OA 4P3PA 2ODRC 2RHQA 4WJ3M 2ARUA 4WI1A 2YIAA 3A7UA 4BW9A 4KQEA 4H2VA 5F5WA 1USYA 1SERA 4XU1A 2CJAA 11ASA 1QF6A 2I4MA 4DPGA 4Q15A 3IALA 1H4SA 3VQYA 2YIBA 5ELOA 4HWPA 1H4QA 2XTIA 2RJZA 3E9HA 1BBUA 4TTVA 4XTYA 4DQ2A 4P71A 3TEHA 2E65A 3PCOA 2ARTA 1QE0A 2QHTA 3HRIA 4P73C 1WLEA 2CGHA 1EIYA 2PGGA 3L4GB 4XTWA 1E1TA 3REUA 3DSQA 5K1PA 2DXUA 3A7RA 4TVAB 4ZIBA 3NENA 1B7YB 2YI9A 2E64A 3QO8A 3NETA 1HXDA 4YRSA 2E41A 1H4VB 3HFVA 3EFRA 1FYFA 4L87A 1Z7MA 2CJ9A 4P71C 3MF1A 1B8AA 2AMCA 2HNIA 3NEMA 1JJCB 3HY1A 4CS4A 2QHVA 2ZR2A 1BIAA 4YP0A 1NJ2A 2DU5A 3BJUA 2P0LA 3VQVA 2PMEA 3PCOB 3CMQA 2E10A 3HXYA 3HXZA 1X54A 1X01A 3RL6A 2ZZEA 1EIYB 3A74A 3RKXA 4XTVA 3TEGA 1NJ8A 5HGQA 4CH5A 5ELNA 1Z7NA 3HTZA 4NCXA 3R07A 2DZ9A 4P74A 1O9GA 3FJPA 2HEPA 1NJ1A 4HWRA 4RQFA 4CH4A 1ADJA 2ZR3A 4XU3A 2ZCEA 2RQ6A 4UP9A 1WYDA 4KR2A 3RF1A 2R70A 2QHSA 3QNEA 4H2XB 3BHPA 2EJFA 4RMFA 4WJ4A 4ZTZB 2AMCB 4K88A 1BIBA 2ZZGA 2CIMA 1LYLA 3HRKA 3TUPA 4CS2A 1H4TA 4YRCA 4YYEA 1EOVA 2ZZFA 2Q5IA 3RACA 4BWAA 3V8JA 4YRRA 4H2UA 1JJCA 2ZT8A 4OLFA 3OD1A 3MF2A 4E51A 1KMMA 2DKGA 3M4QA 1C0AA 1WNLA 2RHSB 2C8MA 2FYKA 3IKLA 2YI8A 2ZTGA 4YPFA 3RKWA 2DTHA 3QO7A 2IY5B 2PMFA 4H02A 3LSSA 1KOGA 3UFGA 4UP8A 3IG2A 1USYC 1J5WA 1WPYA 4K87A 1EFWA 2PUSA 4HWSA 1NJ5A 1X2HA 4OP0A 3EFSA 3VQWA 4YRTA 1WQWA 4XTZA 1YB3A 1G5IA 3QTCA 2ZIOA 2DDZA 2ZT5A 1B70B 2EJ9A 1EVLA 4H2XA 1L0WA 4EX5A 4G85A 1YGBA 4XTXA 3QO5A 3P8YA 1SESA 2DXTA 1RIQA 5C51B 4RQEA 2I4LA 4YRIA 4P72A 1G6UA 1E1OA 2DEQA 4PG3A 4YRKA 3HY0A 3NELA 3UH0A 4YCUA 3V7RA 3W3SA 4HA8A 1WQ7A 1HTTA 4YREA 2ALYA 4ZTUB 3HXXA 4TVYA 1HC7A 2ZT7A 4P3NA 1SETA 3REXA 1NYQA 1EQRA 4YRLA 5K1XA 2P5IA 3MEYA 3V8KA 2RHSA 1YFRA 3ICAA 4P72C 2CJBA 4YRMA 2IY5A 2E3CA 2R72A 2C7IA 1W66A 3A32A 4J15A 1E22A 4HVCA 1O9HA 2J3MA 2ZXFA 3ERRA 2DJZA 4CS3A 2I4NA 1YFTA 3A5ZA 2ZNJA 3ZEDA 3RUXA 1SRYA 4P74C 1B70A 3UGTA 1B76A 2J3LA 3LSQA 2ALYB 4WF2A 1E24A 2ZGWA 1VQZA 4YRNA 3VQXA 3HFZB 4UPAA 3L2ZA 4EO4A 1BBWA 3UGQA 4YRJA 1NYRA 2E5AA 4H2WA 4YDQA 12ASA 2JVDA 4LNSA 3HXUA 2EL9A 4P75A 4CH3A 1ASYA 3P8TA 1PYSA 1N9WA 4K86A 4Q6GA 3VBBA 3E9IA 4XEOA 4G84A 3V7CA 5E3IA 4AH6A 1X55A 1IL2A 1GGMA 2DTIA 4XEMA 2DTOA 3WQZA 4YRQA 1EVKA 4TQDA 2ZIMA 2I4OA 4XU2A 2ODRD 1YFSA 1G5HA 3RIRA 2ZINA 2EAYA 2G4CA 2DZCA 2EWNA 4TQFA 4HWTA 3HXWA 3A31A 2DVEA 4P75C 4YROA 3M4PA 5C52B 4O2DA 2RHQB 4TVWA 3RGLA 4KR3A 3G1ZA 4YRPA 2XGTA 2E1HA 4UP7A 3PZCA 2AKWA 2QJ1A 4YCVA 3V8LA 2Q5HA 1PYSB 1G51A 4XTUA 1WU7A 2Q7EA 1NNHA 3HFZA 4YCWA 3KFUA 4P3OA 3TEHB 1X2GA 1ASZA 5C53B 2DU7A 4XU0A 3HXVA 4H2SA 3IKMB 4HWOA 5KNNA 4YRFA 3LC0A 2EJGA 3I7FA 2YIBD 2Q7GA 1KMNA 1NJ6A 4H2TA 3A7AA 1ADYA 4H2YA 2QHUA 3V7SA 2ZNIA 1X56A 3RKYA 3A5YA 4CH6A 2Q7HA 3L4GA 4PHCA 2ARSA 2DQ3A 4RDXA 2ZT6A 1ATIA 3L1AA 3P8VA 2DQ0A 4YRGA 3BFMA
chains in the Genus database with same CATH superfamily
4TVAA 4Z2WA 4MVQA 1VQ8V 2VWJA 1CPYA 3OR6C 1D2DA 2CH7A 4DV4B 1VQ7V 1ENVA 2ARUA 3CJHB 4CBCA 1WB7A 5LOVB 4BW9A 3ZHRA 3BY6A 5IWAO 4KQEA 2BOCC 1Y74A 1BSMA 1H8EG 2YS8A 5J2TA 1B3QA 1K3EA 3BRCA 3IALA 1H4SA 3CMAV 1EBOA 3UT5A 1B04A 4DW1A 5FPRA 3LNNA 2DN9A 2RJZA 3CMEV 3E9HA 4QE9A 2KQXA 4TTVA 2UXNA 3OTFA 1N36O 5FLXN 2ARTA 2BCCH 2Q0OC 3FAVA 1FAFA 3SPGA 2PGGA 3RW0A 4NTXA 5K1PA 3CWBH 1NTZH 5GONB 1P49A 4K35A 4ZOLA 1AJPA 2F4VO 1VF6C 1AR4A 3F5WC 5H6QA 3DGEA 3JD3A 3NENA 2YI9A 5L3DA 2HKOA 1BS3A 1S3JA 3ZCCA 4MVOA 4X20B 1DF5A 2W0FC 5HFLA 4YRSA 5KLVH 4L87A 5EC2C 5B1NA 4ZI7B 1L8DA 1KP3A 1QBZA 4UUJC 2R9RB 4D6TH 2KG7B 2AMCA 3RWRD 2HNIA 5C8YA 3G80A 4LF6B 4WFFA 5IYCO 4CS4A 3CCEV 1YZBA 3H1IH 2UUCO 2QE7G 4TWKA 1Q90D 4DR5O 3BJUA 2P0LA 4JAUA 3SYAA 2OIEA 4DR7B 2LO1A 1JMKC 3PCOB 1DK1A 1X01A 4J10A 1PP9H 3RL6A 5KA6A 2UUAB 2XT9A 4XTVA 1X4TA 4CH5A 2Q6AA 1OV9A 4E2LA 1N32O 4P74A 3FJPA 2HEPA 1VEWA 1NJ1A 3CD6V 1YSCA 3K9AA 2ZR3A 3ZX6A 4QPJA 5A9GA 2HVJC 2IJHA 3STLC 3CCJV 2RQ6A 5H9CA 5IJ0B 3N2KB 3RF1A 2FB5A 2R70A 4H2XB 2X0LA 3BHPA 3KCYA 3NXSA 3JD4A 1MSDA 1I94B 1SS3A 1KMIZ 3JASA 2ZDIC 3TUPA 3ZMZA 1I0HA 1YTFD 1PKXA 1MA1A 2XAHA 3TGUH 5EIBC 3L74H 1NVPB 2FMLA 2AZ2A 5ITZA 2QSAA 4PDLA 4H2UA 4OLFA 5CA1A 2EILC 1IZ3A 3OD1A 1W0JG 1AI7A 3CXCU 3LUTB 3GWOA 4UFZA 4UVAA 1YCIA 5KUKA 1C0AA 2WPDG 5EC1C 2Q67A 1YJNV 3CE2A 3D36A 4FLWA 2EILB 2EZPA 2ZTGA 4MW3A 5H6RA 1VQ5V 3UO3A 3ABUA 4X62B 3ZIAG 2B5UA 2WAMA 4WFGA 4UCOA 3LSSA 3FKSG 1A32A 2Q0AA 4GX2A 4X1KA 4U7OA 2E75B 4MVUA 1QLEB 1BT8A 4K87A 3TXQA 2VWKA 1FFTB 3IJ4A 4HWSA 5KA5A 4FLZA 1X2HA 3K9SA 4FFKA 1DTOA 1NS1A 4B7KA 1YB3A 2JS3A 3QTCA 1SQXH 3H01A 5EYPA 3STZC 1S5LZ 4O4LB 4TV8B 3QO5A 3RT3C 2X6CA 1S5JA 4EB6A 5EZYA 1G1XB 1RIQA 5C51B 4NXNB 5LL6Y 3E89A 4RQEA 1VQMV 2I4LA 4X8AA 4X65B 1DLBA 1Q8IA 2ZQMA 5B3SC 5B1BB 1PL4A 2CTRA 4TUYB 2VQFO 3ZMUA 3RYFB 1S77D 3W3SA 3JAKB 4X1YB 2EX3A 1V9PA 3AEIA 3ETGA 4R7CA 5AG2A 1JX9A 4DV2O 4J42A 2EULA 2QR4A 4UV8A 2ALYA 1Q43A 1NKDA 5LGUA 1TUBB 3T4DA 2D2CB 3SGIA 1IVSA 3ZRVA 5B3SB 4DV5B 2IH3C 3HKCA 3FB5C 1MOFA 4FLVA 4GCZA 3QF7A 3SPCA 3VOUA 4WCEV 4AQYB 3AG4C 4BIOA 1VF7A 3BFRA 3OMIB 1F4NA 5KX5B 1DF4A 4JI7O 2CJBA 2IY5A 2E3CA 2R72A 1W66A 2F23A 3A32A 2PYJA 1S5HC 4RUFA 4DR6O 1IX9A 2OTJV 3AG4B 3ERRA 3ETDA 4N23A 2DJZA 3HKBB 4CS3A 2I4NA 4GLXA 1IBLB 1L0LH 2KSDA 3ZEDA 4IYHA 1K4CC 5LYJB 4FIPC 1QVGU 2LFSA 5L3GA 2HP8A 1KC8W 1J5EB 5KHHA 3LSQA 1R6NA 1E24A 3JCUZ 2ZGWA 4JI2O 5JQGB 4YRNA 4F4LA 2CK3G 5LXTA 1E1QG 3SPJA 1KUQA 4EO4A 5CB4A 2QM7A 2IM9A 2E5AA 3A0HZ 4JZ2A 5CA0B 1JOYA 4H2WA 4YDQA 3ZMVA 3ABKC 1K9MW 5KMGB 3K5OA 3SJBC 4LNSA 1SKVA 5LP6B 4JI3O 3P8TA 1XOUA 1GN2A 1Z5VA 3VBBA 4FFBA 2BSKA 4DV6B 4KHPB 3ABKB 4UCTA 3DC5A 4G84A 1NH2B 3E8BA 3ASOC 1XBLA 5BR8B 1ZL8B 5E3IA 4XDJA 1PNMA 4L8JA 1YVWA 4MTFA 3HKEB 4LF4B 3RVYA 4YRQA 2BE3A 2B9ZA 3SJAC 1FFXA 2ZIMA 4GKJB 1YFSA 1Z2GA 2FL4A 5FL7G 2ZINA 2DZCA 2EWNA 3ASOB 4HWTA 2JIZG 3M99B 4JI8O 2WA3A 4P75C 4O4HB 2CGNA 2Z0AA 3CYOA 2CH7B 4O2DA 3P32A 5CBGA 4TVWA 4NKGB 3RGLA 3G1ZA 1OCOB 4O4JA 1SQBH 3C3SA 3JYCA 1Q82W 1HNWO 4P9PA 2XGTA 2QTSA 4UP7A 1N33B 4DRXB 1QLNA 3PZCA 3OGIB 5J2TB 2UUAO 2IU3A 2QJ1A 1Q81W 2Q5HA 1PYSB 1G51A 4I0XB 3BPZA 2N05A 2PY5A 2Q7EA 1R3LC 1M56C 4BIUA 4YCWA 5IDJA 3K5LA 1RPRA 2H8PC 3FX7A 1US6A 4X1IA 5BMVA 1AROP 1Q6HA 4UVCA 3K0DA 2DU7A 3FAVB 3SR2C 4H2SA 2L6LA 4W4LA 4HWOA 1M56B 5KNNA 1AILA 1B6QA 1UPGA 4H44B 4WBNA 3I7FA 2A3QA 3L9DA 5E1AC 1OCRB 1KMNA 4ZBMA 3SYCA 4B3MO 1ADYA 3HKDB 4EEQA 4OX9O 1I94O 4J7KA 5JWPA 4JV5B 4IT5A 3RKYA 1KB9F 2DE0X 3A5YA 3T1YB 1TVKB 1GK9A 3SYPA 2ARSA 2DQ3A 3P30A 4RDXA 3ICXA 4JPRA 1T5EA 2KB1A 1M90W 3BFMA 4X9QA 5C8YB 4K3AA 5BZBA 4I7ZB 1B7YA 1W59A 1EN6A 2YEVA 2HFEC 3JSNA 4YJ2B 2ODRC 2QGNA 2WSSG 4WI1A 4YXWG 4MS2A 4QE7A 3L72H 3ZRSA 4YIPA 1QCEA 5F5WA 3K57A 1SERA 3ASNC 4GX1A 4X62O 1JPXA 1M57C 4Q15A 5JH7B 5IT9N 4K0KB 4UVBA 5KUMA 2XAFA 4K8ZA 4YJ3A 2IU0A 4DV7B 5ELOA 2NNUA 3HR0A 1H4QA 3ZMSA 2ADPA 1BBUA 3ZHSA 4DW0A 1AVMA 2QHTA 1M57B 4JI6O 3SJQC 4P73C 1WLEA 4PA9A 2ZT9B 1E1TA 3I55V 3MAQA 2DOSA 1BCCH 3ZRXA 1EM1A 4J41A 4NXNO 1PNLA 4JTAB 4EFEA 3AG1C 4X65O 3JASB 1XI1A 3NETA 2P6JA 4IL6Z 5JCOC 4GX0A 3HFVA 2WLLA 3EFRA 1FXHA 1WNSA 3E22A 4P71C 1XMQB 2Z3YA 1VQKV 5ITZB 1M4UA 3AG1B 3CRCA 3IAYA 4LF5O 5CA1B 2CE4A 5JJEB 2ZR2A 2QHVA 4YP0A 3R65A 1NJ2A 2QTOA 2GUZB 1WPBA 1QVFU 4UCRA 2V7QG 3CCSV 4AQYO 2YDEA 1EFRG 1EN5A 4DUZB 4TT3G 1EIYB 3TEGA 3HPLC 5HGQA 4DR4B 1K5SA 3P3PA 1GN4A 2LFRA 5ELNA 2RMKB 3ZRWB 4JTCB 2DZ9A 5DM6V 1UJWB 4JI0B 4X1KB 2QWQB 4G28B 2ODMA 4X89A 1KQSU 3MHSC 5IYZA 1VMGA 2W0XA 4XU3A 3CX5F 1GRJA 2UXDB 2EIJB 1BMFG 4KR2A 2QHSA 5IYBO 2GTAA 1BGYH 2R9AA 3E8GA 2EJFA 4RMFA 4NTWA 1AR1B 4ZTZB 4O2AA 4K88A 4EB6B 5EZYB 1SZXA 2EBOA 3T1HB 2VQEB 2PYLA 1Q6IA 3Q4HA 3ZJZA 4YRCA 4DR1B 1EOVA 3S3WA 2PZSA 2Q5IA 3OM3B 3OR7C 5J2UA 5EBWC 2Q69A 3CPWU 3H1HH 4UCSA 4KHPO 1YHQV 1KMMA 4LWSA 5BR8O 2RN9A 4LF4O 3I5DA 1KKCA 3ZHTA 1WNLA 4ZHQB 4I4TB 3W7UA 1FJGO 3IKLA 5CBFA 1YDXA 2DTHA 3RYIB 2IY5B 3O9OA 1M5IA 1KOGA 3UFGA 3GWKC 3CSXA 1S0VA 4DV3B 2YUAA 1WPYA 4P2ZA 2NN4A 1SQFA 3K59A 4LCUC 4Z1MG 1NJ5A 3OT7A 4OP0A 4XTZA 4ZKIA 2ZXWC 4F6EA 2DYSB 1QR8A 1EVLA 1N33O 3ABMB 3WB1A 2GHYA 2C2AA 4YY3O 4I9QA 4AHCA 2B1IA 3D3IA 4UCUA 5IJ9A 1TUEB 2Y69C 2QM8A 4J11A 4O2BB 2G38A 1X59A 4PI2A 1IBMO 4P72A 5LXTB 1ZUQA 3ZN0A 2QWPB 2ZXWB 1E1OA 4PG3A 4YRKA 4MSWC 3UH0A 3PJSK 4PI0A 1ZSPA 3V7RA 3APQA 1P7BA 5LA6A 3ABTA 3JD1A 1M9NA 4YREA 1XNQB 4MVSA 3FD9A 2Y69B 4GYCB 3MDSA 3HXXA 1XUQA 1OCZB 1NI8A 2AXTZ 2ZT7A 4DUYB 4FFBB 3JATA 1N0JA 4LP8A 1YF2A 1TAEA 2YSUB 4P3NA 1SETA 3BA9A 1GM7A 2K1EA 4PV1B 4YRLA 2ITCC 3GB7C 2IJJA 4B3TO 3V8KA 2DYRC 2EIKC 3T1YO 2IBZH 1TGOA 1JFFA 1VIBA 1YFRA 1FFXB 1HWYA 2X7RB 3ICAA 4LC1A 1MSWD 2OWOA 1VQPV 4J15A 4FZ1A 4GZRB 3IC7A 4HAMA 3CEIA 2GSMB 2DYRB 5D5PA 2JGDB 4LNUA 2EIKB 2FKXA 1YFTA 3CRMA 2A0LA 1WPXA 3RUXA 1SRYA 2K9PA 1S76D 1B70A 3EHBB 4UCVA 4LF8O 1B76A 2ARHA 2UUBO 2J3LA 4I50A 3HB3B 4PA7A 5FNVB 2P06A 3H1LH 5GTIZ 4K0KO 4NB5A 1WJZA 4DV7O 1G4YB 3U10A 1FXKA 4WF9V 2XAJA 4YRJA 1XREA 5LMUO 2QKSA 1Y67A 1EZVH 12ASA 5BMVB 1RSOA 4J9YB 1QLEC 2JVDA 4JI4B 2UXCO 3HXUA 5B1OA 2EL9A 4CH3A 1ASYA 5LBQA 2AHYA 3OFNG 1RP3B 4U3JB 1YJ9V 1N9WA 3QG5A 4LBEC 2FYUH 2RNBA 1IBKB 1Y6XA 4X88A 4TV9B 1H2SB 4PELA 1AP6A 4K8XA 4DV0B 4XEOA 1SQPH 1IL2A 1GGMA 2DTIA 2DTOA 1K5QA 1SA0A 3ABLB 5CA3A 3B40A 3L70H 1EVKA 4TQDA 4DXWA 3D8CA 2XHBA 3RIRA 5B1BC 2EAYA 1XMQO 2G4CA 5KHIA 3H1JH 3HXWA 1P84F 2DVEA 2F43G 2M7WA 5DECA 4QNHB 4FMTA 1HR0O 3OD4A 2OCHA 2CAZC 3DXRB 4X64B 4FLTA 4LFCB 2XAGA 3MD0A 4FLXA 2P7TC 5L3BA 4DUZO 4LFBB 3CB2A 4FPPA 4YCVA 4DK1A 4DR4O 1WAZA 5F2VO 3RGBA 1JVMA 3HFZA 4YJ3B 5KAIZ 3RFRA 4BAYA 1NQTA 4JI0O 2OTLV 2LW1A 2Q9LA 3C90A 3U0ZA 4B3RB 3K06A 4NTYA 1XL4A 1KU9A 4NXMO 1BHBA 1X2GA 1ASZA 5C53B 4LFAO 2UXDO 4XU0A 1ZLZA 2DMXA 3R66A 3HXVA 4GKKO 5HFMA 4YRFA 1N4CA 2A8EA 3LC0A 3E35A 2JJ2G 3JALB 2UU9O 1NJ6A 4H2YA 3FYIB 1TA8A 2QHUA 3T1HO 2VQEO 2ZNIA 1X56A 4N21A 3TK1A 2QWNB 4DV4O 3CCRV 1ZX3A 4DR1O 3JCZA 2Q7HA 1IXBA 2HJDA 4JI1B 1UFIA 5GONA 3WFVA 3JAMN 1PM9A 3L1AA 3L75H 1AB3A 2AKWB 3OTOB 5LP6C 2N74A 4O4IB 3F7YC 3P3NA 3JD0A 1K33A 4X20A 2QKCA 4PA6A 1SZTA 4IHJB 2OYQA 4X66B 3A7UA 3FB8C 1VF6A 2AGAA 3RYCB 3TCUA 4H2VA 5KHKA 5H5NA 4XU1A 4F6RA 1ZTEA 4XDKA 2KG7A 2ZE8A 1QF6A 1CXZB 3NR7A 4B3SB 3CC2V 2W6JG 1RPOA 2LP7A 5LGTA 4HWPA 4DV3O 2P22C 3S3XA 3F7VC 2F93B 4FVMA 1W0KG 2DW4A 2JEXA 4JTDB 4DK0A 1FS0G 5IYZB 5CN0A 5JJJB 4XTYA 3TEHA 3PCOA 3BCCH 1JCHA 4Q20A 2QA4V 3HRIA 2XTAA 4FM0A 1K92A 4PA4A 3G6BA 2WLIA 3ML0A 1F51A 3N2GA 4IIJB 3L4GB 2LW7A 3REUA 3DSQA 1OCOC 4JAAA 3UCSC 2HHHB 1XILA 3A7RA 3TXSA 4TVAB 4LF6O 5EIBD 1AI5A 5LGNA 2E64A 1XMOB 3Q4HB 4DR2B 5IJ0A 1HXDA 1XNRB 1Q3EA 1Y66A 1H4VB 4DR3B 1N8RW 4DR7O 3N2KA 4KL1A 1FYFA 4LH7A 1K34A 1IXMA 2LQTA 1Y74B 3RYHA 3E2EA 1Z7MA 1XNQO 3FFQA 2CJ9A 4LVKA 4WFEA 2F66C 1NU1H 1JR9A 3HY1A 1EZJA 1BIAA 4DUYO 2MK3A 1M93A 3UT5B 2H94A 4BR6A 3VQVA 4R8CA 5LHIA 1OCRC 4LWSB 1XHXA 1GKFA 4YHHB 1N34B 1MMMA 4MT8A 4BW5A 1GN6A 3E83A 3HXYA 2OT5A 3SJCC 3UO2A 1X54A 2ZZEA 4OGQB 3A74A 2ZDIA 2UXBB 1Z7NA 4UB6Z 3T1CA 4NCXA 2CTWA 2UUCB 4I9WA 2A79B 4ZOLB 4G2KA 5JVDA 2NS6A 3W7XA 4HWRA 2PI5A 1AR5A 2OCCC 1ADJA 1L0NH 2WLMA 2JS5A 4EKWA 3OUFA 5EK0A 2ZCEA 1QNMA 3B2EE 1WYDA 1Y76A 4HYOA 2QKAA 2CUGA 2VRZA 4OPAA 3JSLA 2OCCB 4ICGA 2AMCB 5IJ9B 1JQ0A 2ZZGA 3LSUA 3CCLV 2FTKA 3EVKA 1K4DC 4H0LB 5JJNB 5EBLC 3ZHUA 1PL0A 5B66Z 3AG3B 4FLYA 3ZHQA 4TV8A 4DV1B 3RACA 1V54C 1WB8A 4YRRA 3JARA 1JJCA 2EIMC 1VP7A 1IBKO 2WLJA 4BIZA 3MF2A 4E51A 1R73A 2ETNA 2YXHA 3JATB 1KECA 3M4QA 4PA3A 1V55C 4TUYA 3RYFA 1V54B 3JAKA 2GV9A 2EIMB 2AZ0A 2FYKA 4PDMA 4YPFA 3RKWA 2ADQB 3QO7A 3ETEA 2BTOA 4U7NA 4UV9A 3KKYA 2PMFA 4H02A 5L3FA 3AG2C 4FM1A 1V55B 4MW8A 3IG2A 1USYC 2Z5UA 4RUEA 1EFWA 2PUSA 4JZGA 3BAAA 5D5QA 3OEEG 3EFSA 1H8HG 3VQWA 4YRTA 2CDYA 1GAXA 1G5IA 2DDZA 1B70B 3AG2B 2EJ9A 3E8FA 1BL8A 4EX5A 4R50A 1YGBA 4NR1A 4I50B 2JRIA 2EZOA 5B1AC 1Q86W 1D5AA 3P8YA 3D36C 4UB8Z 2ZE6A 4NYKA 1NH2D 1NR1A 3BEHA 3HKBA 1QHTA 1VQ4V 4YIOA 4D7TA 4YRIA 4DV5O 3U11A 2UXXA 1FXKB 3OUSA 4B3RO 2XASA 1Q5OA 3SDLA 3CXHF 1QR9A 3K03A 5LYJA 2ZM6B 4YCUA 3B4SA 5B1AB 1HTTA 1PV0A 1VF5B 3SYQA 5GTHZ 5BY1A 3X2QC 5BXZA 4ZTUB 5JQGA 1I08A 4TVYA 1HC7A 2QWRB 2EIJC 4J80A 1JJ2U 2Y48A 1NYQA 2AHZA 4PDRA 3A2FA 5CA0A 1YJWV 1IBLO 3UM7A 1BE3H 2VQFB 3MEYA 5KMGA 1COWG 2GTSA 3X2QB 2RHSA 5LP6A 1XDCA 3LDEA 1YTFB 4DV2B 1AP5A 2ZE5A 1PNKA 4JI1O 5EYPB 3LDDA 1E22A 3CRAA 1J5EO 1CEZA 4OPHA 3OE7G 2J3MA 1D5NA 5LHGA 2ZXFA 1ORQC 1ZL8A 1VARA 4JYCA 2IW5A 3HKEA 3A5ZA 2ZNJA 3ZBHA 4LR3A 3T4ZA 2Q8VA 3UGTA 4J7JA 4JYAB 1PD3A 2IJIA 3LDCA 2F95B 4CC5A 2ALYB 4B3SO 4O4HA 2WWWA 1VQZA 4D7SA 4PHZA 3HFZB 1ZAUA 4DV6O 3HKCB 3UGQA 3D3QA 1R3KC 4WFBV 3CCUV 2JEUA 4JF3A 4DRXA 4DR6B 4P75A 1HNZB 2H3OA 3I56V 1PYSA 4GKJO 4I0XA 4Q6GA 4JI2B 2HHHO 4GT1A 1FXVA 2DYSC 3ABMC 2P5OA 3V7CA 4PDVA 3AK3A 1XMOO 1X55A 1Q6UA 2BTQA 3RBZA 4Z1VA 4DR2O 4XEMA 3WQZA 3ZHVA 1XNRO 4DR3O 4FZ0A 2I4OA 4JI3B 2ODRD 1CP9A 2QM4A 3AK1A 4TQFA 2HG5C 3HKDA 4HT4A 1L1FA 1WA8A 1OZ0A 3A31A 2YXYA 3B8MA 4FJCC 5DN6G 4I5SA 1H2MA 3H1KH 3K08A 4I55A 5C52B 1OCZC 5B5EZ 1S72V 5CB4B 1TVKA 4YHHO 1N34O 2X6AA 2E76B 2AW9A 2E1HA 1AJQA 2M6YA 2IJKA 4F6RB 3AG7A 3KG2A 1MZEA 4JI8B 1ZWIC 2UXBO 4XTUA 3OGCC 1WU7A 1K97A 3G4SV 4YJ2A 2BSKB 3K5MA 3J80N 1YXBA 1VQ9V 4HNAA 2V4DA 4E4EA 1ROPA 3KFUA 4JV5O 4LF7B 4P3OA 3TEHB 1SQQH 4MTGA 1HNWB 2Q73A 2WLNA 1EN4A 2WLIB 4J9ZB 5JH7A 2HJFC 3N2GB 4ABMA 2CGOA 1R6TA 2ATKC 2EJGA 2RDCA 2YIBD 2Q7GA 3WB2A 2B1GA 1KD1W 4XDLA 2EJRA 4XBFA 3UKMA 1W2BU 2Y0IA 1LR1A 1BQ0A 4MTXA 1IURA 5E79Z 4AI8A 4CH6A 4O4JB 3BVOA 1NT2B 1H2GA 4DV1O 2ZT6A 1IDSA 2IH1C 3RYHB 1ATIA 3P8VA 1OHHG 4YRGA 2DWEC 4B3MB 4TWAA 4OX9B 1F7YA 4P73A 1H2LA 4P3PA 4X5OA 1R6KA 2EJ7A 3MHHC 1WP8A 3OW2U 2RHQA 4WJ3M 2JGUA 1AI4A 4JYYA 1MNGA 2YIAA 4X1IB 4ASUG 1LUVA 1U96A 1GM9A 1USYA 2NLJC 2CJAA 11ASA 3TJTA 2I4MA 4DPGA 3ABLC 3JAWA 2JK5C 1MABG 4WBNB 5JCOA 4TSFG 3VQYA 2YIBA 2GUZA 1F4MA 1GMGA 3W7SA 2XTIA 1YIJV 5JVDB 4RWUA 3IGAC 4P71A 4DQ2A 1G8MA 1NTKH 5H2FZ 2E65A 1QE0A 5CBHA 1I7FA 1SQGA 3KCXA 2CGHA 5DEDA 5LMNB 1EIYA 3BABA 2XUMA 1XEQA 3SYOA 4XTWA 1R3JC 1Y76B 1NTMH 4RO2A 3ZRWA 5EBMC 5KAFZ 1J95A 2D3OW 2DXUA 2YC0A 1KP2A 3K04A 2HR3A 4ZIBA 3CC7V 4JASA 2QWOB 3FB6C 1B7YB 5CMUA 2YEVB 1XHZA 3QO8A 4JI6B 3K3WA 4FM2A 2E41A 2ZM6O 4RAIA 4JI5B 5LHHA 2A9HA 3ZS8C 3MF1A 1B8AA 2DWDC 3K79A 2JDIG 3NEMA 3JARB 1JJCB 2DJVA 2N04A 4LF9B 2DU5A 1Z5WA 1YEWA 3C3TA 3IC9A 1NBMG 3CJHA 2PMEA 5LOVA 1HP8A 2PTMA 3CMQA 2E10A 4H37A 3HXZA 1P4RA 3CC4V 3RKXA 2E5LB 4LF5B 5L3EA 1NJ8A 2KKWA 1E1RG 3HTZA 3ETQA 3CRQA 1VQLV 3R07A 1THZA 1O9GA 4AILC 5IY5C 2P4KA 1GO3F 2WLHA 4RQFA 4CH4A 2ITDC 1JA8A 4P30A 1HNXB 3M7MX 1QQCA 4ZHQA 4I4TA 2NR5A 4MTOA 3PN1A 3OEHG 4UP9A 2WLLB 3RYIA 4JYAO 5J9PC 5IY5B 5A2QN 3QNEA 3E22B 2CTQA 1HDJA 4WJ4A 3E86A 3OAAG 2R9IA 1BIBA 1FKAO 4GUNA 1YI2V 2Q4PA 2CIMA 1LYLA 3FB7C 3HRKA 4FK5C 4IYIA 4DO2A 4CS2A 4QIWF 2Q68A 3A0BZ 4LH6A 1H4TA 4YYEA 2ZZFA 2Y4UA 2ZD9A 4ZI7A 5GW7A 2JJ1G 4WFHA 2XAQA 3SPHA 3A8TA 1HNZO 4BWAA 1WP7A 3K58A 4WFAV 3V8JA 5KHGA 2V1DA 1OJHA 3H9VA 2ZT8A 3B77A 1N0NA 4O2BA 2A06H 1P7GA 1M1KW 3J81N 2DKGA 5C93A 1R3IC 5IWAB 1NVPD 3M8AA 2Q5ZA 4KP4A 4MVMA 2XOKG 2RHSB 2C8MA 2W6IG 2YI8A 3CCMV 4QPKA 3CP1A 4MVRA 1VQ6V 4UP8A 2OIGA 3MQZA 1K7DA 4O2AB 1B06A 4UXNA 1J5WA 3WG7C 1Q7YW 1N36B 1LNQA 1YITV 1BHAA 1OCCC 1FJGB 1WQWA 3ZN1A 2ZIOA 2ZT5A 2P67A 4C7UA 4H2XA 1L0WA 4G85A 3APOA 4PD4F 4MVZA 4XTXA 2X6BA 2QEXV 3RVZA 3THOA 1WN7A 2Y0PA 5J2UB 2F4VB 3WG7B 1SESA 4NVPA 2JGDA 2DXTA 3JD2A 4LVLA 1OCCB 1G6UA 4J7ZA 3ZMTA 2BOBC 2DEQA 3EXAA 3HY0A 3NELA 1SC5B 2P4VA 2ZE7A 4HZ3A 4KXRA 5FPOA 4LF7O 3LNMB 3DTUB 3W7WA 4PJ0Z 4H13B 1E79G 3B8NA 2YXLA 4HA8A 3SPIA 1WQ7A 3G71V 1BQZA 4YY3B 1GTOA 3OMAB 3QVNA 1H38A 4QGPA 5FNVA 3J7AU 3DC6A 1PPJH 4W4KA 4B08A 1GH6A 4IGGA 3TETA 3K5NA 3CRRA 1RFYA 1K73W 1KBHA 1IBMB 4DR5B 4OXSA 3REXA 1EQRA 5K1XA 2P5IA 2BTQB 3AK2A 4P72C 4TOIA 4U3JA 4YRMA 3B09A 1U97A 1DGSA 4DYLA 5IE9A 2C7IA 3W7TA 4R6ZA 4TV9A 3AG3C 5KHJA 4HVCA 1N32B 1O9HA 4QJFB 1WA8B 4FLUA 2EINC 2VS0A 1Y4MA 4B3TB 3EFFK 4I55B 1KYOF 1FPOA 4P74C 1NJIW 4JI4O 4O4LA 2MW2B 5LA6B 1JJOA 3G67A 1K8AW 2EINB 4U3FH 4CZZA 4WF2A 3GVMA 3E8HA 2Y4TA 3CCVV 1URFA 3VQXA 4G27B 3L73H 3WU2Z 2WLKA 1XL6A 3L2ZA 4UPAA 4JAVA 4DV0O 1BBWA 4P9OA 4B7EA 4HNAB 1NYRA 3DXRA 3K0GA 1HW7A 1RM1C 2PI4A 4LF8B 4X1YA 2ZKOA 1VQNV 5LMNO 2L35A 2UUBB 4CC6A 1JFFB 1SF9A 2LGWA 4K86A 1AI6A 1TUBA 2A7WA 3L71H 1MG1A 3E9IA 3G6EV 3T2MA 1RM1B 3F5TA 2XNDG 3WB0A 5LMUB 1NZ6A 2WA4A 4LNUB 3CCQV 3ASNB 4AH6A 1I5YA 1R1BA 2QDOA 1LUWA 2GBOA 2UXCB 4GX5A 5KX5A 4LVIA 3N27A 4X64O 2HVKC 4LFCO 4XU2A 1FXKC 2O57A 4HBNA 1G5HA 4JI5O 3JALA 4LFBO 4KFMA 1BZKA 3O65A 4LVMA 4LF9O 4YROA 3M4PA 2ILMA 2YICA 1KKDA 2E74B 1SQVH 4EFBA 2RHQB 4LVJA 4KR3A 4A5UB 4YRPA 1GM8A 1RSOB 1I5XA 1MZFA 2AKWA 2RCVA 2E5LO 4H33A 3V8LA 1XQ8A 3JAWB 4O4IA 3CS5A 1F23A 3CHXA 1NNHA 1HR0B 3KZIZ 1H2KA 4IHJA 1HNXO 1H2NA 3RYCA 2P90A 1SA0B 2GDSA 1AJNA 4KUMA 2YIDA 3IKMB 3IFXA 5IYDO 1VQOV 3A0RA 4JGSA 1NR7A 2PF4E 2CTPA 4H2TA 3A7AA 4JYBA 3OTOO 3BA8A 3UQ8A 3OMNB 3V7SA 1GN3A 2HLDG 4NXMB 5L3CA 3RN4A 4LFAB 2LGQA 4X66O 4IIJA 3L4GA 4PHCA 4JI7B 4GKKB 1FYJA 5TISZ 1QU7A 2F1MA 2DQ0A 3FYEB 2UU9B 2LJ2A 1FD9A
chains in the Genus database with same CATH topology
4TVAA 2AKWB 4B3MB 4TWAA 4OX9B 5C8YB 3OTOB 1B7YA 5LP6C 2VWJA 4P73A 4O4IB 4P3PA 4X5OA 3JSNA 4YJ2B 2ODRC 4DV4B 2RHQA 4WJ3M 4X20A 2JGUA 2ARUA 4WI1A 2YIAA 3A7UA 4IHJB 5LOVB 2OYQA 4BW9A 4X66B 4KQEA 4X1IB 3RYCB 4H2VA 5F5WA 5KHKA 3K57A 1USYA 1SERA 5J2TA 4XU1A 4F6RA 2CJAA 11ASA 1QF6A 2I4MA 4DPGA 4Q15A 3BRCA 5JH7B 3JAWA 4B3SB 3IALA 1H4SA 4K0KB 4WBNB 5JCOA 3VQYA 2YIBA 4K8ZA 4YJ3A 4DV7B 5ELOA 3UT5A 1B04A 4HWPA 1H4QA 2XTIA 2P22C 3LNNA 5FPRA 2RJZA 5JVDB 2F93B 3E9HA 4FVMA 1BBUA 5IYZB 5JJJB 4DK0A 4P71A 4TTVA 4XTYA 2E65A 3TEHA 4DQ2A 3PCOA 3OTFA 2ARTA 1QE0A 2QHTA 3HRIA 4FM0A 1I7FA 1SQGA 4P73C 1WLEA 2CGHA 5LMNB 1EIYA 3BABA 2PGGA 3N2GA 4IIJB 3L4GB 4XTWA 1E1TA 3REUA 3MAQA 3DSQA 5K1PA 5GONB 2HHHB 1P49A 4ZOLA 2DXUA 3A7RA 4TVAB 4ZIBA 5EIBD 3NENA 1B7YB 4EFEA 2YI9A 2E64A 1XMOB 1XHZA 3JASB 3QO8A 4DR2B 1XI1A 3NETA 4JI6B 5JCOC 5IJ0A 4X20B 4FM2A 1Q3EA 1XNRB 1HXDA 1H4VB 4DR3B 2E41A 3EFRA 3N2KA 4KL1A 1FYFA 4LH7A 3HFVA 4L87A 4ZI7B 1WNSA 1L8DA 3E22A 3RYHA 4JI5B 1Z7MA 3FFQA 2CJ9A 4P71C 4LVKA 3ZS8C 3MF1A 1XMQB 1B8AA 5ITZB 1M4UA 3RWRD 2F66C 3IAYA 2AMCA 2HNIA 5C8YA 3JARB 1JJCB 5CA1B 4LF6B 5JJEB 3NEMA 3HY1A 4CS4A 2QHVA 2ZR2A 1BIAA 4YP0A 1NJ2A 4LF9B 2DU5A 1Z5WA 1YEWA 1M93A 3BJUA 2P0LA 1WPBA 3UT5B 4UCRA 3VQVA 2PMEA 5LOVA 4DR7B 1XHXA 4YHHB 1N34B 1JMKC 3PCOB 2PTMA 3CMQA 2E10A 3HXYA 3SJCC 3HXZA 1X54A 4DUZB 1X01A 3RL6A 2ZZEA 1EIYB 2UUAB 3A74A 3RKXA 2E5LB 4LF5B 4XTVA 3TEGA 1X4TA 1NJ8A 5HGQA 4DR4B 2KKWA 4CH5A 2UXBB 1Z7NA 5ELNA 3HTZA 3ETQA 4NCXA 3R07A 2UUCB 4ZOLB 2DZ9A 4P74A 1O9GA 4AILC 4JI0B 4X1KB 3FJPA 5JVDA 2HEPA 2NS6A 1NJ1A 4HWRA 4RQFA 5IYZA 4CH4A 1ADJA 2JS5A 1HNXB 2ZR3A 4XU3A 3M7MX 1QQCA 4ZHQA 4I4TA 2ZCEA 2RQ6A 3B2EE 3PN1A 2UXDB 5IJ0B 4UP9A 1WYDA 3N2KB 3RYIA 4KR2A 3RF1A 2R70A 2QHSA 3QNEA 3E22B 4H2XB 3JSLA 2R9AA 3BHPA 2EJFA 4RMFA 4WJ4A 4ZTZB 2AMCB 4O2AA 4K88A 4EB6B 5EZYB 1BIBA 5IJ9B 2ZZGA 1I94B 3T1HB 2VQEB 2PYLA 2CIMA 1LYLA 1KMIZ 3JASA 3HRKA 3TUPA 4CS2A 5JJNB 1H4TA 4LH6A 4YRCA 4YYEA 4DR1B 1EOVA 2ZZFA 4ZI7A 4FLYA 2PZSA 2Q5IA 5EIBC 4TV8A 4DV1B 3RACA 4BWAA 3K58A 3V8JA 5ITZA 5KHGA 5J2UA 4YRRA 4H2UA 3JARA 1JJCA 5CA1A 2ZT8A 4OLFA 3OD1A 3MF2A 4O2BA 4E51A 3JATB 4UCSA 1KMMA 2DKGA 4UFZA 3M4QA 4TUYA 3RYFA 1C0AA 5IWAB 3JAKA 1WNLA 2GV9A 4ZHQB 4I4TB 2RHSB 2C8MA 2FYKA 4FLWA 3IKLA 2YI8A 2ZTGA 4YPFA 3RKWA 2DTHA 3QO7A 4X62B 3RYIB 2IY5B 2BTOA 4UCOA 2PMFA 4H02A 1M5IA 3LSSA 1KOGA 3UFGA 4FM1A 2Q0AA 3CSXA 4X1KA 4UP8A 3MQZA 4DV3B 4O2AB 3IG2A 1USYC 1J5WA 1WPYA 4K87A 2VWKA 3K59A 1SQFA 1EFWA 2PUSA 4HWSA 1N36B 4FLZA 1NJ5A 1X2HA 3BAAA 5D5QA 4OP0A 1FJGB 3EFSA 3VQWA 4YRTA 1WQWA 4XTZA 1YB3A 1G5IA 3QTCA 2ZIOA 2DDZA 2ZT5A 1B70B 2EJ9A 1EVLA 5EYPA 4H2XA 1L0WA 3WB1A 4EX5A 4O4LB 4TV8B 4G85A 4I9QA 1YGBA 4AHCA 4I50B 4XTXA 3QO5A 3THOA 1WN7A 5J2UB 1S5JA 2F4VB 4EB6A 4UCUA 5EZYA 1D5AA 5IJ9A 1SESA 3P8YA 4NVPA 2DXTA 1RIQA 5C51B 3HKBA 4NXNB 4LVLA 3BFMA 1QHTA 4RQEA 4O2BB 2I4LA 4PI2A 4D7TA 4P72A 1G6UA 3U11A 5LXTB 4X65B 4YRIA 1E1OA 2DEQA 4PG3A 4YRKA 3HY0A 1Q5OA 3NELA 5FPOA 1Q8IA 3UH0A 5LYJA 4PI0A 4TUYB 2ZM6B 4YCUA 3RYFB 2YXLA 3V7RA 3JAKB 3W3SA 4HA8A 1WQ7A 4X1YB 5LA6A 1HTTA 2EX3A 1V9PA 4YREA 1XNQB 4YY3B 4YRSA 4GYCB 2ALYA 5FNVA 4ZTUB 1Q43A 3HXXA 5JQGA 4TVYA 1TUBB 1HC7A 2ZT7A 4B08A 3K5NA 3SGIA 4DUYB 4FFBB 3JATA 1IBMB 4DV5B 4DR5B 1TAEA 3HKCA 4P3NA 3BA9A 1SETA 3REXA 4FLVA 1NYQA 1EQRA 3A2FA 5CA0A 5K1XA 2P5IA 4YRLA 3QF7A 2VQFB 3MEYA 4AQYB 2BTQB 5KMGA 3V8KA 1VF7A 2RHSA 5LP6A 1TGOA 1JFFA 5KX5B 1YFRA 3ICAA 1FFXB 4P72C 4TOIA 4U3JA 4DV2B 2CJBA 4YRMA 2IY5A 2E3CA 1DGSA 2OWOA 2R72A 2C7IA 1W66A 5EYPB 3A32A 4J15A 2PYJA 4TV9A 1E22A 5KHJA 4HVCA 1N32B 1O9HA 2J3MA 2ZXFA 4FLUA 3ERRA 4LNUA 5D5PA 2DJZA 3HKBB 4CS3A 2I4NA 4GLXA 1IBLB 1YFTA 3HKEA 4B3TB 4I55B 3A5ZA 2ZNJA 3ZEDA 4LR3A 3RUXA 1SRYA 4P74C 1B70A 5LYJB 3UGTA 4UCVA 4JYAB 1B76A 4O4LA 5LA6B 1JJOA 2J3LA 4I50A 1J5EB 5KHHA 2F95B 4CC5A 3LSQA 2ALYB 4WF2A 5FNVB 1E24A 2ZGWA 4O4HA 5JQGB 1VQZA 4YRNA 4D7SA 4PHZA 3VQXA 5LXTA 3HFZB 4UPAA 3L2ZA 1ZAUA 3U10A 4EO4A 1BBWA 3HKCB 5CB4A 3UGQA 2IM9A 4HNAB 4YRJA 1NYRA 2E5AA 1HW7A 5CA0B 4H2WA 4YDQA 12ASA 5BMVB 1RSOA 5KMGB 4LF8B 4DRXA 2JVDA 3K5OA 4X1YA 3SJBC 4JI4B 2EL9A 3HXUA 4LNSA 1SKVA 4P75A 1HNZB 4CH3A 5LP6B 2UUBB 1ASYA 4CC6A 1JFFB 3P8TA 1PYSA 4U3JB 1N9WA 4K86A 3QG5A 4Q6GA 1TUBA 1Z5VA 4JI2B 1IBKB 3VBBA 4FFBA 4TV9B 3E9IA 1H2SB 4DV6B 4K8XA 3WB0A 4DV0B 4KHPB 4XEOA 4UCTA 2P5OA 5LMUB 4G84A 3V7CA 4LNUB 5E3IA 5BR8B 4AH6A 1X55A 1IL2A 2BTQA 1GGMA 2DTIA 4L8JA 4LF4B 4XEMA 3HKEB 2DTOA 1SA0A 3WQZA 2UXCB 4YRQA 5KX5A 3SJAC 4LVIA 1FFXA 1EVKA 4TQDA 2ZIMA 2I4OA 4JI3B 4XU2A 2ODRD 4HBNA 2XHBA 4GKJB 1YFSA 1G5HA 3RIRA 3JALA 2QM4A 2ZINA 2EAYA 2G4CA 2DZCA 5KHIA 4TQFA 2EWNA 4HWTA 3HKDA 4HT4A 3HXWA 4LVMA 3A31A 2DVEA 4P75C 4O4HB 4YROA 3M4PA 4I55A 5C52B 4O2DA 2RHQB 4EFBA 4TVWA 3RGLA 4LVJA 4KR3A 3G1ZA 4O4JA 5CB4B 1TVKA 4YRPA 2CAZC 4X64B 4FLTA 4LFCB 2XGTA 2E1HA 4UP7A 4FLXA 1N33B 4DRXB 3PZCA 5J2TB 4F6RB 4LFBB 3CB2A 2AKWA 2QJ1A 4YCVA 3V8LA 2Q5HA 4DK1A 1XQ8A 1PYSB 3JAWB 4JI8B 1G51A 4XTUA 4O4IA 1WU7A 3RGBA 3BPZA 2PY5A 2Q7EA 3CHXA 4YJ2A 1NNHA 4YJ3B 3RFRA 3HFZA 4YCWA 1HR0B 3K5MA 3U0ZA 3K5LA 4HNAA 2V4DA 4B3RB 1KU9A 4IHJA 3KFUA 4LF7B 4P3OA 3TEHB 4X1IA 5BMVA 3RYCA 1HNWB 1X2GA 1ASZA 5C53B 2DU7A 1SA0B 4XU0A 3HXVA 3SR2C 4H2SA 3IKMB 5JH7A 4HWOA 3N2GB 5KNNA 4YRFA 4WBNA 2A8EA 2EJGA 3I7FA 3LC0A 3JALB 2YIBD 2Q7GA 3WB2A 1KMNA 1NJ6A 4H2TA 3A7AA 1ADYA 4H2YA 3HKDB 4EEQA 3BA8A 1TA8A 3UQ8A 2QHUA 3V7SA 2ZNIA 4JV5B 1X56A 4NXMB 3RKYA 3A5YA 4LFAB 3T1YB 4CH6A 4O4JB 1TVKB 2Q7HA 4IIJA 3L4GA 4PHCA 2ARSA 4JI7B 1NT2B 4GKKB 2DQ3A 4JI1B 4RDXA 3ICXA 5GONA 2ZT6A 1T5EA 3RYHB 1ATIA 3L1AA 3P8VA 2F1MA 2UU9B 2DQ0A 4YRGA 4DR6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TVA A;  2AKW B;  4TWA A;  1B7Y A;  4P73 A;  4X5O A;  4P3P A;  2ODR C;  2RHQ A;  4WJ3 M;  2ARU A;  4WI1 A;  2YIA A;  3A7U A;  4BW9 A;  4KQE A;  4H2V A;  5F5W A;  1USY A;  1SER A;  4XU1 A;  2CJA A;  11AS A;  1QF6 A;  2I4M A;  4DPG A;  4Q15 A;  3IAL A;  1H4S A;  3VQY A;  2YIB A;  5ELO A;  4HWP A;  1H4Q A;  2XTI A;  2RJZ A;  3E9H A;  1BBU A;  4TTV A;  4XTY A;  4DQ2 A;  4P71 A;  3TEH A;  2E65 A;  3PCO A;  2ART A;  1QE0 A;  2QHT A;  3HRI A;  4P73 C;  1WLE A;  2CGH A;  1EIY A;  2PGG A;  3L4G B;  4XTW A;  1E1T A;  3REU A;  3DSQ A;  5K1P A;  2DXU A;  3A7R A;  4TVA B;  4ZIB A;  3NEN A;  1B7Y B;  2YI9 A;  2E64 A;  3QO8 A;  3NET A;  1HXD A;  4YRS A;  2E41 A;  1H4V B;  3HFV A;  3EFR A;  1FYF A;  4L87 A;  1Z7M A;  2CJ9 A;  4P71 C;  3MF1 A;  1B8A A;  2AMC A;  2HNI A;  3NEM A;  1JJC B;  3HY1 A;  4CS4 A;  2QHV A;  2ZR2 A;  1BIA A;  4YP0 A;  1NJ2 A;  2DU5 A;  3BJU A;  2P0L A;  3VQV A;  2PME A;  3PCO B;  3CMQ A;  2E10 A;  3HXY A;  3HXZ A;  1X54 A;  1X01 A;  3RL6 A;  2ZZE A;  1EIY B;  3A74 A;  3RKX A;  4XTV A;  3TEG A;  1NJ8 A;  5HGQ A;  4CH5 A;  5ELN A;  1Z7N A;  3HTZ A;  4NCX A;  3R07 A;  2DZ9 A;  4P74 A;  1O9G A;  3FJP A;  2HEP A;  1NJ1 A;  4HWR A;  4RQF A;  4CH4 A;  1ADJ A;  2ZR3 A;  4XU3 A;  2ZCE A;  2RQ6 A;  4UP9 A;  1WYD A;  4KR2 A;  3RF1 A;  2R70 A;  2QHS A;  3QNE A;  4H2X B;  3BHP A;  2EJF A;  4RMF A;  4WJ4 A;  4ZTZ B;  2AMC B;  4K88 A;  1BIB A;  2ZZG A;  2CIM A;  1LYL A;  3HRK A;  3TUP A;  4CS2 A;  1H4T A;  4YRC A;  4YYE A;  1EOV A;  2ZZF A;  2Q5I A;  3RAC A;  4BWA A;  3V8J A;  4YRR A;  4H2U A;  1JJC A;  2ZT8 A;  4OLF A;  3OD1 A;  3MF2 A;  4E51 A;  1KMM A;  2DKG A;  3M4Q A;  1C0A A;  1WNL A;  2RHS B;  2C8M A;  2FYK A;  3IKL A;  2YI8 A;  2ZTG A;  4YPF A;  3RKW A;  2DTH A;  3QO7 A;  2IY5 B;  2PMF A;  4H02 A;  3LSS A;  1KOG A;  3UFG A;  4UP8 A;  3IG2 A;  1USY C;  1J5W A;  1WPY A;  4K87 A;  1EFW A;  2PUS A;  4HWS A;  1NJ5 A;  1X2H A;  4OP0 A;  3EFS A;  3VQW A;  4YRT A;  1WQW A;  4XTZ A;  1YB3 A;  1G5I A;  3QTC A;  2ZIO A;  2DDZ A;  2ZT5 A;  1B70 B;  2EJ9 A;  1EVL A;  4H2X A;  1L0W A;  4EX5 A;  4G85 A;  1YGB A;  4XTX A;  3QO5 A;  3P8Y A;  1SES A;  2DXT A;  1RIQ A;  5C51 B;  4RQE A;  2I4L A;  4YRI A;  4P72 A;  1G6U A;  1E1O A;  2DEQ A;  4PG3 A;  4YRK A;  3HY0 A;  3NEL A;  3UH0 A;  4YCU A;  3V7R A;  3W3S A;  4HA8 A;  1WQ7 A;  1HTT A;  4YRE A;  2ALY A;  4ZTU B;  3HXX A;  4TVY A;  1HC7 A;  2ZT7 A;  4P3N A;  1SET A;  3REX A;  1NYQ A;  1EQR A;  4YRL A;  5K1X A;  2P5I A;  3MEY A;  3V8K A;  2RHS A;  1YFR A;  3ICA A;  4P72 C;  2CJB A;  4YRM A;  2IY5 A;  2E3C A;  2R72 A;  2C7I A;  1W66 A;  3A32 A;  4J15 A;  1E22 A;  4HVC A;  1O9H A;  2J3M A;  2ZXF A;  3ERR A;  2DJZ A;  4CS3 A;  2I4N A;  1YFT A;  3A5Z A;  2ZNJ A;  3ZED A;  3RUX A;  1SRY A;  4P74 C;  1B70 A;  3UGT A;  1B76 A;  2J3L A;  3LSQ A;  2ALY B;  4WF2 A;  1E24 A;  2ZGW A;  1VQZ A;  4YRN A;  3VQX A;  3HFZ B;  4UPA A;  3L2Z A;  4EO4 A;  1BBW A;  3UGQ A;  4YRJ A;  1NYR A;  2E5A A;  4H2W A;  4YDQ A;  12AS A;  2JVD A;  4LNS A;  3HXU A;  2EL9 A;  4P75 A;  4CH3 A;  1ASY A;  3P8T A;  1PYS A;  1N9W A;  4K86 A;  4Q6G A;  3VBB A;  3E9I A;  4XEO A;  4G84 A;  3V7C A;  5E3I A;  4AH6 A;  1X55 A;  1IL2 A;  1GGM A;  2DTI A;  4XEM A;  2DTO A;  3WQZ A;  4YRQ A;  1EVK A;  4TQD A;  2ZIM A;  2I4O A;  4XU2 A;  2ODR D;  1YFS A;  1G5H A;  3RIR A;  2ZIN A;  2EAY A;  2G4C A;  2DZC A;  2EWN A;  4TQF A;  4HWT A;  3HXW A;  3A31 A;  2DVE A;  4P75 C;  4YRO A;  3M4P A;  5C52 B;  4O2D A;  2RHQ B;  4TVW A;  3RGL A;  4KR3 A;  3G1Z A;  4YRP A;  2XGT A;  2E1H A;  4UP7 A;  3PZC A;  2AKW A;  2QJ1 A;  4YCV A;  3V8L A;  2Q5H A;  1PYS B;  1G51 A;  4XTU A;  1WU7 A;  2Q7E A;  1NNH A;  3HFZ A;  4YCW A;  3KFU A;  4P3O A;  3TEH B;  1X2G A;  1ASZ A;  5C53 B;  2DU7 A;  4XU0 A;  3HXV A;  4H2S A;  3IKM B;  4HWO A;  5KNN A;  4YRF A;  3LC0 A;  2EJG A;  3I7F A;  2YIB D;  2Q7G A;  1KMN A;  1NJ6 A;  4H2T A;  3A7A A;  1ADY A;  4H2Y A;  2QHU A;  3V7S A;  2ZNI A;  1X56 A;  3RKY A;  3A5Y A;  4CH6 A;  2Q7H A;  3L4G A;  4PHC A;  2ARS A;  2DQ3 A;  4RDX A;  2ZT6 A;  1ATI A;  3L1A A;  3P8V A;  2DQ0 A;  4YRG A;  3BFM A; 
#chains in the Genus database with same CATH topology
 4TVA A;  4Z2W A;  4MVQ A;  1VQ8 V;  2VWJ A;  1CPY A;  3OR6 C;  1D2D A;  2CH7 A;  4DV4 B;  1VQ7 V;  1ENV A;  2ARU A;  3CJH B;  4CBC A;  1WB7 A;  5LOV B;  4BW9 A;  3ZHR A;  3BY6 A;  5IWA O;  4KQE A;  2BOC C;  1Y74 A;  1BSM A;  1H8E G;  2YS8 A;  5J2T A;  1B3Q A;  1K3E A;  3BRC A;  3IAL A;  1H4S A;  3CMA V;  1EBO A;  3UT5 A;  1B04 A;  4DW1 A;  5FPR A;  3LNN A;  2DN9 A;  2RJZ A;  3CME V;  3E9H A;  4QE9 A;  2KQX A;  4TTV A;  2UXN A;  3OTF A;  1N36 O;  5FLX N;  2ART A;  2BCC H;  2Q0O C;  3FAV A;  1FAF A;  3SPG A;  2PGG A;  3RW0 A;  4NTX A;  5K1P A;  3CWB H;  1NTZ H;  5GON B;  1P49 A;  4K35 A;  4ZOL A;  1AJP A;  2F4V O;  1VF6 C;  1AR4 A;  3F5W C;  5H6Q A;  3DGE A;  3JD3 A;  3NEN A;  2YI9 A;  5L3D A;  2HKO A;  1BS3 A;  1S3J A;  3ZCC A;  4MVO A;  4X20 B;  1DF5 A;  2W0F C;  5HFL A;  4YRS A;  5KLV H;  4L87 A;  5EC2 C;  5B1N A;  4ZI7 B;  1L8D A;  1KP3 A;  1QBZ A;  4UUJ C;  2R9R B;  4D6T H;  2KG7 B;  2AMC A;  3RWR D;  2HNI A;  5C8Y A;  3G80 A;  4LF6 B;  4WFF A;  5IYC O;  4CS4 A;  3CCE V;  1YZB A;  3H1I H;  2UUC O;  2QE7 G;  4TWK A;  1Q90 D;  4DR5 O;  3BJU A;  2P0L A;  4JAU A;  3SYA A;  2OIE A;  4DR7 B;  2LO1 A;  1JMK C;  3PCO B;  1DK1 A;  1X01 A;  4J10 A;  1PP9 H;  3RL6 A;  5KA6 A;  2UUA B;  2XT9 A;  4XTV A;  1X4T A;  4CH5 A;  2Q6A A;  1OV9 A;  4E2L A;  1N32 O;  4P74 A;  3FJP A;  2HEP A;  1VEW A;  1NJ1 A;  3CD6 V;  1YSC A;  3K9A A;  2ZR3 A;  3ZX6 A;  4QPJ A;  5A9G A;  2HVJ C;  2IJH A;  3STL C;  3CCJ V;  2RQ6 A;  5H9C A;  5IJ0 B;  3N2K B;  3RF1 A;  2FB5 A;  2R70 A;  4H2X B;  2X0L A;  3BHP A;  3KCY A;  3NXS A;  3JD4 A;  1MSD A;  1I94 B;  1SS3 A;  1KMI Z;  3JAS A;  2ZDI C;  3TUP A;  3ZMZ A;  1I0H A;  1YTF D;  1PKX A;  1MA1 A;  2XAH A;  3TGU H;  5EIB C;  3L74 H;  1NVP B;  2FML A;  2AZ2 A;  5ITZ A;  2QSA A;  4PDL A;  4H2U A;  4OLF A;  5CA1 A;  2EIL C;  1IZ3 A;  3OD1 A;  1W0J G;  1AI7 A;  3CXC U;  3LUT B;  3GWO A;  4UFZ A;  4UVA A;  1YCI A;  5KUK A;  1C0A A;  2WPD G;  5EC1 C;  2Q67 A;  1YJN V;  3CE2 A;  3D36 A;  4FLW A;  2EIL B;  2EZP A;  2ZTG A;  4MW3 A;  5H6R A;  1VQ5 V;  3UO3 A;  3ABU A;  4X62 B;  3ZIA G;  2B5U A;  2WAM A;  4WFG A;  4UCO A;  3LSS A;  3FKS G;  1A32 A;  2Q0A A;  4GX2 A;  4X1K A;  4U7O A;  2E75 B;  4MVU A;  1QLE B;  1BT8 A;  4K87 A;  3TXQ A;  2VWK A;  1FFT B;  3IJ4 A;  4HWS A;  5KA5 A;  4FLZ A;  1X2H A;  3K9S A;  4FFK A;  1DTO A;  1NS1 A;  4B7K A;  1YB3 A;  2JS3 A;  3QTC A;  1SQX H;  3H01 A;  5EYP A;  3STZ C;  1S5L Z;  4O4L B;  4TV8 B;  3QO5 A;  3RT3 C;  2X6C A;  1S5J A;  4EB6 A;  5EZY A;  1G1X B;  1RIQ A;  5C51 B;  4NXN B;  5LL6 Y;  3E89 A;  4RQE A;  1VQM V;  2I4L A;  4X8A A;  4X65 B;  1DLB A;  1Q8I A;  2ZQM A;  5B3S C;  5B1B B;  1PL4 A;  2CTR A;  4TUY B;  2VQF O;  3ZMU A;  3RYF B;  1S77 D;  3W3S A;  3JAK B;  4X1Y B;  2EX3 A;  1V9P A;  3AEI A;  3ETG A;  4R7C A;  5AG2 A;  1JX9 A;  4DV2 O;  4J42 A;  2EUL A;  2QR4 A;  4UV8 A;  2ALY A;  1Q43 A;  1NKD A;  5LGU A;  1TUB B;  3T4D A;  2D2C B;  3SGI A;  1IVS A;  3ZRV A;  5B3S B;  4DV5 B;  2IH3 C;  3HKC A;  3FB5 C;  1MOF A;  4FLV A;  4GCZ A;  3QF7 A;  3SPC A;  3VOU A;  4WCE V;  4AQY B;  3AG4 C;  4BIO A;  1VF7 A;  3BFR A;  3OMI B;  1F4N A;  5KX5 B;  1DF4 A;  4JI7 O;  2CJB A;  2IY5 A;  2E3C A;  2R72 A;  1W66 A;  2F23 A;  3A32 A;  2PYJ A;  1S5H C;  4RUF A;  4DR6 O;  1IX9 A;  2OTJ V;  3AG4 B;  3ERR A;  3ETD A;  4N23 A;  2DJZ A;  3HKB B;  4CS3 A;  2I4N A;  4GLX A;  1IBL B;  1L0L H;  2KSD A;  3ZED A;  4IYH A;  1K4C C;  5LYJ B;  4FIP C;  1QVG U;  2LFS A;  5L3G A;  2HP8 A;  1KC8 W;  1J5E B;  5KHH A;  3LSQ A;  1R6N A;  1E24 A;  3JCU Z;  2ZGW A;  4JI2 O;  5JQG B;  4YRN A;  4F4L A;  2CK3 G;  5LXT A;  1E1Q G;  3SPJ A;  1KUQ A;  4EO4 A;  5CB4 A;  2QM7 A;  2IM9 A;  2E5A A;  3A0H Z;  4JZ2 A;  5CA0 B;  1JOY A;  4H2W A;  4YDQ A;  3ZMV A;  3ABK C;  1K9M W;  5KMG B;  3K5O A;  3SJB C;  4LNS A;  1SKV A;  5LP6 B;  4JI3 O;  3P8T A;  1XOU A;  1GN2 A;  1Z5V A;  3VBB A;  4FFB A;  2BSK A;  4DV6 B;  4KHP B;  3ABK B;  4UCT A;  3DC5 A;  4G84 A;  1NH2 B;  3E8B A;  3ASO C;  1XBL A;  5BR8 B;  1ZL8 B;  5E3I A;  4XDJ A;  1PNM A;  4L8J A;  1YVW A;  4MTF A;  3HKE B;  4LF4 B;  3RVY A;  4YRQ A;  2BE3 A;  2B9Z A;  3SJA C;  1FFX A;  2ZIM A;  4GKJ B;  1YFS A;  1Z2G A;  2FL4 A;  5FL7 G;  2ZIN A;  2DZC A;  2EWN A;  3ASO B;  4HWT A;  2JIZ G;  3M99 B;  4JI8 O;  2WA3 A;  4P75 C;  4O4H B;  2CGN A;  2Z0A A;  3CYO A;  2CH7 B;  4O2D A;  3P32 A;  5CBG A;  4TVW A;  4NKG B;  3RGL A;  3G1Z A;  1OCO B;  4O4J A;  1SQB H;  3C3S A;  3JYC A;  1Q82 W;  1HNW O;  4P9P A;  2XGT A;  2QTS A;  4UP7 A;  1N33 B;  4DRX B;  1QLN A;  3PZC A;  3OGI B;  5J2T B;  2UUA O;  2IU3 A;  2QJ1 A;  1Q81 W;  2Q5H A;  1PYS B;  1G51 A;  4I0X B;  3BPZ A;  2N05 A;  2PY5 A;  2Q7E A;  1R3L C;  1M56 C;  4BIU A;  4YCW A;  5IDJ A;  3K5L A;  1RPR A;  2H8P C;  3FX7 A;  1US6 A;  4X1I A;  5BMV A;  1ARO P;  1Q6H A;  4UVC A;  3K0D A;  2DU7 A;  3FAV B;  3SR2 C;  4H2S A;  2L6L A;  4W4L A;  4HWO A;  1M56 B;  5KNN A;  1AIL A;  1B6Q A;  1UPG A;  4H44 B;  4WBN A;  3I7F A;  2A3Q A;  3L9D A;  5E1A C;  1OCR B;  1KMN A;  4ZBM A;  3SYC A;  4B3M O;  1ADY A;  3HKD B;  4EEQ A;  4OX9 O;  1I94 O;  4J7K A;  5JWP A;  4JV5 B;  4IT5 A;  3RKY A;  1KB9 F;  2DE0 X;  3A5Y A;  3T1Y B;  1TVK B;  1GK9 A;  3SYP A;  2ARS A;  2DQ3 A;  3P30 A;  4RDX A;  3ICX A;  4JPR A;  1T5E A;  2KB1 A;  1M90 W;  3BFM A;  4X9Q A;  5C8Y B;  4K3A A;  5BZB A;  4I7Z B;  1B7Y A;  1W59 A;  1EN6 A;  2YEV A;  2HFE C;  3JSN A;  4YJ2 B;  2ODR C;  2QGN A;  2WSS G;  4WI1 A;  4YXW G;  4MS2 A;  4QE7 A;  3L72 H;  3ZRS A;  4YIP A;  1QCE A;  5F5W A;  3K57 A;  1SER A;  3ASN C;  4GX1 A;  4X62 O;  1JPX A;  1M57 C;  4Q15 A;  5JH7 B;  5IT9 N;  4K0K B;  4UVB A;  5KUM A;  2XAF A;  4K8Z A;  4YJ3 A;  2IU0 A;  4DV7 B;  5ELO A;  2NNU A;  3HR0 A;  1H4Q A;  3ZMS A;  2ADP A;  1BBU A;  3ZHS A;  4DW0 A;  1AVM A;  2QHT A;  1M57 B;  4JI6 O;  3SJQ C;  4P73 C;  1WLE A;  4PA9 A;  2ZT9 B;  1E1T A;  3I55 V;  3MAQ A;  2DOS A;  1BCC H;  3ZRX A;  1EM1 A;  4J41 A;  4NXN O;  1PNL A;  4JTA B;  4EFE A;  3AG1 C;  4X65 O;  3JAS B;  1XI1 A;  3NET A;  2P6J A;  4IL6 Z;  5JCO C;  4GX0 A;  3HFV A;  2WLL A;  3EFR A;  1FXH A;  1WNS A;  3E22 A;  4P71 C;  1XMQ B;  2Z3Y A;  1VQK V;  5ITZ B;  1M4U A;  3AG1 B;  3CRC A;  3IAY A;  4LF5 O;  5CA1 B;  2CE4 A;  5JJE B;  2ZR2 A;  2QHV A;  4YP0 A;  3R65 A;  1NJ2 A;  2QTO A;  2GUZ B;  1WPB A;  1QVF U;  4UCR A;  2V7Q G;  3CCS V;  4AQY O;  2YDE A;  1EFR G;  1EN5 A;  4DUZ B;  4TT3 G;  1EIY B;  3TEG A;  3HPL C;  5HGQ A;  4DR4 B;  1K5S A;  3P3P A;  1GN4 A;  2LFR A;  5ELN A;  2RMK B;  3ZRW B;  4JTC B;  2DZ9 A;  5DM6 V;  1UJW B;  4JI0 B;  4X1K B;  2QWQ B;  4G28 B;  2ODM A;  4X89 A;  1KQS U;  3MHS C;  5IYZ A;  1VMG A;  2W0X A;  4XU3 A;  3CX5 F;  1GRJ A;  2UXD B;  2EIJ B;  1BMF G;  4KR2 A;  2QHS A;  5IYB O;  2GTA A;  1BGY H;  2R9A A;  3E8G A;  2EJF A;  4RMF A;  4NTW A;  1AR1 B;  4ZTZ B;  4O2A A;  4K88 A;  4EB6 B;  5EZY B;  1SZX A;  2EBO A;  3T1H B;  2VQE B;  2PYL A;  1Q6I A;  3Q4H A;  3ZJZ A;  4YRC A;  4DR1 B;  1EOV A;  3S3W A;  2PZS A;  2Q5I A;  3OM3 B;  3OR7 C;  5J2U A;  5EBW C;  2Q69 A;  3CPW U;  3H1H H;  4UCS A;  4KHP O;  1YHQ V;  1KMM A;  4LWS A;  5BR8 O;  2RN9 A;  4LF4 O;  3I5D A;  1KKC A;  3ZHT A;  1WNL A;  4ZHQ B;  4I4T B;  3W7U A;  1FJG O;  3IKL A;  5CBF A;  1YDX A;  2DTH A;  3RYI B;  2IY5 B;  3O9O A;  1M5I A;  1KOG A;  3UFG A;  3GWK C;  3CSX A;  1S0V A;  4DV3 B;  2YUA A;  1WPY A;  4P2Z A;  2NN4 A;  1SQF A;  3K59 A;  4LCU C;  4Z1M G;  1NJ5 A;  3OT7 A;  4OP0 A;  4XTZ A;  4ZKI A;  2ZXW C;  4F6E A;  2DYS B;  1QR8 A;  1EVL A;  1N33 O;  3ABM B;  3WB1 A;  2GHY A;  2C2A A;  4YY3 O;  4I9Q A;  4AHC A;  2B1I A;  3D3I A;  4UCU A;  5IJ9 A;  1TUE B;  2Y69 C;  2QM8 A;  4J11 A;  4O2B B;  2G38 A;  1X59 A;  4PI2 A;  1IBM O;  4P72 A;  5LXT B;  1ZUQ A;  3ZN0 A;  2QWP B;  2ZXW B;  1E1O A;  4PG3 A;  4YRK A;  4MSW C;  3UH0 A;  3PJS K;  4PI0 A;  1ZSP A;  3V7R A;  3APQ A;  1P7B A;  5LA6 A;  3ABT A;  3JD1 A;  1M9N A;  4YRE A;  1XNQ B;  4MVS A;  3FD9 A;  2Y69 B;  4GYC B;  3MDS A;  3HXX A;  1XUQ A;  1OCZ B;  1NI8 A;  2AXT Z;  2ZT7 A;  4DUY B;  4FFB B;  3JAT A;  1N0J A;  4LP8 A;  1YF2 A;  1TAE A;  2YSU B;  4P3N A;  1SET A;  3BA9 A;  1GM7 A;  2K1E A;  4PV1 B;  4YRL A;  2ITC C;  3GB7 C;  2IJJ A;  4B3T O;  3V8K A;  2DYR C;  2EIK C;  3T1Y O;  2IBZ H;  1TGO A;  1JFF A;  1VIB A;  1YFR A;  1FFX B;  1HWY A;  2X7R B;  3ICA A;  4LC1 A;  1MSW D;  2OWO A;  1VQP V;  4J15 A;  4FZ1 A;  4GZR B;  3IC7 A;  4HAM A;  3CEI A;  2GSM B;  2DYR B;  5D5P A;  2JGD B;  4LNU A;  2EIK B;  2FKX A;  1YFT A;  3CRM A;  2A0L A;  1WPX A;  3RUX A;  1SRY A;  2K9P A;  1S76 D;  1B70 A;  3EHB B;  4UCV A;  4LF8 O;  1B76 A;  2ARH A;  2UUB O;  2J3L A;  4I50 A;  3HB3 B;  4PA7 A;  5FNV B;  2P06 A;  3H1L H;  5GTI Z;  4K0K O;  4NB5 A;  1WJZ A;  4DV7 O;  1G4Y B;  3U10 A;  1FXK A;  4WF9 V;  2XAJ A;  4YRJ A;  1XRE A;  5LMU O;  2QKS A;  1Y67 A;  1EZV H;  12AS A;  5BMV B;  1RSO A;  4J9Y B;  1QLE C;  2JVD A;  4JI4 B;  2UXC O;  3HXU A;  5B1O A;  2EL9 A;  4CH3 A;  1ASY A;  5LBQ A;  2AHY A;  3OFN G;  1RP3 B;  4U3J B;  1YJ9 V;  1N9W A;  3QG5 A;  4LBE C;  2FYU H;  2RNB A;  1IBK B;  1Y6X A;  4X88 A;  4TV9 B;  1H2S B;  4PEL A;  1AP6 A;  4K8X A;  4DV0 B;  4XEO A;  1SQP H;  1IL2 A;  1GGM A;  2DTI A;  2DTO A;  1K5Q A;  1SA0 A;  3ABL B;  5CA3 A;  3B40 A;  3L70 H;  1EVK A;  4TQD A;  4DXW A;  3D8C A;  2XHB A;  3RIR A;  5B1B C;  2EAY A;  1XMQ O;  2G4C A;  5KHI A;  3H1J H;  3HXW A;  1P84 F;  2DVE A;  2F43 G;  2M7W A;  5DEC A;  4QNH B;  4FMT A;  1HR0 O;  3OD4 A;  2OCH A;  2CAZ C;  3DXR B;  4X64 B;  4FLT A;  4LFC B;  2XAG A;  3MD0 A;  4FLX A;  2P7T C;  5L3B A;  4DUZ O;  4LFB B;  3CB2 A;  4FPP A;  4YCV A;  4DK1 A;  4DR4 O;  1WAZ A;  5F2V O;  3RGB A;  1JVM A;  3HFZ A;  4YJ3 B;  5KAI Z;  3RFR A;  4BAY A;  1NQT A;  4JI0 O;  2OTL V;  2LW1 A;  2Q9L A;  3C90 A;  3U0Z A;  4B3R B;  3K06 A;  4NTY A;  1XL4 A;  1KU9 A;  4NXM O;  1BHB A;  1X2G A;  1ASZ A;  5C53 B;  4LFA O;  2UXD O;  4XU0 A;  1ZLZ A;  2DMX A;  3R66 A;  3HXV A;  4GKK O;  5HFM A;  4YRF A;  1N4C A;  2A8E A;  3LC0 A;  3E35 A;  2JJ2 G;  3JAL B;  2UU9 O;  1NJ6 A;  4H2Y A;  3FYI B;  1TA8 A;  2QHU A;  3T1H O;  2VQE O;  2ZNI A;  1X56 A;  4N21 A;  3TK1 A;  2QWN B;  4DV4 O;  3CCR V;  1ZX3 A;  4DR1 O;  3JCZ A;  2Q7H A;  1IXB A;  2HJD A;  4JI1 B;  1UFI A;  5GON A;  3WFV A;  3JAM N;  1PM9 A;  3L1A A;  3L75 H;  1AB3 A;  2AKW B;  3OTO B;  5LP6 C;  2N74 A;  4O4I B;  3F7Y C;  3P3N A;  3JD0 A;  1K33 A;  4X20 A;  2QKC A;  4PA6 A;  1SZT A;  4IHJ B;  2OYQ A;  4X66 B;  3A7U A;  3FB8 C;  1VF6 A;  2AGA A;  3RYC B;  3TCU A;  4H2V A;  5KHK A;  5H5N A;  4XU1 A;  4F6R A;  1ZTE A;  4XDK A;  2KG7 A;  2ZE8 A;  1QF6 A;  1CXZ B;  3NR7 A;  4B3S B;  3CC2 V;  2W6J G;  1RPO A;  2LP7 A;  5LGT A;  4HWP A;  4DV3 O;  2P22 C;  3S3X A;  3F7V C;  2F93 B;  4FVM A;  1W0K G;  2DW4 A;  2JEX A;  4JTD B;  4DK0 A;  1FS0 G;  5IYZ B;  5CN0 A;  5JJJ B;  4XTY A;  3TEH A;  3PCO A;  3BCC H;  1JCH A;  4Q20 A;  2QA4 V;  3HRI A;  2XTA A;  4FM0 A;  1K92 A;  4PA4 A;  3G6B A;  2WLI A;  3ML0 A;  1F51 A;  3N2G A;  4IIJ B;  3L4G B;  2LW7 A;  3REU A;  3DSQ A;  1OCO C;  4JAA A;  3UCS C;  2HHH B;  1XIL A;  3A7R A;  3TXS A;  4TVA B;  4LF6 O;  5EIB D;  1AI5 A;  5LGN A;  2E64 A;  1XMO B;  3Q4H B;  4DR2 B;  5IJ0 A;  1HXD A;  1XNR B;  1Q3E A;  1Y66 A;  1H4V B;  4DR3 B;  1N8R W;  4DR7 O;  3N2K A;  4KL1 A;  1FYF A;  4LH7 A;  1K34 A;  1IXM A;  2LQT A;  1Y74 B;  3RYH A;  3E2E A;  1Z7M A;  1XNQ O;  3FFQ A;  2CJ9 A;  4LVK A;  4WFE A;  2F66 C;  1NU1 H;  1JR9 A;  3HY1 A;  1EZJ A;  1BIA A;  4DUY O;  2MK3 A;  1M93 A;  3UT5 B;  2H94 A;  4BR6 A;  3VQV A;  4R8C A;  5LHI A;  1OCR C;  4LWS B;  1XHX A;  1GKF A;  4YHH B;  1N34 B;  1MMM A;  4MT8 A;  4BW5 A;  1GN6 A;  3E83 A;  3HXY A;  2OT5 A;  3SJC C;  3UO2 A;  1X54 A;  2ZZE A;  4OGQ B;  3A74 A;  2ZDI A;  2UXB B;  1Z7N A;  4UB6 Z;  3T1C A;  4NCX A;  2CTW A;  2UUC B;  4I9W A;  2A79 B;  4ZOL B;  4G2K A;  5JVD A;  2NS6 A;  3W7X A;  4HWR A;  2PI5 A;  1AR5 A;  2OCC C;  1ADJ A;  1L0N H;  2WLM A;  2JS5 A;  4EKW A;  3OUF A;  5EK0 A;  2ZCE A;  1QNM A;  3B2E E;  1WYD A;  1Y76 A;  4HYO A;  2QKA A;  2CUG A;  2VRZ A;  4OPA A;  3JSL A;  2OCC B;  4ICG A;  2AMC B;  5IJ9 B;  1JQ0 A;  2ZZG A;  3LSU A;  3CCL V;  2FTK A;  3EVK A;  1K4D C;  4H0L B;  5JJN B;  5EBL C;  3ZHU A;  1PL0 A;  5B66 Z;  3AG3 B;  4FLY A;  3ZHQ A;  4TV8 A;  4DV1 B;  3RAC A;  1V54 C;  1WB8 A;  4YRR A;  3JAR A;  1JJC A;  2EIM C;  1VP7 A;  1IBK O;  2WLJ A;  4BIZ A;  3MF2 A;  4E51 A;  1R73 A;  2ETN A;  2YXH A;  3JAT B;  1KEC A;  3M4Q A;  4PA3 A;  1V55 C;  4TUY A;  3RYF A;  1V54 B;  3JAK A;  2GV9 A;  2EIM B;  2AZ0 A;  2FYK A;  4PDM A;  4YPF A;  3RKW A;  2ADQ B;  3QO7 A;  3ETE A;  2BTO A;  4U7N A;  4UV9 A;  3KKY A;  2PMF A;  4H02 A;  5L3F A;  3AG2 C;  4FM1 A;  1V55 B;  4MW8 A;  3IG2 A;  1USY C;  2Z5U A;  4RUE A;  1EFW A;  2PUS A;  4JZG A;  3BAA A;  5D5Q A;  3OEE G;  3EFS A;  1H8H G;  3VQW A;  4YRT A;  2CDY A;  1GAX A;  1G5I A;  2DDZ A;  1B70 B;  3AG2 B;  2EJ9 A;  3E8F A;  1BL8 A;  4EX5 A;  4R50 A;  1YGB A;  4NR1 A;  4I50 B;  2JRI A;  2EZO A;  5B1A C;  1Q86 W;  1D5A A;  3P8Y A;  3D36 C;  4UB8 Z;  2ZE6 A;  4NYK A;  1NH2 D;  1NR1 A;  3BEH A;  3HKB A;  1QHT A;  1VQ4 V;  4YIO A;  4D7T A;  4YRI A;  4DV5 O;  3U11 A;  2UXX A;  1FXK B;  3OUS A;  4B3R O;  2XAS A;  1Q5O A;  3SDL A;  3CXH F;  1QR9 A;  3K03 A;  5LYJ A;  2ZM6 B;  4YCU A;  3B4S A;  5B1A B;  1HTT A;  1PV0 A;  1VF5 B;  3SYQ A;  5GTH Z;  5BY1 A;  3X2Q C;  5BXZ A;  4ZTU B;  5JQG A;  1I08 A;  4TVY A;  1HC7 A;  2QWR B;  2EIJ C;  4J80 A;  1JJ2 U;  2Y48 A;  1NYQ A;  2AHZ A;  4PDR A;  3A2F A;  5CA0 A;  1YJW V;  1IBL O;  3UM7 A;  1BE3 H;  2VQF B;  3MEY A;  5KMG A;  1COW G;  2GTS A;  3X2Q B;  2RHS A;  5LP6 A;  1XDC A;  3LDE A;  1YTF B;  4DV2 B;  1AP5 A;  2ZE5 A;  1PNK A;  4JI1 O;  5EYP B;  3LDD A;  1E22 A;  3CRA A;  1J5E O;  1CEZ A;  4OPH A;  3OE7 G;  2J3M A;  1D5N A;  5LHG A;  2ZXF A;  1ORQ C;  1ZL8 A;  1VAR A;  4JYC A;  2IW5 A;  3HKE A;  3A5Z A;  2ZNJ A;  3ZBH A;  4LR3 A;  3T4Z A;  2Q8V A;  3UGT A;  4J7J A;  4JYA B;  1PD3 A;  2IJI A;  3LDC A;  2F95 B;  4CC5 A;  2ALY B;  4B3S O;  4O4H A;  2WWW A;  1VQZ A;  4D7S A;  4PHZ A;  3HFZ B;  1ZAU A;  4DV6 O;  3HKC B;  3UGQ A;  3D3Q A;  1R3K C;  4WFB V;  3CCU V;  2JEU A;  4JF3 A;  4DRX A;  4DR6 B;  4P75 A;  1HNZ B;  2H3O A;  3I56 V;  1PYS A;  4GKJ O;  4I0X A;  4Q6G A;  4JI2 B;  2HHH O;  4GT1 A;  1FXV A;  2DYS C;  3ABM C;  2P5O A;  3V7C A;  4PDV A;  3AK3 A;  1XMO O;  1X55 A;  1Q6U A;  2BTQ A;  3RBZ A;  4Z1V A;  4DR2 O;  4XEM A;  3WQZ A;  3ZHV A;  1XNR O;  4DR3 O;  4FZ0 A;  2I4O A;  4JI3 B;  2ODR D;  1CP9 A;  2QM4 A;  3AK1 A;  4TQF A;  2HG5 C;  3HKD A;  4HT4 A;  1L1F A;  1WA8 A;  1OZ0 A;  3A31 A;  2YXY A;  3B8M A;  4FJC C;  5DN6 G;  4I5S A;  1H2M A;  3H1K H;  3K08 A;  4I55 A;  5C52 B;  1OCZ C;  5B5E Z;  1S72 V;  5CB4 B;  1TVK A;  4YHH O;  1N34 O;  2X6A A;  2E76 B;  2AW9 A;  2E1H A;  1AJQ A;  2M6Y A;  2IJK A;  4F6R B;  3AG7 A;  3KG2 A;  1MZE A;  4JI8 B;  1ZWI C;  2UXB O;  4XTU A;  3OGC C;  1WU7 A;  1K97 A;  3G4S V;  4YJ2 A;  2BSK B;  3K5M A;  3J80 N;  1YXB A;  1VQ9 V;  4HNA A;  2V4D A;  4E4E A;  1ROP A;  3KFU A;  4JV5 O;  4LF7 B;  4P3O A;  3TEH B;  1SQQ H;  4MTG A;  1HNW B;  2Q73 A;  2WLN A;  1EN4 A;  2WLI B;  4J9Z B;  5JH7 A;  2HJF C;  3N2G B;  4ABM A;  2CGO A;  1R6T A;  2ATK C;  2EJG A;  2RDC A;  2YIB D;  2Q7G A;  3WB2 A;  2B1G A;  1KD1 W;  4XDL A;  2EJR A;  4XBF A;  3UKM A;  1W2B U;  2Y0I A;  1LR1 A;  1BQ0 A;  4MTX A;  1IUR A;  5E79 Z;  4AI8 A;  4CH6 A;  4O4J B;  3BVO A;  1NT2 B;  1H2G A;  4DV1 O;  2ZT6 A;  1IDS A;  2IH1 C;  3RYH B;  1ATI A;  3P8V A;  1OHH G;  4YRG A;  2DWE C;  4B3M B;  4TWA A;  4OX9 B;  1F7Y A;  4P73 A;  1H2L A;  4P3P A;  4X5O A;  1R6K A;  2EJ7 A;  3MHH C;  1WP8 A;  3OW2 U;  2RHQ A;  4WJ3 M;  2JGU A;  1AI4 A;  4JYY A;  1MNG A;  2YIA A;  4X1I B;  4ASU G;  1LUV A;  1U96 A;  1GM9 A;  1USY A;  2NLJ C;  2CJA A;  11AS A;  3TJT A;  2I4M A;  4DPG A;  3ABL C;  3JAW A;  2JK5 C;  1MAB G;  4WBN B;  5JCO A;  4TSF G;  3VQY A;  2YIB A;  2GUZ A;  1F4M A;  1GMG A;  3W7S A;  2XTI A;  1YIJ V;  5JVD B;  4RWU A;  3IGA C;  4P71 A;  4DQ2 A;  1G8M A;  1NTK H;  5H2F Z;  2E65 A;  1QE0 A;  5CBH A;  1I7F A;  1SQG A;  3KCX A;  2CGH A;  5DED A;  5LMN B;  1EIY A;  3BAB A;  2XUM A;  1XEQ A;  3SYO A;  4XTW A;  1R3J C;  1Y76 B;  1NTM H;  4RO2 A;  3ZRW A;  5EBM C;  5KAF Z;  1J95 A;  2D3O W;  2DXU A;  2YC0 A;  1KP2 A;  3K04 A;  2HR3 A;  4ZIB A;  3CC7 V;  4JAS A;  2QWO B;  3FB6 C;  1B7Y B;  5CMU A;  2YEV B;  1XHZ A;  3QO8 A;  4JI6 B;  3K3W A;  4FM2 A;  2E41 A;  2ZM6 O;  4RAI A;  4JI5 B;  5LHH A;  2A9H A;  3ZS8 C;  3MF1 A;  1B8A A;  2DWD C;  3K79 A;  2JDI G;  3NEM A;  3JAR B;  1JJC B;  2DJV A;  2N04 A;  4LF9 B;  2DU5 A;  1Z5W A;  1YEW A;  3C3T A;  3IC9 A;  1NBM G;  3CJH A;  2PME A;  5LOV A;  1HP8 A;  2PTM A;  3CMQ A;  2E10 A;  4H37 A;  3HXZ A;  1P4R A;  3CC4 V;  3RKX A;  2E5L B;  4LF5 B;  5L3E A;  1NJ8 A;  2KKW A;  1E1R G;  3HTZ A;  3ETQ A;  3CRQ A;  1VQL V;  3R07 A;  1THZ A;  1O9G A;  4AIL C;  5IY5 C;  2P4K A;  1GO3 F;  2WLH A;  4RQF A;  4CH4 A;  2ITD C;  1JA8 A;  4P30 A;  1HNX B;  3M7M X;  1QQC A;  4ZHQ A;  4I4T A;  2NR5 A;  4MTO A;  3PN1 A;  3OEH G;  4UP9 A;  2WLL B;  3RYI A;  4JYA O;  5J9P C;  5IY5 B;  5A2Q N;  3QNE A;  3E22 B;  2CTQ A;  1HDJ A;  4WJ4 A;  3E86 A;  3OAA G;  2R9I A;  1BIB A;  1FKA O;  4GUN A;  1YI2 V;  2Q4P A;  2CIM A;  1LYL A;  3FB7 C;  3HRK A;  4FK5 C;  4IYI A;  4DO2 A;  4CS2 A;  4QIW F;  2Q68 A;  3A0B Z;  4LH6 A;  1H4T A;  4YYE A;  2ZZF A;  2Y4U A;  2ZD9 A;  4ZI7 A;  5GW7 A;  2JJ1 G;  4WFH A;  2XAQ A;  3SPH A;  3A8T A;  1HNZ O;  4BWA A;  1WP7 A;  3K58 A;  4WFA V;  3V8J A;  5KHG A;  2V1D A;  1OJH A;  3H9V A;  2ZT8 A;  3B77 A;  1N0N A;  4O2B A;  2A06 H;  1P7G A;  1M1K W;  3J81 N;  2DKG A;  5C93 A;  1R3I C;  5IWA B;  1NVP D;  3M8A A;  2Q5Z A;  4KP4 A;  4MVM A;  2XOK G;  2RHS B;  2C8M A;  2W6I G;  2YI8 A;  3CCM V;  4QPK A;  3CP1 A;  4MVR A;  1VQ6 V;  4UP8 A;  2OIG A;  3MQZ A;  1K7D A;  4O2A B;  1B06 A;  4UXN A;  1J5W A;  3WG7 C;  1Q7Y W;  1N36 B;  1LNQ A;  1YIT V;  1BHA A;  1OCC C;  1FJG B;  1WQW A;  3ZN1 A;  2ZIO A;  2ZT5 A;  2P67 A;  4C7U A;  4H2X A;  1L0W A;  4G85 A;  3APO A;  4PD4 F;  4MVZ A;  4XTX A;  2X6B A;  2QEX V;  3RVZ A;  3THO A;  1WN7 A;  2Y0P A;  5J2U B;  2F4V B;  3WG7 B;  1SES A;  4NVP A;  2JGD A;  2DXT A;  3JD2 A;  4LVL A;  1OCC B;  1G6U A;  4J7Z A;  3ZMT A;  2BOB C;  2DEQ A;  3EXA A;  3HY0 A;  3NEL A;  1SC5 B;  2P4V A;  2ZE7 A;  4HZ3 A;  4KXR A;  5FPO A;  4LF7 O;  3LNM B;  3DTU B;  3W7W A;  4PJ0 Z;  4H13 B;  1E79 G;  3B8N A;  2YXL A;  4HA8 A;  3SPI A;  1WQ7 A;  3G71 V;  1BQZ A;  4YY3 B;  1GTO A;  3OMA B;  3QVN A;  1H38 A;  4QGP A;  5FNV A;  3J7A U;  3DC6 A;  1PPJ H;  4W4K A;  4B08 A;  1GH6 A;  4IGG A;  3TET A;  3K5N A;  3CRR A;  1RFY A;  1K73 W;  1KBH A;  1IBM B;  4DR5 B;  4OXS A;  3REX A;  1EQR A;  5K1X A;  2P5I A;  2BTQ B;  3AK2 A;  4P72 C;  4TOI A;  4U3J A;  4YRM A;  3B09 A;  1U97 A;  1DGS A;  4DYL A;  5IE9 A;  2C7I A;  3W7T A;  4R6Z A;  4TV9 A;  3AG3 C;  5KHJ A;  4HVC A;  1N32 B;  1O9H A;  4QJF B;  1WA8 B;  4FLU A;  2EIN C;  2VS0 A;  1Y4M A;  4B3T B;  3EFF K;  4I55 B;  1KYO F;  1FPO A;  4P74 C;  1NJI W;  4JI4 O;  4O4L A;  2MW2 B;  5LA6 B;  1JJO A;  3G67 A;  1K8A W;  2EIN B;  4U3F H;  4CZZ A;  4WF2 A;  3GVM A;  3E8H A;  2Y4T A;  3CCV V;  1URF A;  3VQX A;  4G27 B;  3L73 H;  3WU2 Z;  2WLK A;  1XL6 A;  3L2Z A;  4UPA A;  4JAV A;  4DV0 O;  1BBW A;  4P9O A;  4B7E A;  4HNA B;  1NYR A;  3DXR A;  3K0G A;  1HW7 A;  1RM1 C;  2PI4 A;  4LF8 B;  4X1Y A;  2ZKO A;  1VQN V;  5LMN O;  2L35 A;  2UUB B;  4CC6 A;  1JFF B;  1SF9 A;  2LGW A;  4K86 A;  1AI6 A;  1TUB A;  2A7W A;  3L71 H;  1MG1 A;  3E9I A;  3G6E V;  3T2M A;  1RM1 B;  3F5T A;  2XND G;  3WB0 A;  5LMU B;  1NZ6 A;  2WA4 A;  4LNU B;  3CCQ V;  3ASN B;  4AH6 A;  1I5Y A;  1R1B A;  2QDO A;  1LUW A;  2GBO A;  2UXC B;  4GX5 A;  5KX5 A;  4LVI A;  3N27 A;  4X64 O;  2HVK C;  4LFC O;  4XU2 A;  1FXK C;  2O57 A;  4HBN A;  1G5H A;  4JI5 O;  3JAL A;  4LFB O;  4KFM A;  1BZK A;  3O65 A;  4LVM A;  4LF9 O;  4YRO A;  3M4P A;  2ILM A;  2YIC A;  1KKD A;  2E74 B;  1SQV H;  4EFB A;  2RHQ B;  4LVJ A;  4KR3 A;  4A5U B;  4YRP A;  1GM8 A;  1RSO B;  1I5X A;  1MZF A;  2AKW A;  2RCV A;  2E5L O;  4H33 A;  3V8L A;  1XQ8 A;  3JAW B;  4O4I A;  3CS5 A;  1F23 A;  3CHX A;  1NNH A;  1HR0 B;  3KZI Z;  1H2K A;  4IHJ A;  1HNX O;  1H2N A;  3RYC A;  2P90 A;  1SA0 B;  2GDS A;  1AJN A;  4KUM A;  2YID A;  3IKM B;  3IFX A;  5IYD O;  1VQO V;  3A0R A;  4JGS A;  1NR7 A;  2PF4 E;  2CTP A;  4H2T A;  3A7A A;  4JYB A;  3OTO O;  3BA8 A;  3UQ8 A;  3OMN B;  3V7S A;  1GN3 A;  2HLD G;  4NXM B;  5L3C A;  3RN4 A;  4LFA B;  2LGQ A;  4X66 O;  4IIJ A;  3L4G A;  4PHC A;  4JI7 B;  4GKK B;  1FYJ A;  5TIS Z;  1QU7 A;  2F1M A;  2DQ0 A;  3FYE B;  2UU9 B;  2LJ2 A;  1FD9 A; 
#chains in the Genus database with same CATH homology
 4TVA A;  2AKW B;  4B3M B;  4TWA A;  4OX9 B;  5C8Y B;  3OTO B;  1B7Y A;  5LP6 C;  2VWJ A;  4P73 A;  4O4I B;  4P3P A;  4X5O A;  3JSN A;  4YJ2 B;  2ODR C;  4DV4 B;  2RHQ A;  4WJ3 M;  4X20 A;  2JGU A;  2ARU A;  4WI1 A;  2YIA A;  3A7U A;  4IHJ B;  5LOV B;  2OYQ A;  4BW9 A;  4X66 B;  4KQE A;  4X1I B;  3RYC B;  4H2V A;  5F5W A;  5KHK A;  3K57 A;  1USY A;  1SER A;  5J2T A;  4XU1 A;  4F6R A;  2CJA A;  11AS A;  1QF6 A;  2I4M A;  4DPG A;  4Q15 A;  3BRC A;  5JH7 B;  3JAW A;  4B3S B;  3IAL A;  1H4S A;  4K0K B;  4WBN B;  5JCO A;  3VQY A;  2YIB A;  4K8Z A;  4YJ3 A;  4DV7 B;  5ELO A;  3UT5 A;  1B04 A;  4HWP A;  1H4Q A;  2XTI A;  2P22 C;  3LNN A;  5FPR A;  2RJZ A;  5JVD B;  2F93 B;  3E9H A;  4FVM A;  1BBU A;  5IYZ B;  5JJJ B;  4DK0 A;  4P71 A;  4TTV A;  4XTY A;  2E65 A;  3TEH A;  4DQ2 A;  3PCO A;  3OTF A;  2ART A;  1QE0 A;  2QHT A;  3HRI A;  4FM0 A;  1I7F A;  1SQG A;  4P73 C;  1WLE A;  2CGH A;  5LMN B;  1EIY A;  3BAB A;  2PGG A;  3N2G A;  4IIJ B;  3L4G B;  4XTW A;  1E1T A;  3REU A;  3MAQ A;  3DSQ A;  5K1P A;  5GON B;  2HHH B;  1P49 A;  4ZOL A;  2DXU A;  3A7R A;  4TVA B;  4ZIB A;  5EIB D;  3NEN A;  1B7Y B;  4EFE A;  2YI9 A;  2E64 A;  1XMO B;  1XHZ A;  3JAS B;  3QO8 A;  4DR2 B;  1XI1 A;  3NET A;  4JI6 B;  5JCO C;  5IJ0 A;  4X20 B;  4FM2 A;  1Q3E A;  1XNR B;  1HXD A;  1H4V B;  4DR3 B;  2E41 A;  3EFR A;  3N2K A;  4KL1 A;  1FYF A;  4LH7 A;  3HFV A;  4L87 A;  4ZI7 B;  1WNS A;  1L8D A;  3E22 A;  3RYH A;  4JI5 B;  1Z7M A;  3FFQ A;  2CJ9 A;  4P71 C;  4LVK A;  3ZS8 C;  3MF1 A;  1XMQ B;  1B8A A;  5ITZ B;  1M4U A;  3RWR D;  2F66 C;  3IAY A;  2AMC A;  2HNI A;  5C8Y A;  3JAR B;  1JJC B;  5CA1 B;  4LF6 B;  5JJE B;  3NEM A;  3HY1 A;  4CS4 A;  2QHV A;  2ZR2 A;  1BIA A;  4YP0 A;  1NJ2 A;  4LF9 B;  2DU5 A;  1Z5W A;  1YEW A;  1M93 A;  3BJU A;  2P0L A;  1WPB A;  3UT5 B;  4UCR A;  3VQV A;  2PME A;  5LOV A;  4DR7 B;  1XHX A;  4YHH B;  1N34 B;  1JMK C;  3PCO B;  2PTM A;  3CMQ A;  2E10 A;  3HXY A;  3SJC C;  3HXZ A;  1X54 A;  4DUZ B;  1X01 A;  3RL6 A;  2ZZE A;  1EIY B;  2UUA B;  3A74 A;  3RKX A;  2E5L B;  4LF5 B;  4XTV A;  3TEG A;  1X4T A;  1NJ8 A;  5HGQ A;  4DR4 B;  2KKW A;  4CH5 A;  2UXB B;  1Z7N A;  5ELN A;  3HTZ A;  3ETQ A;  4NCX A;  3R07 A;  2UUC B;  4ZOL B;  2DZ9 A;  4P74 A;  1O9G A;  4AIL C;  4JI0 B;  4X1K B;  3FJP A;  5JVD A;  2HEP A;  2NS6 A;  1NJ1 A;  4HWR A;  4RQF A;  5IYZ A;  4CH4 A;  1ADJ A;  2JS5 A;  1HNX B;  2ZR3 A;  4XU3 A;  3M7M X;  1QQC A;  4ZHQ A;  4I4T A;  2ZCE A;  2RQ6 A;  3B2E E;  3PN1 A;  2UXD B;  5IJ0 B;  4UP9 A;  1WYD A;  3N2K B;  3RYI A;  4KR2 A;  3RF1 A;  2R70 A;  2QHS A;  3QNE A;  3E22 B;  4H2X B;  3JSL A;  2R9A A;  3BHP A;  2EJF A;  4RMF A;  4WJ4 A;  4ZTZ B;  2AMC B;  4O2A A;  4K88 A;  4EB6 B;  5EZY B;  1BIB A;  5IJ9 B;  2ZZG A;  1I94 B;  3T1H B;  2VQE B;  2PYL A;  2CIM A;  1LYL A;  1KMI Z;  3JAS A;  3HRK A;  3TUP A;  4CS2 A;  5JJN B;  1H4T A;  4LH6 A;  4YRC A;  4YYE A;  4DR1 B;  1EOV A;  2ZZF A;  4ZI7 A;  4FLY A;  2PZS A;  2Q5I A;  5EIB C;  4TV8 A;  4DV1 B;  3RAC A;  4BWA A;  3K58 A;  3V8J A;  5ITZ A;  5KHG A;  5J2U A;  4YRR A;  4H2U A;  3JAR A;  1JJC A;  5CA1 A;  2ZT8 A;  4OLF A;  3OD1 A;  3MF2 A;  4O2B A;  4E51 A;  3JAT B;  4UCS A;  1KMM A;  2DKG A;  4UFZ A;  3M4Q A;  4TUY A;  3RYF A;  1C0A A;  5IWA B;  3JAK A;  1WNL A;  2GV9 A;  4ZHQ B;  4I4T B;  2RHS B;  2C8M A;  2FYK A;  4FLW A;  3IKL A;  2YI8 A;  2ZTG A;  4YPF A;  3RKW A;  2DTH A;  3QO7 A;  4X62 B;  3RYI B;  2IY5 B;  2BTO A;  4UCO A;  2PMF A;  4H02 A;  1M5I A;  3LSS A;  1KOG A;  3UFG A;  4FM1 A;  2Q0A A;  3CSX A;  4X1K A;  4UP8 A;  3MQZ A;  4DV3 B;  4O2A B;  3IG2 A;  1USY C;  1J5W A;  1WPY A;  4K87 A;  2VWK A;  3K59 A;  1SQF A;  1EFW A;  2PUS A;  4HWS A;  1N36 B;  4FLZ A;  1NJ5 A;  1X2H A;  3BAA A;  5D5Q A;  4OP0 A;  1FJG B;  3EFS A;  3VQW A;  4YRT A;  1WQW A;  4XTZ A;  1YB3 A;  1G5I A;  3QTC A;  2ZIO A;  2DDZ A;  2ZT5 A;  1B70 B;  2EJ9 A;  1EVL A;  5EYP A;  4H2X A;  1L0W A;  3WB1 A;  4EX5 A;  4O4L B;  4TV8 B;  4G85 A;  4I9Q A;  1YGB A;  4AHC A;  4I50 B;  4XTX A;  3QO5 A;  3THO A;  1WN7 A;  5J2U B;  1S5J A;  2F4V B;  4EB6 A;  4UCU A;  5EZY A;  1D5A A;  5IJ9 A;  1SES A;  3P8Y A;  4NVP A;  2DXT A;  1RIQ A;  5C51 B;  3HKB A;  4NXN B;  4LVL A;  3BFM A;  1QHT A;  4RQE A;  4O2B B;  2I4L A;  4PI2 A;  4D7T A;  4P72 A;  1G6U A;  3U11 A;  5LXT B;  4X65 B;  4YRI A;  1E1O A;  2DEQ A;  4PG3 A;  4YRK A;  3HY0 A;  1Q5O A;  3NEL A;  5FPO A;  1Q8I A;  3UH0 A;  5LYJ A;  4PI0 A;  4TUY B;  2ZM6 B;  4YCU A;  3RYF B;  2YXL A;  3V7R A;  3JAK B;  3W3S A;  4HA8 A;  1WQ7 A;  4X1Y B;  5LA6 A;  1HTT A;  2EX3 A;  1V9P A;  4YRE A;  1XNQ B;  4YY3 B;  4YRS A;  4GYC B;  2ALY A;  5FNV A;  4ZTU B;  1Q43 A;  3HXX A;  5JQG A;  4TVY A;  1TUB B;  1HC7 A;  2ZT7 A;  4B08 A;  3K5N A;  3SGI A;  4DUY B;  4FFB B;  3JAT A;  1IBM B;  4DV5 B;  4DR5 B;  1TAE A;  3HKC A;  4P3N A;  3BA9 A;  1SET A;  3REX A;  4FLV A;  1NYQ A;  1EQR A;  3A2F A;  5CA0 A;  5K1X A;  2P5I A;  4YRL A;  3QF7 A;  2VQF B;  3MEY A;  4AQY B;  2BTQ B;  5KMG A;  3V8K A;  1VF7 A;  2RHS A;  5LP6 A;  1TGO A;  1JFF A;  5KX5 B;  1YFR A;  3ICA A;  1FFX B;  4P72 C;  4TOI A;  4U3J A;  4DV2 B;  2CJB A;  4YRM A;  2IY5 A;  2E3C A;  1DGS A;  2OWO A;  2R72 A;  2C7I A;  1W66 A;  5EYP B;  3A32 A;  4J15 A;  2PYJ A;  4TV9 A;  1E22 A;  5KHJ A;  4HVC A;  1N32 B;  1O9H A;  2J3M A;  2ZXF A;  4FLU A;  3ERR A;  4LNU A;  5D5P A;  2DJZ A;  3HKB B;  4CS3 A;  2I4N A;  4GLX A;  1IBL B;  1YFT A;  3HKE A;  4B3T B;  4I55 B;  3A5Z A;  2ZNJ A;  3ZED A;  4LR3 A;  3RUX A;  1SRY A;  4P74 C;  1B70 A;  5LYJ B;  3UGT A;  4UCV A;  4JYA B;  1B76 A;  4O4L A;  5LA6 B;  1JJO A;  2J3L A;  4I50 A;  1J5E B;  5KHH A;  2F95 B;  4CC5 A;  3LSQ A;  2ALY B;  4WF2 A;  5FNV B;  1E24 A;  2ZGW A;  4O4H A;  5JQG B;  1VQZ A;  4YRN A;  4D7S A;  4PHZ A;  3VQX A;  5LXT A;  3HFZ B;  4UPA A;  3L2Z A;  1ZAU A;  3U10 A;  4EO4 A;  1BBW A;  3HKC B;  5CB4 A;  3UGQ A;  2IM9 A;  4HNA B;  4YRJ A;  1NYR A;  2E5A A;  1HW7 A;  5CA0 B;  4H2W A;  4YDQ A;  12AS A;  5BMV B;  1RSO A;  5KMG B;  4LF8 B;  4DRX A;  2JVD A;  3K5O A;  4X1Y A;  3SJB C;  4JI4 B;  2EL9 A;  3HXU A;  4LNS A;  1SKV A;  4P75 A;  1HNZ B;  4CH3 A;  5LP6 B;  2UUB B;  1ASY A;  4CC6 A;  1JFF B;  3P8T A;  1PYS A;  4U3J B;  1N9W A;  4K86 A;  3QG5 A;  4Q6G A;  1TUB A;  1Z5V A;  4JI2 B;  1IBK B;  3VBB A;  4FFB A;  4TV9 B;  3E9I A;  1H2S B;  4DV6 B;  4K8X A;  3WB0 A;  4DV0 B;  4KHP B;  4XEO A;  4UCT A;  2P5O A;  5LMU B;  4G84 A;  3V7C A;  4LNU B;  5E3I A;  5BR8 B;  4AH6 A;  1X55 A;  1IL2 A;  2BTQ A;  1GGM A;  2DTI A;  4L8J A;  4LF4 B;  4XEM A;  3HKE B;  2DTO A;  1SA0 A;  3WQZ A;  2UXC B;  4YRQ A;  5KX5 A;  3SJA C;  4LVI A;  1FFX A;  1EVK A;  4TQD A;  2ZIM A;  2I4O A;  4JI3 B;  4XU2 A;  2ODR D;  4HBN A;  2XHB A;  4GKJ B;  1YFS A;  1G5H A;  3RIR A;  3JAL A;  2QM4 A;  2ZIN A;  2EAY A;  2G4C A;  2DZC A;  5KHI A;  4TQF A;  2EWN A;  4HWT A;  3HKD A;  4HT4 A;  3HXW A;  4LVM A;  3A31 A;  2DVE A;  4P75 C;  4O4H B;  4YRO A;  3M4P A;  4I55 A;  5C52 B;  4O2D A;  2RHQ B;  4EFB A;  4TVW A;  3RGL A;  4LVJ A;  4KR3 A;  3G1Z A;  4O4J A;  5CB4 B;  1TVK A;  4YRP A;  2CAZ C;  4X64 B;  4FLT A;  4LFC B;  2XGT A;  2E1H A;  4UP7 A;  4FLX A;  1N33 B;  4DRX B;  3PZC A;  5J2T B;  4F6R B;  4LFB B;  3CB2 A;  2AKW A;  2QJ1 A;  4YCV A;  3V8L A;  2Q5H A;  4DK1 A;  1XQ8 A;  1PYS B;  3JAW B;  4JI8 B;  1G51 A;  4XTU A;  4O4I A;  1WU7 A;  3RGB A;  3BPZ A;  2PY5 A;  2Q7E A;  3CHX A;  4YJ2 A;  1NNH A;  4YJ3 B;  3RFR A;  3HFZ A;  4YCW A;  1HR0 B;  3K5M A;  3U0Z A;  3K5L A;  4HNA A;  2V4D A;  4B3R B;  1KU9 A;  4IHJ A;  3KFU A;  4LF7 B;  4P3O A;  3TEH B;  4X1I A;  5BMV A;  3RYC A;  1HNW B;  1X2G A;  1ASZ A;  5C53 B;  2DU7 A;  1SA0 B;  4XU0 A;  3HXV A;  3SR2 C;  4H2S A;  3IKM B;  5JH7 A;  4HWO A;  3N2G B;  5KNN A;  4YRF A;  4WBN A;  2A8E A;  2EJG A;  3I7F A;  3LC0 A;  3JAL B;  2YIB D;  2Q7G A;  3WB2 A;  1KMN A;  1NJ6 A;  4H2T A;  3A7A A;  1ADY A;  4H2Y A;  3HKD B;  4EEQ A;  3BA8 A;  1TA8 A;  3UQ8 A;  2QHU A;  3V7S A;  2ZNI A;  4JV5 B;  1X56 A;  4NXM B;  3RKY A;  3A5Y A;  4LFA B;  3T1Y B;  4CH6 A;  4O4J B;  1TVK B;  2Q7H A;  4IIJ A;  3L4G A;  4PHC A;  2ARS A;  4JI7 B;  1NT2 B;  4GKK B;  2DQ3 A;  4JI1 B;  4RDX A;  3ICX A;  5GON A;  2ZT6 A;  1T5E A;  3RYH B;  1ATI A;  3L1A A;  3P8V A;  2F1M A;  2UU9 B;  2DQ0 A;  4YRG A;  4DR6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...