3DSQA

Structure of desulfitobacterium hafniense pylsc, a pyrrolysyl trna synthetase
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
280
structure length
278
Chain Sequence
PPLSSFWTKVQYQRLKELNASGEQLEMGFSDALSRDRAFQGIEHQLMSQGKRHLEQLRTVKHRPALLELEEKLAKALHQQGFVQVVTPTIITKSALAKMTIGEPLFSQVFWLDGKKCLRPMLAPNLYTLWRELERLWDKPIRIFEIGTCYRKESQGAQHLNEFTMLNLTELGTPLEERHQRLEDMARWVLEAAGIREFELVTESSVVYGDTVDVMKGDLELASGAMGPHFLDEKWEIFDPWVGLGFGLERLLMIREGTQHVQSMARSLSYLDGVRLNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Desulfitobacterium hafniense PylSc, a pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Ligase
molecule keywords Pyrrolysyl-tRNA synthetase
total genus 80
structure length 278
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01409 tRNA-synt_2d tRNA synthetases class II core domain (F)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3dsqA01
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3dsqA02
1N9WA 2ZINA 4RDXA 2CJ9A 3HY1A 4XTWA 4YROA 1YFSA 1EOVA 4HVCA 3A5YA 1KOGA 1X55A 2RHSA 2ZTGA 3QTCA 3LSQA 4XU1A 2DU5A 2RHQA 1VQZA 1B70B 3TEGA 1B7YA 2EAYA 3IG2A 3REXA 1H4TA 4BW9A 3HFZB 4K86A 4TVWA 2E1HA 2ZNIA 3HRKA 3RUXA 1BBUA 1WYDA 4RQEA 5C51B 1E1TA 2ALYA 2ARTA 3A32A 4YPFA 2IY5B 2E3CA 3E9HA 4P73C 2XTIA 2YI9A 1PYSB 4CH3A 4Q15A 4H02A 3VQWA 4TTVA 3MF2A 3L4GB 3NELA 1NJ8A 2QHTA 2CIMA 4RMFA 4P72A 4YRSA 4P3OA 2ZT8A 3VBBA 1YFRA 2YIBA 4YRGA 2ZZGA 1H4VB 3OD1A 3R07A 4YP0A 1J5WA 2ZIOA 3RKWA 4WJ4A 3KFUA 4P73A 2ODRD 2I4LA 3HXVA 3VQVA 3EFSA 1X54A 4TVAA 3V7CA 3A7UA 2C7IA 1C0AA 4DPGA 3PZCA 4P71C 1USYC 1WQ7A 4CH5A 3HFZA 1X56A 3RKXA 2ODRC 3RIRA 4HWSA 4H2UA 2ALYB 3E9IA 4P72C 1HC7A 1NJ5A 3DSQA 4YRNA 2CGHA 1H4SA 4CS3A 1SESA 3ERRA 1ADJA 1H4QA 2R72A 5C52B 2HEPA 3L4GA 1LYLA 4YRTA 2DXTA 4P75A 3RF1A 1E22A 2E64A 1WPYA 3CMQA 1B76A 2QJ1A 4Q6GA 4TQDA 4CH4A 4LNSA 2DTIA 2ZT5A 2Q7GA 4YRIA 4TWAA 2ZR2A 2ARUA 3NEMA 3QO5A 4YRQA 1QF6A 3IKMB 1BBWA 1B8AA 1EIYB 2E41A 1SRYA 3PCOB 4TVAB 2R70A 4O2DA 4ZTUB 2J3LA 4KR2A 1O9GA 2DTOA 4KQEA 3V7RA 3RKYA 4XTUA 3W3SA 1YGBA 2ZR3A 4CS4A 4L87A 3RL6A 3TUPA 3HTZA 4P74C 1NYQA 1L0WA 1RIQA 3EFRA 4PG3A 1WU7A 3L1AA 2Q5IA 4P3NA 3V8LA 4H2WA 1NJ2A 2Q7HA 12ASA 3V7SA 5E3IA 4P71A 2DJZA 3ICAA 4XTYA 4PHCA 4P75C 4H2VA 2EJ9A 1QE0A 3PCOA 1EIYA 1ASZA 1WLEA 2DVEA 2ZGWA 2DQ3A 4EO4A 4CH6A 2ZZFA 4YRCA 2QHSA 3QNEA 1NJ6A 1G5IA 1G6UA 4P74A 2ZXFA 2J3MA 1HXDA 4HWOA 2DTHA 2JVDA 2PMEA 1NNHA 2EJFA 3LC0A 2I4NA 1E24A 4H2XA 4OP0A 2DQ0A 4DQ2A 4RQFA 4HWPA 2YIAA 4BWAA 2DZCA 3QO8A 4XU3A 2EJGA 2Q5HA 2P0LA 3A7RA 3A5ZA 1EVKA 1IL2A 4E51A 1BIAA 1E1OA 2RQ6A 1G5HA 1JJCB 2DU7A 3UGQA 3HXWA 2XGTA 2PUSA 2DZ9A 2FYKA 5C53B 5K1XA 3REUA 1SERA 4X5OA 4YRLA 3QO7A 4TQFA 2E65A 1ADYA 2ZZEA 3NETA 1WQWA 4ZIBA 3MF1A 3A31A 4YRJA 1EVLA 1X01A 3HXUA 1EFWA 2AKWB 1KMNA 3P8YA 3UH0A 4XTZA 1O9HA 1EQRA 1YFTA 3BFMA 3MEYA 4YREA 4AH6A 4UPAA 2QHVA 2CJAA 2EL9A 4XTVA 1X2HA 4H2XB 4K87A 2ZCEA 3HXZA 4UP9A 3TEHA 4H2TA 3RACA 4H2SA 2CJBA 1NYRA 4G85A 1SETA 1GGMA 11ASA 3NENA 4XEOA 4XU0A 2PMFA 5K1PA 2ZIMA 2RJZA 3V8JA 2ZT7A 4WF2A 1JJCA 2C8MA 3P8TA 3WQZA 3HXYA 2PGGA 4UP8A 2AMCB 1YB3A 3BJUA 2ZNJA 4TVYA 2DKGA 1BIBA 4YRPA 2G4CA 3IKLA 1KMMA 4K88A 3FJPA 1X2GA 4YRRA 2Q7EA 4J15A 2AKWA 4XU2A 4WJ3M 2I4OA 4HWTA 2P5IA 3HXXA 4EX5A 3V8KA 4YCUA 4YRKA 5ELNA 3ZEDA 2DDZA 2HNIA 2DEQA 3A7AA 3I7FA 3HFVA 3VQXA 3VQYA 5HGQA 1W66A 1ASYA 4ZTZB 1Z7MA 3TEHB 1Z7NA 2ARSA 2RHSB 2YI8A 2RHQB 2QHUA 4H2YA 1B70A 4WI1A 4YRFA 1B7YB 3G1ZA 1FYFA 4YCWA 3P8VA 4P3PA 4YDQA 2E5AA 4KR3A 1G51A 3UFGA 3M4QA 3HY0A 3LSSA 2I4MA 4XTXA 2AMCA 1USYA 4XEMA 4OLFA 3IALA 2IY5A 3HRIA 3UGTA 3M4PA 1ATIA 2E10A 4NCXA 1WNLA 1PYSA 4YRMA 5ELOA 4YYEA 4HA8A 4CS2A 3A74A 4G84A 1NJ1A 4YCVA 4UP7A 3L2ZA 2EWNA 5KNNA 2ZT6A 1HTTA 2YIBD 5F5WA 3RGLA 4HWRA 2DXUA 3BHPA
chains in the Genus database with same CATH superfamily
2H94A 3LDEA 1JPXA 5FPOA 2Y4UA 2ZINA 2WLJA 1GM7A 2CJ9A 4YROA 1THZA 2IJKA 2XNDG 1E1QG 4KHPB 3A5YA 1WN7A 3M99B 3TK1A 2RHSA 2ZTGA 4XU1A 4DR1B 4X66B 2YSUB 1X4TA 1VQ9V 3N2KA 3C90A 2P67A 1ZSPA 3IG2A 5KX5B 3CRRA 3PJSK 5LOVB 3HRKA 1M56C 1N33O 1CPYA 1E1TA 4EB6B 4YPFA 4K8XA 2IY5B 1OCRC 1R1BA 1KP2A 5LXTB 4W4KA 2XTIA 3ZMVA 4JYAO 4CH3A 3VQWA 4Z2WA 1FJGB 3L4GB 2CK3G 5JWPA 4UV9A 3NELA 4R50A 3VBBA 2VWJA 2YEVA 2AXTZ 2IJIA 5BY1A 2L6LA 1YFRA 1I94O 2F95B 3SPGA 2JDIG 1I08A 1K5SA 1XHXA 2GUZB 3R07A 2VQFB 3ICXA 1NI8A 2ZIOA 5IT9N 4OGQB 3STLC 1AJNA 2E5LB 4P73A 2ODRD 4ZOLA 4DV5B 1QQCA 4I7ZB 3HXVA 2ZXWC 1TAEA 4U3JB 2KQXA 3EFSA 4TVAA 1KYOF 4K3AA 3A7UA 4FMTA 2C7IA 4L8JA 4HYOA 1FFXB 4PDMA 1WJZA 4KXRA 2WLLA 2KKWA 4CH5A 2V7QG 3RIRA 3GWKC 1PL0A 1S0VA 4P72C 4ZKIA 3ASNB 4DV2B 1NJ5A 4DUYB 4R8CA 4GZRB 2EZOA 1OCZC 3ERRA 3ETEA 3CC4V 1H4QA 1NT2B 2ZD9A 2YDEA 3ZHSA 4H13B 1VMGA 4F6RA 4YRTA 1E22A 5LBQA 2UXDB 3DC5A 2PY5A 2E64A 3IGAC 4Q6GA 1FFTB 5IJ0B 4CH4A 4U7NA 1AI6A 1Y67A 2DTIA 3JALB 3VOUA 2JIZG 3CCQV 3I55V 5B1AB 4CC6A 3SJQC 4X64O 2BE3A 4GLXA 1F51A 4LWSA 2WLNA 3APOA 4X20B 3WB1A 3F5TA 1BMFG 4R6ZA 3X2QC 3ZMSA 2JEUA 1RPRA 3PCOB 1SRYA 1XMOO 2ZKOA 3LNNA 1JR9A 4KUMA 2JS3A 3A2FA 3NR7A 2WAMA 3G6EV 2N05A 4LF8O 1S76D 1S5LZ 2HJDA 4DV7O 2UXDO 2A79B 2XAJA 2Y48A 4R7CA 5HFLA 4KQEA 1GN4A 4X1YA 4XTUA 1VF5B 5FPRA 2EIJB 5LA6A 3CCRV 1YGBA 1H2GA 3QG5A 4FFBA 1U96A 5BMVB 3WB0A 1HNXB 1KB9F 3RL6A 3EFFK 1IDSA 3HTZA 2NNUA 4LVJA 2WPDG 3TGUH 2ZT9B 3C3SA 3EFRA 4FZ0A 1TUBA 4FVMA 1NH2B 1KKDA 3BCCH 2Q6AA 4UCUA 4IIJA 3SJCC 4B3SB 3OGCC 4KL1A 2Q5IA 4JYCA 1NU1H 2CTPA 2QGNA 1H2LA 1QU7A 2E5LO 2ZE5A 3G80A 3JYCA 3B8MA 4X65B 3ICAA 3TCUA 4P75C 4MTOA 1F4NA 3SYQA 4B08A 2EJ9A 1QLNA 3A8TA 4H33A 1ASZA 1WLEA 3LUTB 4PJ0Z 4H0LB 5EIBC 1FYJA 2QWQB 4J41A 4JI3B 4G27B 4RO2A 5GONA 4JI5B 2ZXFA 4MVMA 2DTHA 1Q86W 4QPKA 1Q43A 2JVDA 1NNHA 3DC6A 3ZX6A 1YTFD 1VQLV 1YJ9V 2JGDA 1XMQO 2PI5A 3U11A 4K0KO 4MVRA 3SJBC 1NR7A 2UU9O 4RQFA 1N33B 4GX2A 4HWPA 1V55C 3UQ8A 4NR1A 3OR7C 4JZ2A 4W4LA 1GM8A 4JI4B 1OZ0A 2EJGA 2NN4A 2Q5HA 2LGWA 3A5ZA 1IL2A 3H1KH 1BIAA 1E1OA 1G5HA 3FB5C 1JJCB 4OX9B 3ZRWA 3UGQA 3SR2C 5JJEB 2GDSA 2YS8A 2PUSA 4DV6B 3JAWB 4UCVA 3OW2U 3HKEA 5KA6A 4JI7B 3REUA 4JV5B 3QO7A 4X66O 4TQFA 2UXXA 4JPRA 1ADYA 4PA6A 2ZZEA 1Y6XA 2HLDG 1H2NA 1EVLA 2O57A 1EFWA 3T1YB 3AG2B 5CA1A 3H01A 1GO3F 4XTZA 1O9HA 1EQRA 4JI6B 2EJRA 5JVDA 4B3TB 4AH6A 4X64B 3J7AU 2CH7B 3WFVA 1X2HA 2ZCEA 4ZI7A 3TEHA 2Q67A 5FLXN 1VEWA 1M93A 2DYRB 1F23A 4H2SA 1NYRA 1N4CA 2VQEO 1YTFB 3JD3A 3NENA 4ZHQB 5JH7A 4LVMA 3FB8C 5F2VO 1SA0B 2ZE8A 3T1CA 2X0LA 1GN2A 1FPOA 2WLKA 1QNMA 2Y69B 1ZLZA 1Q6HA 4WF2A 4O4JA 3P8TA 3APQA 4AHCA 5LP6A 4I0XA 4DRXA 2XT9A 3RYHA 1VF7A 3BA9A 4MVSA 1XDCA 2EIMB 5HFMA 4X1IA 3D36A 3BPZA 1BIBA 4TV9A 4YJ3B 4YRPA 1CXZB 1FXVA 2G4CA 5KA5A 5L3GA 2X6CA 3JASB 3CCEV 5EC1C 3RYCB 2EIKB 1K34A 2AKWA 4XU2A 4I55A 3CB2A 2OIEA 2P5IA 5J2TB 3DXRA 2DDZA 3U10A 4JAVA 3HFVA 4PDVA 2BOCC 2Q0AA 4O4IA 2OT5A 1NZ6A 3VQYA 5HGQA 2CE4A 3E22B 1YSCA 5B3SC 3P32A 4DR7O 1SC5B 3JD1A 1EZVH 4H2YA 4A5UB 1B70A 4WI1A 3CJHA 4YRFA 2IJHA 1L1FA 1HWYA 1FYFA 3P8VA 1TGOA 4P3PA 3K5MA 1XL6A 3FAVA 3M4QA 5B1NA 4X65O 1DF5A 2IJJA 4UUJC 2OIGA 4U7OA 5DM6V 4XTXA 1SF9A 2A06H 2HFEC 1SQBH 2EIJC 3ETGA 4NTYA 1M57B 4X1KA 3HRIA 1MOFA 2RMKB 3F7VC 1ATIA 4GT1A 3HKDB 1WNLA 2GV9A 1YEWA 4GKKB 2WSSG 3K5NA 4DR6O 2ZM6O 1L8DA 5ELOA 4YYEA 5IJ9A 5EZYB 2LGQA 2QR4A 1BHBA 2OWOA 2BSKA 5LYJB 1UPGA 2EWNA 3SDLA 2ZT6A 4WFFA 3RGLA 1XNQO 5F5WA 3ZJZA 1S5JA 2ITCC 3B40A 4HWRA 3ETQA 2VRZA 5LHIA 2CGOA 4JGSA 5H9CA 3X2QB 3AG1C 5CB4A 1EOVA 1M5IA 1QLEB 1Z5WA 3OGIB 1RM1B 4HVCA 3G67A 1KUQA 1KOGA 1SKVA 2DU5A 2RHQA 5IWAB 2DWDC 3BA8A 3K9AA 1Q3EA 2QM7A 2JRIA 1VQZA 3K0GA 4NTXA 1AROP 1YZBA 3TEGA 1VP7A 3P3NA 4TV8A 4I4TA 2EAYA 2H3OA 4X89A 1Y76B 1H4TA 4O2BA 1Q6UA 1XI1A 1YIJV 3SJAC 1IURA 2E1HA 2ZNIA 4H37A 2OCCC 1BBUA 1CP9A 4RQEA 1WYDA 2QWNB 3A32A 3SPHA 3Q4HA 3E9HA 4P73C 3MHSC 1QLEC 1YI2V 1DF4A 4FJCC 5IYZA 5LMUB 1PYSB 4N21A 2DWEC 1S72V 1G8MA 4Q15A 4LCUC 4TTVA 2UXBO 1Q8IA 3WG7C 3N2GB 4DV0B 4RMFA 3T2MA 4YRSA 3JAKB 2ZT8A 1HNXO 1FXKA 1PNKA 2YIBA 3L70H 5A2QN 1OCCB 3P30A 1H4VB 3CD6V 4QGPA 1R6KA 2JGUA 1ZAUA 2F23A 4JI4O 5E1AC 1ZX3A 1X54A 2WLHA 4FFKA 4HZ3A 3UT5B 3V7CA 4UFZA 3CMEV 3ZBHA 1Y4MA 3PZCA 3K0DA 3D3QA 1USYC 1MNGA 1KD1W 1WQ7A 2P6JA 5LOVA 3RKXA 2ODRC 4LVLA 1GM9A 2Y69C 4LFCO 4DK1A 1HW7A 4PA7A 4WFGA 4EB6A 1NTKH 2R9AA 1IZ3A 3DSQA 1NTZH 2GBOA 4MT8A 2IU0A 4NYKA 5KHGA 4JI3O 4EKWA 2AW9A 4YJ2A 2RDCA 1H4SA 1SESA 1Z5VA 3UM7A 2R72A 2LFRA 3D36C 5IWAO 1EZJA 2HEPA 3L4GA 1LYLA 2CTQA 2ETNA 5L3BA 1D2DA 5KLVH 1TUEB 1Q82W 2EX3A 1WPYA 4TOIA 1SQVH 2ADQB 2YEVB 3JSLA 4TQDA 4RUEA 3OMAB 3CX5F 3L73H 4UVAA 2P06A 4YIOA 4RUFA 3ZRXA 5CMUA 3EHBB 2LO1A 1WB7A 1V54B 1H38A 4B7EA 3QO5A 2IW5A 4ZOLB 4YRQA 1GKFA 3KG2A 1WPBA 1BBWA 1EIYB 2E41A 1SQPH 4TVAB 3CHXA 3RVYA 2PZSA 1GTOA 1PD3A 3OMIB 3JD4A 1SQXH 1FFXA 4GKJB 2WLLB 3ASNC 1O9GA 2FL4A 1BZKA 1XL4A 2CDYA 3ASOC 4X88A 1KC8W 3K58A 2EZPA 3T1HO 4UB6Z 3TJTA 1KP3A 1JQ0A 1I0HA 2ZR3A 4DV7B 4LNUB 4CS4A 1I94B 3K57A 1T5EA 4L87A 1H2MA 1KMIZ 2Y0IA 5KHJA 4FM0A 3K04A 2R9IA 3UO3A 3MQZA 3N27A 4F6RB 3TUPA 4P74C 1N0JA 4J10A 4NVPA 1L0WA 1P84F 3AG2C 4LF7B 1AVMA 4KP4A 1NTMH 4XBFA 4LFAB 3CEIA 1AJQA 3L1AA 1P4RA 3S3WA 2YC0A 4P3NA 4FLYA 4P9PA 3V8LA 1BCCH 1L0NH 3K79A 12ASA 3V7SA 1XNRO 1WP8A 4QPJA 4LWSB 3MHHC 4X20A 5E3IA 4JI1B 2DJZA 4DYLA 4PHCA 1AI4A 1QE0A 3PCOA 4JZGA 4J7ZA 2DVEA 1YITV 2ZGWA 2FB5A 4J9YB 3BRCA 3JATB 2HG5C 3MD0A 1SQGA 3W7TA 4WBNA 4FM1A 4FPPA 4ABMA 1IX9A 1R6TA 4LC1A 2QKCA 2EJFA 3LC0A 4X1YB 2I4NA 2IU3A 3CYOA 1N36O 1P49A 2E76B 2P4VA 4PD4F 1ORQC 3J80N 3QO8A 2XAQA 2Q4PA 2CUGA 2P0LA 1KU9A 1TUBB 1ZL8B 4LFBB 5C8YA 3AK3A 1HNWO 4IIJB 4WFEA 1OHHG 3CCVV 2DN9A 4MTFA 4UV8A 4C7UA 3CCJV 3AK2A 2DU7A 2QKAA 1J95A 3F5WC 4DR5B 2DZ9A 4I50B 5B1OA 2FYKA 1XOUA 2EINB 5K1XA 2DYSB 5J9PC 1SERA 1CEZA 3W7WA 4J80A 3ZMZA 1P7BA 3OM3B 1PP9H 1R73A 3JD0A 3D3IA 1VQ6V 3A31A 4LH6A 4XDJA 5D5PA 3HB3B 4JI7O 4UB8Z 1BQ0A 1GRJA 3P8YA 3TXSA 4DUYO 3UH0A 2WA4A 4TUYA 2XTAA 1YFTA 3BFMA 4YREA 5CA0B 1EN4A 2M6YA 4UPAA 2OCHA 5LHGA 2QHVA 2EINC 4XTVA 1MSDA 3SPIA 4K87A 3HXZA 4UP9A 1VQMV 1SQFA 2GHYA 3E8BA 4GKKO 4H2TA 3RACA 1ENVA 4G85A 2F4VB 4J7KA 1BL8A 4XEOA 4LP8A 3U0ZA 5K1PA 3SYOA 1HR0B 1H2KA 4BW5A 3W7XA 5C93A 3RN4A 2DYRC 1JJCA 1BQZA 4DUZO 4CC5A 4E4EA 2MW2B 2VQFO 1K33A 2PGGA 4UP8A 5JQGB 5JCOA 3K08A 2QTOA 3BJUA 3JAWA 5IY5C 4GX5A 2HJFC 1SZXA 1JJOA 3HKEB 1TVKB 2QDOA 1WP7A 2Q9LA 5LP6C 3ZS8C 3IKLA 1KMMA 2NS6A 1N34O 5GW7A 3A0BZ 4MVOA 4DV3O 1HP8A 1VQNV 4YRRA 4DR3B 1J5EB 4PA4A 5H6RA 4I9WA 1BT8A 2B1IA 4HWTA 1A32A 3AG1B 2A8EA 3HXXA 4P2ZA 3RYIB 5ELNA 3ZEDA 5KUMA 1AI5A 3A7AA 3ZRSA 3FB6C 3I7FA 1GAXA 5JVDB 1W0JG 1H2SB 1K97A 3T4DA 1W66A 1DK1A 2RCVA 1IBLB 3AG4C 4ZTZB 4ZI7B 3TEHB 1Z7NA 2AGAA 4MW3A 2QEXV 1WB8A 4TSFG 3G6BA 1KBHA 2QHUA 1EFRG 1PM9A 4ZHQA 5JH7B 2F93B 1YJWV 2EILC 1B7YB 1SA0A 1DTOA 3G1ZA 2HP8A 1LUWA 1Q5OA 1XUQA 3LNMB 5KAIZ 3LDDA 4HAMA 5LP6B 1XNRB 4DRXB 3RYHB 1URFA 4MS2A 3CPWU 3RT3C 3M4PA 1MZFA 4LF8B 4HNAA 4X1IB 4Z1MG 3ASOB 4TV9B 1Q7YW 4O4HA 2B9ZA 2HVJC 4HA8A 1H8HG 4CS2A 4DV3B 4LF5B 3A74A 5H6QA 4G84A 2A0LA 1N32B 1G4YB 1VF6C 3CRMA 3OT7A 3CCLV 5KNNA 1AP5A 2YIBD 4BR6A 1D5NA 4RDXA 2UXCO 3HY1A 3PN1A 4LH7A 1NS1A 1YFSA 5FL7G 3I5DA 4O4IB 5B1BB 1EM1A 1OCRB 3RGBA 4JTAB 2P90A 1M9NA 3ABMC 1HNZO 3QTCA 3LSQA 4FLUA 1K7DA 2F4VO 3J81N 1B70B 3E8FA 1COWG 2EIMC 1IXBA 4NKGB 4E2LA 3REXA 3L75H 3H1HH 3A0HZ 4GUNA 4O2AB 3HFZB 4TVWA 1OJHA 3THOA 2AHZA 4IT5A 3RUXA 2ALYA 1NKDA 4NB5A 5ITZB 1XMQB 3TETA 3B09A 5B1BC 3OTOO 2YI9A 5LL6Y 4LFAO 1RSOB 4H02A 1ZUQA 3QF7A 5EYPB 5FNVB 4KFMA 3CC2V 1MG1A 1YF2A 3ZHQA 5IJ9B 4X9QA 5EZYA 5KMGB 2PYLA 1OV9A 1NJ8A 3K5OA 2CIMA 1LR1A 2P22C 4MSWC 4P72A 5LYJA 3IC9A 1I5XA 2LW1A 2VWKA 3BAAA 4JI5O 1NVPD 1FS0G 4UCSA 4YRGA 1QVFU 4DR2O 3OD1A 3SYPA 4YP0A 5CB4B 2IH3C 1M1KW 1OCOB 5J2UA 3RKWA 3EXAA 4WJ4A 4DR4O 1HNWB 3KFUA 2I4LA 1HR0O 4NXNO 4NXMB 3VQVA 2K1EA 3T4ZA 2UUAO 2UUCO 2KSDA 4DPGA 5IY5B 4I4TB 4JASA 3OTOB 4P71C 1VF6A 2XAHA 4MTXA 3E89A 3KZIZ 2Q73A 3OEEG 1X56A 3R66A 4QE7A 2KG7A 4O4LB 3E9IA 3Q4HB 5LGUA 1HC7A 3AG4B 2N74A 4DO2A 1GH6A 2PTMA 5IYZB 4CS3A 4PDRA 1ADJA 3CXHF 5C52B 4DV4B 4B3MB 1XQ8A 2DXTA 4P75A 3RF1A 2B1GA 2LQTA 2CGNA 4WFAV 1EBOA 3N2GA 5EBLC 1BE3H 3CMQA 3L72H 1S3JA 1B76A 1H8EG 3E2EA 2ZXWB 3ZHRA 1FXHA 2ZT5A 5H5NA 2C2AA 4EEQA 3JARB 4YRIA 4TWAA 4JI8B 1P7GA 3HKBB 2A3QA 1TA8A 2PI4A 2ARUA 3NEMA 5KHHA 4LF6O 4Q20A 4Z1VA 1QF6A 4LF5O 3S3XA 1RFYA 1SQQH 3UT5A 2XAFA 3T1YO 3AG7A 3K06A 1LUVA 4JI8O 1R3LC 4ZTUB 2J3LA 2V1DA 1JX9A 1Q81W 1B3QA 4B3MO 3FYIB 3QVNA 1WNSA 3SGIA 3V7RA 1RPOA 4IHJB 2H8PC 3BEHA 3G4SV 4DV6O 1VQ5V 1JFFA 4YJ2B 4OX9O 1JVMA 1K73W 1GN3A 2B5UA 3SYAA 3OMNB 4GCZA 2GTAA 4FLVA 1QCEA 2EULA 4UCOA 1HDJA 1RIQA 1IBLO 1VIBA 1WA8B 4PI0A 3RYFA 1PL4A 5EIBD 2E74B 5B5EZ 1NR1A 2CAZC 4ZBMA 2Y0PA 3ABLB 3R65A 1NJ2A 1ROPA 1F4MA 2LP7A 4DR4B 5EBMC 3P3PA 1F7YA 3HKCA 2A7WA 2P7TC 4DW0A 2XAGA 3CRQA 1GN6A 4G28B 4H2VA 4OPHA 5L3EA 1EIYA 2UUBO 2ATKC 3OUFA 2QM8A 4AQYO 4FLTA 2DQ3A 2X6BA 5E79Z 4EO4A 4CH6A 3KCXA 4YRCA 3JCZA 2QHSA 1E79G 4ICGA 2LJ2A 1G5IA 2JEXA 3UO2A 1FJGO 5IE9A 1PNMA 3OAAG 3FX7A 2AZ0A 1HXDA 2J3MA 4HWOA 4QJFB 3E86A 2PMEA 3RWRD 4H2XA 1OCCC 4OP0A 2RNBA 4GKJO 4LNUA 4DQ2A 3ZRVA 1XNQB 4FLZA 1NBMG 4G2KA 4B3SO 1N0NA 3SPJA 2YIAA 1K92A 5LGTA 3CS5A 2GTSA 3ML0A 3CP1A 4XU3A 2WLIA 3RVZA 5TISZ 3B4SA 2WWWA 1XBLA 3B2EE 2RQ6A 3BABA 3IAYA 5EBWC 3ZIAG 1QR8A 4RAIA 3BVOA 3HXWA 2XGTA 1AR1B 3MDSA 2Q69A 2QSAA 1YCIA 4X5OA 4X62O 1JCHA 1Z2GA 2HVKC 1HNZB 1FAFA 3B8NA 1K4DC 3O65A 3NETA 1WQWA 4UXNA 4XDKA 1VQ4V 3MF1A 3HXUA 3STZC 3JATA 5JJJB 4QIWF 3AG3B 1KMNA 2QE7G 4YXWG 3NXSA 4WBNB 4PDLA 2AZ2A 1GMGA 4LFCB 1Y74A 3MEYA 1XILA 2ZDIC 3H1IH 1IBKB 4JI2O 2CJAA 1JMKC 1AR4A 1W0KG 1AJPA 1Q6IA 1UFIA 2CJBA 5CBGA 3FYEB 1SETA 1GGMA 11ASA 4XU0A 1ZL8A 1B04A 5C8YB 2RJZA 3E8GA 2ZT7A 4X62B 4PA3A 4JV5O 2Z0AA 5L3DA 5L3FA 2LFSA 3HXYA 2HKOA 2XUMA 2ARHA 3IJ4A 2AMCB 1G1XB 5L3CA 3ZHUA 4I50A 4DV2O 3OUSA 4FM2A 3H9VA 4MVZA 3EVKA 4TVYA 1PV0A 4FLWA 1ZWIC 4JF3A 5JJNB 2EJ7A 2BTQB 2RN9A 2XHBA 3FJPA 4LVIA 1X2GA 5DEDA 5EC2C 2UUCB 1Q90D 4J15A 1AP6A 4BIZA 5LMUO 2I4OA 1RP3B 4MW8A 4WFBV 2UU9B 2V4DA 4I9QA 5CN0A 4NXMO 1S77D 3OE7G 3CCMV 4YRKA 4TUYB 1N34B 4J9ZB 3FD9A 5CA0A 2DYSC 4LF7O 1J5EO 1S5HC 3IC7A 1KQSU 1I7FA 1ASYA 2WA3A 2ARSA 3CCSV 2RHSB 4J7JA 3ABLC 4RWUA 1IBMO 2YXHA 4PELA 5LGNA 3ZCCA 2EIKC 3N2KB 2LW7A 3ABKB 2XOKG 4YDQA 2E5AA 4KR3A 5KX5A 3K3WA 4TWKA 4DUZB 2R9RB 3HY0A 2JJ1G 3KKYA 3LSSA 1BHAA 3H1LH 1LNQA 2P4KA 1QR9A 5JQGA 3K59A 4OLFA 3B77A 4MVUA 2IY5A 3UGTA 2QWOB 1TVKA 4QNHB 1XEQA 5LXTA 4LR3A 2Q8VA 2E10A 4NCXA 5CBFA 1X59A 3ZMUA 3A0RA 3MAQA 1NJ1A 1YHQV 4NTWA 1WPXA 4D7SA 3ABUA 1DLBA 4UP7A 1ZTEA 1XHZA 3WG7B 2QTSA 4DR1O 3E8HA 2DOSA 2DXUA 4PI2A 3BHPA 1N9WA 3RYIA 1VQ8V 2GUZA 3DTUB 4XTWA 2BCCH 4YY3O 2ILMA 2YIDA 3OEHG 5B1AC 1X55A 1N8RW 4U3JA 4WFHA 4P30A 1M90W 4JI0B 3JSNA 3LDCA 3W7UA 1B7YA 1Y66A 3H1JH 4LFBO 4MTGA 1US6A 5JCOC 4LF6B 4BW9A 1FD9A 2F66C 4K86A 4MVQA 2PYJA 4J11A 2QA4V 4IGGA 3AEIA 5C51B 2ARTA 2E75B 2L35A 1B06A 2E3CA 1RM1C 5BR8O 3OD4A 1K4CC 4LF4O 2W0FC 4HNAB 4X8AA 4DW1A 4O4HB 3MF2A 1YDXA 5IYBO 3GVMA 2Q68A 2QHTA 4PHZA 4CZZA 4P3OA 3ZN0A 3BFRA 3L71H 5IJ0A 2FYUH 3JALA 4YHHO 2ZZGA 2UXNA 4FIPC 3CWBH 3L74H 2EBOA 1R3IC 3M8AA 1J5WA 4LVKA 3ZHVA 4JI1O 3ABTA 4LF9B 4I5SA 4JTCB 3FFQA 4DV1O 1PPJH 2UXBB 3F7YC 1MMMA 2X7RB 2VQEB 5B66Z 1C0AA 1JA8A 4LF4B 3ABKC 1XREA 5AG2A 4O2AA 2OYQA 4NXNB 2W6IG 3HFZA 2YICA 3GWOA 3JCUZ 3K03A 4JAUA 5GTIZ 4HWSA 4H2UA 2ALYB 2N04A 4HBNA 4DK0A 5ITZA 1K9MW 4ASUG 5B3SB 4YRNA 1UJWB 3W7SA 4OXSA 4YIPA 1K3EA 2JJ2G 5LA6B 2CGHA 2P5OA 1RSOA 4FFBB 3ETDA 5BMVA 4UVBA 2BTOA 2YUAA 3AK1A 5EYPA 5FNVA 3I56V 2Q5ZA 2FTKA 2KB1A 1MABG 5KMGA 2ZQMA 3CMAV 4J42A 3T1HB 2M7WA 1JJ2U 2QJ1A 4WCEV 4LNSA 4B3RB 1B6QA 2WLMA 2W6JG 2Q7GA 3SYCA 2ZR2A 5J2UB 3JAMN 5EK0A 2QKSA 2DE0X 1AI7A 2ODMA 4B7KA 3E83A 3IKMB 1VQ7V 4B3RO 1B8AA 2ZM6B 2R70A 2UUAB 4UVCA 3OTFA 4O2DA 5KUKA 4K0KB 2Y4TA 4KR2A 4KHPO 2DTOA 4DV5O 5GONB 2Q0OC 4U3FH 1R3KC 2BOBC 2KG7B 2PF4E 3DGEA 4O4LA 3G71V 2UXCB 4GYCB 5KHIA 3RKYA 1MZEA 4JAAA 4DR5O 3W3SA 1YVWA 2JGDB 5IDJA 4EFEA 1VARA 4D6TH 4JYBA 4WF9V 1BGYH 4AI8A 4AQYB 1IBMB 1XMOB 2UUBB 1N32O 1NYQA 3WU2Z 4PG3A 1D5AA 2ZE7A 1WU7A 2JS5A 3FB7C 1N36B 5GTHZ 3ZRWB 3JD2A 2CTWA 3KCYA 3CSXA 4H2WA 1AB3A 3JARA 2ITDC 2Q7HA 2YXYA 1K5QA 4UCTA 3O9OA 3HKBA 4LF9O 4P71A 5BXZA 4TT3G 4XTYA 4CBCA 2ZDIA 1PKXA 3TXQA 2MK3A 1M4UA 3CCUV 4DV1B 2D2CB 2D3OW 4HT4A 4DV4O 1QVGU 1V54C 1VQPV 3ZMTA 5CA1B 4EFBA 2ZZFA 3QNEA 3CRCA 1NJ6A 1BSMA 4YHHB 1G6UA 4P74A 2A9HA 1MA1A 1V55B 3L9DA 4DXWA 4IHJA 1R3JC 3WB2A 1M57C 1E24A 3ZN1A 2CH7A 4N23A 5BR8B 1JFFB 2FMLA 2DQ0A 5A9GA 4BIUA 1NJIW 4K35A 4FLXA 1IVSA 1MSWD 2DMXA 3HR0A 1U97A 1KECA 4BWAA 4DR3O 1NQTA 2DZCA 3ABMB 3RW0A 3A7RA 4AILC 2X6AA 1AR5A 5KAFZ 1EVKA 4E51A 1WA8A 3RYFB 3SPCA 2W0XA 2FKXA 2K9PA 4JI6O 4O4JB 1DGSA 5H2FZ 4I0XB 4DR2B 1W2BU 2Z3YA 5C53B 4XDLA 1L0LH 3HKCB 4YRLA 2DJVA 1SZTA 4YJ3A 2E65A 2IBZH 1EN6A 5CA3A 2HHHB 3K5LA 4ZIBA 4YRJA 1W59A 3JASA 5CBHA 1X01A 4YY3B 3RYCA 1JOYA 2AKWB 4JYAB 1WAZA 3C3TA 4OPAA 4I55B 3RFRA 2ZE6A 2NR5A 5IYCO 5J2TA 2YXLA 3FKSG 1SS3A 3DXRB 4DR6B 4F4LA 3OR6C 2JK5C 4GX0A 2EL9A 4FK5C 4H2XB 3E22A 4D7TA 1FXKC 4IL6Z 5BZBA 2Z5UA 1PNLA 1OCZB 3CJHB 3CXCU 2WLIB 2HHHO 2PMFA 1VQOV 2ZIMA 1KKCA 3V8JA 3FAVB 1QBZA 3OFNG 2OCCB 2C8MA 4JTDB 3WQZA 3CRAA 1I5YA 2IM9A 1FKAO 1K8AW 1YB3A 2ZNJA 2OTJV 4X1KB 4BAYA 4P9OA 2DKGA 3HKDA 4DR7B 1GK9A 4K88A 4JYYA 2NLJC 3AG3C 1R6NA 3LSUA 2DW4A 2EILB 2Q7EA 2BSKB 4WJ3M 4PV1B 4IYIA 1NVPB 4EX5A 3V8KA 4YCUA 3UCSC 2HR3A 5D5QA 2QM4A 4LBEC 1QHTA 2HNIA 2DEQA 1Y74B 4PA9A 2F43G 3VQXA 3K9SA 5IYDO 1YJNV 2AHYA 3BY6A 1EN5A 5LMNO 1Z7MA 2YI8A 2RHQB 3IFXA 1AILA 1E1RG 1BS3A 4GX1A 2XASA 4K8ZA 4IYHA 4DV0O 5DECA 4TV8B 4YCWA 5LHHA 5LMNB 1Y76A 1NH2D 1G51A 3UFGA 4O2BB 3M7MX 1M56B 4BIOA 2CTRA 2VS0A 4FZ1A 5KHKA 2I4MA 2QWRB 4H44B 2AMCA 1USYA 4XEMA 3CE2A 2OTLV 3IALA 4QE9A 1IBKO 4JI2B 2ADPA 1YXBA 2IH1C 1V9PA 1OCOC 2GSMB 3ZHTA 1PYSA 5DN6G 4YRMA 3E35A 4F6EA 3RBZA 2BTQA 3UKMA 4YCVA 3CC7V 4JI0O 3GB7C 4B3TO 3JAKA 3L2ZA 3D8CA 2G38A 1IXMA 1VQKV 1HTTA 2F1MA 3HPLC 1FXKB 2QWPB 4UCRA
chains in the Genus database with same CATH topology
1N9WA 3RYIA 5FPOA 2ZINA 4RDXA 2CJ9A 3PN1A 3HY1A 4LH7A 4XTWA 4YROA 5CB4A 1YFSA 1EOVA 1M5IA 4O4IB 3RGBA 1Z5WA 4HVCA 4KHPB 3A5YA 1WN7A 1KOGA 1X55A 2RHSA 1SKVA 3QTCA 2ZTGA 3LSQA 4XU1A 2DU5A 4FLUA 4DR1B 2RHQA 5IWAB 4X66B 4U3JA 3BA8A 1Q3EA 1VQZA 1B70B 1X4TA 4JI0B 3JSNA 3N2KA 3TEGA 1B7YA 4TV8A 4I4TA 2EAYA 3IG2A 5JCOC 5KX5B 1H4TA 3REXA 4LF6B 4BW9A 4O2BA 4O2AB 1XI1A 2F66C 3HFZB 4K86A 3SJAC 2PYJA 3THOA 4TVWA 2E1HA 5LOVB 2ZNIA 3HRKA 3RUXA 1BBUA 1WYDA 4RQEA 5C51B 1E1TA 2ALYA 2ARTA 3A32A 4EB6B 4YPFA 4K8XA 5ITZB 1XMQB 2IY5B 2E3CA 3E9HA 4P73C 5LXTB 2XTIA 2YI9A 4HNAB 5IYZA 5LMUB 1PYSB 4CH3A 4Q15A 4H02A 3QF7A 3VQWA 4O4HB 5EYPB 5FNVB 4TTVA 3MF2A 1FJGB 3L4GB 1Q8IA 5IJ9B 5EZYA 5KMGB 2PYLA 3NELA 1NJ8A 3K5OA 2QHTA 4PHZA 2CIMA 3N2GB 4DV0B 4RMFA 2P22C 4P72A 4YRSA 3JAKB 4P3OA 5LYJA 2ZT8A 3VBBA 2VWJA 2VWKA 3BAAA 1YFRA 5IJ0A 2F95B 2YIBA 3JALA 4UCSA 4YRGA 2ZZGA 1XHXA 1H4VB 3OD1A 3R07A 2VQFB 3ICXA 4YP0A 1J5WA 2ZIOA 5CB4B 4LVKA 3RKWA 5J2UA 4WJ4A 2E5LB 4LF9B 1HNWB 3KFUA 4P73A 2ODRD 4ZOLA 4DV5B 2I4LA 1QQCA 2JGUA 3FFQA 1ZAUA 4NXMB 3HXVA 2UXBB 1TAEA 4U3JB 3VQVA 3EFSA 1X54A 3UT5B 2VQEB 4TVAA 3V7CA 4UFZA 3A7UA 2C7IA 1C0AA 4DPGA 4L8JA 4I4TB 3PZCA 3OTOB 4LF4B 4P71C 1FFXB 1USYC 1WQ7A 2KKWA 4CH5A 2OYQA 4O2AA 4NXNB 3HFZA 5LOVA 1X56A 2ODRC 3RKXA 3RIRA 4HWSA 4LVLA 4O4LB 4DK1A 4H2UA 1HW7A 2ALYB 3E9IA 4HBNA 4DK0A 4EB6A 4P72C 1HC7A 5ITZA 2R9AA 3DSQA 4DV2B 1NJ5A 4YRNA 4DUYB 5KHGA 5LA6B 4YJ2A 2PTMA 5IYZB 2CGHA 1H4SA 4CS3A 1RSOA 2P5OA 1Z5VA 4FFBB 1ADJA 1SESA 5BMVA 1NT2B 3ERRA 1H4QA 2BTOA 2R72A 5C52B 5EYPA 5FNVA 4DV4B 4F6RA 4B3MB 2HEPA 1XQ8A 1LYLA 3L4GA 4YRTA 2DXTA 4P75A 5KMGA 3RF1A 1E22A 3T1HB 2UXDB 3N2GA 2PY5A 2E64A 2EX3A 1WPYA 4TOIA 3CMQA 1B76A 2QJ1A 3JSLA 4Q6GA 4TQDA 5IJ0B 4CH4A 4LNSA 2DTIA 3JALB 4B3RB 2ZT5A 4EEQA 3JARB 2Q7GA 4CC6A 4YRIA 4TWAA 2ZR2A 4GLXA 4JI8B 5J2UB 3HKBB 4X20B 1TA8A 3WB1A 2ARUA 3NEMA 3QO5A 4ZOLB 4YRQA 5KHHA 1QF6A 1WPBA 3IKMB 1BBWA 1B8AA 1EIYB 2ZM6B 1SRYA 2E41A 3PCOB 3UT5A 4TVAB 3CHXA 3LNNA 2PZSA 2R70A 3A2FA 2UUAB 3OTFA 4O2DA 4ZTUB 2J3LA 1FFXA 4GKJB 4K0KB 4KR2A 1O9GA 2DTOA 5GONB 4KQEA 4O4LA 1WNSA 3SGIA 3V7RA 4IHJB 2UXCB 4GYCB 5KHIA 4X1YA 3RKYA 3K58A 4XTUA 3W3SA 5FPRA 1JFFA 4YJ2B 5LA6A 4DV7B 1YGBA 2ZR3A 4LNUB 4CS4A 3QG5A 4EFEA 1I94B 4FFBA 3K57A 5BMVB 3WB0A 1T5EA 4L87A 1HNXB 1KMIZ 5KHJA 4FM0A 3RL6A 3MQZA 4F6RB 4AQYB 3TUPA 1IBMB 3HTZA 1XMOB 4P74C 2UUBB 4LVJA 4NVPA 4FLVA 1NYQA 1L0WA 4UCOA 1RIQA 3EFRA 1TUBA 4FVMA 4PI0A 4PG3A 1D5AA 3RYFA 4LF7B 4UCUA 1WU7A 2JS5A 4IIJA 4LFAB 3SJCC 1N36B 5EIBD 4B3SB 3L1AA 4KL1A 2Q5IA 2CAZC 4FLYA 4P3NA 3V8LA 3CSXA 4H2WA 3JARA 1NJ2A 2Q7HA 12ASA 3V7SA 4UCTA 3HKBA 4X20A 4DR4B 4P71A 5E3IA 4JI1B 2DJZA 4X65B 3ICAA 3HKCA 4XTYA 4PHCA 1M4UA 4P75C 4H2VA 4DV1B 4B08A 2EJ9A 1QE0A 3PCOA 1EIYA 4HT4A 1ASZA 1WLEA 4FLTA 2DVEA 2ZGWA 2DQ3A 5EIBC 3BRCA 3JATB 4EO4A 5CA1B 4CH6A 4EFBA 2ZZFA 4YRCA 4JI3B 2QHSA 3QNEA 1NJ6A 1SQGA 4YHHB 1G5IA 4WBNA 5GONA 4FM1A 4JI5B 1G6UA 4P74A 2ZXFA 2J3MA 1HXDA 4HWOA 4IHJA 2DTHA 1Q43A 2JVDA 2PMEA 3RWRD 3WB2A 1NNHA 2EJFA 3LC0A 4X1YB 2I4NA 1E24A 5BR8B 1JFFB 3U11A 4H2XA 4OP0A 2DQ0A 4LNUA 3SJBC 4DQ2A 4FLXA 1XNQB 4RQFA 4FLZA 1P49A 1N33B 4HWPA 2YIAA 3UQ8A 4BWAA 2DZCA 3QO8A 4JI4B 4XU3A 2EJGA 2Q5HA 2P0LA 3A7RA 1KU9A 4AILC 3A5ZA 1TUBB 1EVKA 4E51A 1IL2A 4LFBB 5C8YA 3RYFB 1BIAA 3B2EE 4IIJB 1E1OA 2RQ6A 3BABA 1G5HA 3IAYA 4O4JB 4OX9B 1JJCB 2DU7A 3UGQA 1DGSA 3SR2C 5JJEB 3HXWA 2XGTA 4DR2B 4DR5B 2PUSA 2DZ9A 4I50B 4DV6B 3JAWB 4UCVA 2FYKA 5C53B 3HKEA 4JI7B 5K1XA 3REUA 3HKCB 1SERA 4X5OA 4YRLA 4JV5B 3QO7A 4TQFA 4YJ3A 2E65A 1ADYA 1HNZB 2ZZEA 3NETA 2HHHB 1WQWA 3K5LA 4ZIBA 3MF1A 3A31A 4YRJA 4LH6A 3JASA 1EVLA 1X01A 5D5PA 4YY3B 3HXUA 3RYCA 3T1YB 1EFWA 3JATA 2AKWB 5CA1A 5JJJB 4JYAB 3RFRA 4I55B 1KMNA 3P8YA 3UH0A 4WBNB 4XTZA 1O9HA 2YXLA 5J2TA 4DR6B 4TUYA 1EQRA 1YFTA 4JI6B 3BFMA 4LFCB 3MEYA 4YREA 5CA0B 5JVDA 4B3TB 4AH6A 4UPAA 4X64B 1IBKB 2QHVA 2CJAA 2EL9A 4XTVA 1JMKC 1X2HA 4H2XB 3E22A 4D7TA 2ZCEA 3HXZA 4K87A 4ZI7A 4UP9A 3TEHA 1M93A 1SQFA 4H2TA 3RACA 4H2SA 2CJBA 1NYRA 4G85A 2F4VB 1SETA 1GGMA 11ASA 3NENA 4ZHQB 5JH7A 4LVMA 4XEOA 3U0ZA 2PMFA 4XU0A 1SA0B 1B04A 5C8YB 5K1PA 2ZIMA 2RJZA 1HR0B 3V8JA 2ZT7A 4X62B 4WF2A 4O4JA 1JJCA 2C8MA 3P8TA 3WQZA 4CC5A 4AHCA 3HXYA 5LP6A 2PGGA 4DRXA 4UP8A 2IM9A 5JCOA 3RYHA 5JQGB 2AMCB 4I50A 1VF7A 3BA9A 4FM2A 1YB3A 3BJUA 2ZNJA 3JAWA 4X1KB 1JJOA 3HKEB 4TVYA 1TVKB 5LP6C 3ZS8C 4FLWA 4X1IA 2DKGA 3BPZA 3HKDA 4DR7B 1BIBA 4TV9A 5JJNB 4YJ3B 4YRPA 2G4CA 3IKLA 1KMMA 2NS6A 4K88A 2BTQB 2XHBA 4LVIA 3FJPA 1X2GA 3JASB 4YRRA 4DR3B 1J5EB 2Q7EA 3RYCB 2UUCB 4J15A 2AKWA 4XU2A 4WJ3M 2I4OA 4I55A 3CB2A 4HWTA 2UU9B 2V4DA 2A8EA 4I9QA 2P5IA 3HXXA 4EX5A 3V8KA 4YCUA 5J2TB 5D5QA 4YRKA 4TUYB 1N34B 2QM4A 3RYIB 3ZEDA 1QHTA 2DDZA 5ELNA 3U10A 2HNIA 2DEQA 3A7AA 3I7FA 3HFVA 5JVDB 5CA0A 1H2SB 3VQXA 2Q0AA 4O4IA 3VQYA 5HGQA 1W66A 1I7FA 1ASYA 1IBLB 3E22B 4ZTZB 1Z7MA 4ZI7B 3TEHB 1Z7NA 2ARSA 2RHSB 2YI8A 2RHQB 2QHUA 4H2YA 1B70A 4WI1A 4YRFA 4K8ZA 4ZHQA 5JH7B 3N2KB 2F93B 1B7YB 3G1ZA 1SA0A 4TV8B 1FYFA 4YCWA 3P8VA 1TGOA 5LMNB 4P3PA 4YDQA 3K5MA 2E5AA 1G51A 5KX5A 3UFGA 4KR3A 4O2BB 1Q5OA 3M4QA 3M7MX 4DUZB 3HY0A 5KHKA 3LSSA 2I4MA 5LP6B 4XTXA 1XNRB 4DRXB 3RYHB 5JQGA 3K59A 1USYA 2AMCA 4XEMA 4OLFA 3IALA 2IY5A 4X1KA 3HRIA 3UGTA 1TVKA 4JI2B 3M4PA 4LF8B 5LXTA 4LR3A 1ATIA 1V9PA 4HNAA 4X1IB 2E10A 4NCXA 3HKDB 1WNLA 1PYSA 4TV9B 2GV9A 1YEWA 4GKKB 3K5NA 4YRMA 3MAQA 4O4HA 1L8DA 5ELOA 4HA8A 4YYEA 4CS2A 4DV3B 4LF5B 3A74A 4G84A 2BTQA 5IJ9A 1NJ1A 5EZYB 1N32B 4D7SA 4YCVA 2OWOA 4UP7A 3JAKA 3L2ZA 5LYJB 2EWNA 5KNNA 1XHZA 2ZT6A 1HTTA 2F1MA 2YIBD 5F5WA 3RGLA 1S5JA 4HWRA 3ETQA 4UCRA 2DXUA 4PI2A 3BHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9W A;  2ZIN A;  4RDX A;  2CJ9 A;  3HY1 A;  4XTW A;  4YRO A;  1YFS A;  1EOV A;  4HVC A;  3A5Y A;  1KOG A;  1X55 A;  2RHS A;  2ZTG A;  3QTC A;  3LSQ A;  4XU1 A;  2DU5 A;  2RHQ A;  1VQZ A;  1B70 B;  3TEG A;  1B7Y A;  2EAY A;  3IG2 A;  3REX A;  1H4T A;  4BW9 A;  3HFZ B;  4K86 A;  4TVW A;  2E1H A;  2ZNI A;  3HRK A;  3RUX A;  1BBU A;  1WYD A;  4RQE A;  5C51 B;  1E1T A;  2ALY A;  2ART A;  3A32 A;  4YPF A;  2IY5 B;  2E3C A;  3E9H A;  4P73 C;  2XTI A;  2YI9 A;  1PYS B;  4CH3 A;  4Q15 A;  4H02 A;  3VQW A;  4TTV A;  3MF2 A;  3L4G B;  3NEL A;  1NJ8 A;  2QHT A;  2CIM A;  4RMF A;  4P72 A;  4YRS A;  4P3O A;  2ZT8 A;  3VBB A;  1YFR A;  2YIB A;  4YRG A;  2ZZG A;  1H4V B;  3OD1 A;  3R07 A;  4YP0 A;  1J5W A;  2ZIO A;  3RKW A;  4WJ4 A;  3KFU A;  4P73 A;  2ODR D;  2I4L A;  3HXV A;  3VQV A;  3EFS A;  1X54 A;  4TVA A;  3V7C A;  3A7U A;  2C7I A;  1C0A A;  4DPG A;  3PZC A;  4P71 C;  1USY C;  1WQ7 A;  4CH5 A;  3HFZ A;  1X56 A;  3RKX A;  2ODR C;  3RIR A;  4HWS A;  4H2U A;  2ALY B;  3E9I A;  4P72 C;  1HC7 A;  1NJ5 A;  3DSQ A;  4YRN A;  2CGH A;  1H4S A;  4CS3 A;  1SES A;  3ERR A;  1ADJ A;  1H4Q A;  2R72 A;  5C52 B;  2HEP A;  3L4G A;  1LYL A;  4YRT A;  2DXT A;  4P75 A;  3RF1 A;  1E22 A;  2E64 A;  1WPY A;  3CMQ A;  1B76 A;  2QJ1 A;  4Q6G A;  4TQD A;  4CH4 A;  4LNS A;  2DTI A;  2ZT5 A;  2Q7G A;  4YRI A;  4TWA A;  2ZR2 A;  2ARU A;  3NEM A;  3QO5 A;  4YRQ A;  1QF6 A;  3IKM B;  1BBW A;  1B8A A;  1EIY B;  2E41 A;  1SRY A;  3PCO B;  4TVA B;  2R70 A;  4O2D A;  4ZTU B;  2J3L A;  4KR2 A;  1O9G A;  2DTO A;  4KQE A;  3V7R A;  3RKY A;  4XTU A;  3W3S A;  1YGB A;  2ZR3 A;  4CS4 A;  4L87 A;  3RL6 A;  3TUP A;  3HTZ A;  4P74 C;  1NYQ A;  1L0W A;  1RIQ A;  3EFR A;  4PG3 A;  1WU7 A;  3L1A A;  2Q5I A;  4P3N A;  3V8L A;  4H2W A;  1NJ2 A;  2Q7H A;  12AS A;  3V7S A;  5E3I A;  4P71 A;  2DJZ A;  3ICA A;  4XTY A;  4PHC A;  4P75 C;  4H2V A;  2EJ9 A;  1QE0 A;  3PCO A;  1EIY A;  1ASZ A;  1WLE A;  2DVE A;  2ZGW A;  2DQ3 A;  4EO4 A;  4CH6 A;  2ZZF A;  4YRC A;  2QHS A;  3QNE A;  1NJ6 A;  1G5I A;  1G6U A;  4P74 A;  2ZXF A;  2J3M A;  1HXD A;  4HWO A;  2DTH A;  2JVD A;  2PME A;  1NNH A;  2EJF A;  3LC0 A;  2I4N A;  1E24 A;  4H2X A;  4OP0 A;  2DQ0 A;  4DQ2 A;  4RQF A;  4HWP A;  2YIA A;  4BWA A;  2DZC A;  3QO8 A;  4XU3 A;  2EJG A;  2Q5H A;  2P0L A;  3A7R A;  3A5Z A;  1EVK A;  1IL2 A;  4E51 A;  1BIA A;  1E1O A;  2RQ6 A;  1G5H A;  1JJC B;  2DU7 A;  3UGQ A;  3HXW A;  2XGT A;  2PUS A;  2DZ9 A;  2FYK A;  5C53 B;  5K1X A;  3REU A;  1SER A;  4X5O A;  4YRL A;  3QO7 A;  4TQF A;  2E65 A;  1ADY A;  2ZZE A;  3NET A;  1WQW A;  4ZIB A;  3MF1 A;  3A31 A;  4YRJ A;  1EVL A;  1X01 A;  3HXU A;  1EFW A;  2AKW B;  1KMN A;  3P8Y A;  3UH0 A;  4XTZ A;  1O9H A;  1EQR A;  1YFT A;  3BFM A;  3MEY A;  4YRE A;  4AH6 A;  4UPA A;  2QHV A;  2CJA A;  2EL9 A;  4XTV A;  1X2H A;  4H2X B;  4K87 A;  2ZCE A;  3HXZ A;  4UP9 A;  3TEH A;  4H2T A;  3RAC A;  4H2S A;  2CJB A;  1NYR A;  4G85 A;  1SET A;  1GGM A;  11AS A;  3NEN A;  4XEO A;  4XU0 A;  2PMF A;  5K1P A;  2ZIM A;  2RJZ A;  3V8J A;  2ZT7 A;  4WF2 A;  1JJC A;  2C8M A;  3P8T A;  3WQZ A;  3HXY A;  2PGG A;  4UP8 A;  2AMC B;  1YB3 A;  3BJU A;  2ZNJ A;  4TVY A;  2DKG A;  1BIB A;  4YRP A;  2G4C A;  3IKL A;  1KMM A;  4K88 A;  3FJP A;  1X2G A;  4YRR A;  2Q7E A;  4J15 A;  2AKW A;  4XU2 A;  4WJ3 M;  2I4O A;  4HWT A;  2P5I A;  3HXX A;  4EX5 A;  3V8K A;  4YCU A;  4YRK A;  5ELN A;  3ZED A;  2DDZ A;  2HNI A;  2DEQ A;  3A7A A;  3I7F A;  3HFV A;  3VQX A;  3VQY A;  5HGQ A;  1W66 A;  1ASY A;  4ZTZ B;  1Z7M A;  3TEH B;  1Z7N A;  2ARS A;  2RHS B;  2YI8 A;  2RHQ B;  2QHU A;  4H2Y A;  1B70 A;  4WI1 A;  4YRF A;  1B7Y B;  3G1Z A;  1FYF A;  4YCW A;  3P8V A;  4P3P A;  4YDQ A;  2E5A A;  4KR3 A;  1G51 A;  3UFG A;  3M4Q A;  3HY0 A;  3LSS A;  2I4M A;  4XTX A;  2AMC A;  1USY A;  4XEM A;  4OLF A;  3IAL A;  2IY5 A;  3HRI A;  3UGT A;  3M4P A;  1ATI A;  2E10 A;  4NCX A;  1WNL A;  1PYS A;  4YRM A;  5ELO A;  4YYE A;  4HA8 A;  4CS2 A;  3A74 A;  4G84 A;  1NJ1 A;  4YCV A;  4UP7 A;  3L2Z A;  2EWN A;  5KNN A;  2ZT6 A;  1HTT A;  2YIB D;  5F5W A;  3RGL A;  4HWR A;  2DXU A;  3BHP A; 
#chains in the Genus database with same CATH topology
 2H94 A;  3LDE A;  1JPX A;  5FPO A;  2Y4U A;  2ZIN A;  2WLJ A;  1GM7 A;  2CJ9 A;  4YRO A;  1THZ A;  2IJK A;  2XND G;  1E1Q G;  4KHP B;  3A5Y A;  1WN7 A;  3M99 B;  3TK1 A;  2RHS A;  2ZTG A;  4XU1 A;  4DR1 B;  4X66 B;  2YSU B;  1X4T A;  1VQ9 V;  3N2K A;  3C90 A;  2P67 A;  1ZSP A;  3IG2 A;  5KX5 B;  3CRR A;  3PJS K;  5LOV B;  3HRK A;  1M56 C;  1N33 O;  1CPY A;  1E1T A;  4EB6 B;  4YPF A;  4K8X A;  2IY5 B;  1OCR C;  1R1B A;  1KP2 A;  5LXT B;  4W4K A;  2XTI A;  3ZMV A;  4JYA O;  4CH3 A;  3VQW A;  4Z2W A;  1FJG B;  3L4G B;  2CK3 G;  5JWP A;  4UV9 A;  3NEL A;  4R50 A;  3VBB A;  2VWJ A;  2YEV A;  2AXT Z;  2IJI A;  5BY1 A;  2L6L A;  1YFR A;  1I94 O;  2F95 B;  3SPG A;  2JDI G;  1I08 A;  1K5S A;  1XHX A;  2GUZ B;  3R07 A;  2VQF B;  3ICX A;  1NI8 A;  2ZIO A;  5IT9 N;  4OGQ B;  3STL C;  1AJN A;  2E5L B;  4P73 A;  2ODR D;  4ZOL A;  4DV5 B;  1QQC A;  4I7Z B;  3HXV A;  2ZXW C;  1TAE A;  4U3J B;  2KQX A;  3EFS A;  4TVA A;  1KYO F;  4K3A A;  3A7U A;  4FMT A;  2C7I A;  4L8J A;  4HYO A;  1FFX B;  4PDM A;  1WJZ A;  4KXR A;  2WLL A;  2KKW A;  4CH5 A;  2V7Q G;  3RIR A;  3GWK C;  1PL0 A;  1S0V A;  4P72 C;  4ZKI A;  3ASN B;  4DV2 B;  1NJ5 A;  4DUY B;  4R8C A;  4GZR B;  2EZO A;  1OCZ C;  3ERR A;  3ETE A;  3CC4 V;  1H4Q A;  1NT2 B;  2ZD9 A;  2YDE A;  3ZHS A;  4H13 B;  1VMG A;  4F6R A;  4YRT A;  1E22 A;  5LBQ A;  2UXD B;  3DC5 A;  2PY5 A;  2E64 A;  3IGA C;  4Q6G A;  1FFT B;  5IJ0 B;  4CH4 A;  4U7N A;  1AI6 A;  1Y67 A;  2DTI A;  3JAL B;  3VOU A;  2JIZ G;  3CCQ V;  3I55 V;  5B1A B;  4CC6 A;  3SJQ C;  4X64 O;  2BE3 A;  4GLX A;  1F51 A;  4LWS A;  2WLN A;  3APO A;  4X20 B;  3WB1 A;  3F5T A;  1BMF G;  4R6Z A;  3X2Q C;  3ZMS A;  2JEU A;  1RPR A;  3PCO B;  1SRY A;  1XMO O;  2ZKO A;  3LNN A;  1JR9 A;  4KUM A;  2JS3 A;  3A2F A;  3NR7 A;  2WAM A;  3G6E V;  2N05 A;  4LF8 O;  1S76 D;  1S5L Z;  2HJD A;  4DV7 O;  2UXD O;  2A79 B;  2XAJ A;  2Y48 A;  4R7C A;  5HFL A;  4KQE A;  1GN4 A;  4X1Y A;  4XTU A;  1VF5 B;  5FPR A;  2EIJ B;  5LA6 A;  3CCR V;  1YGB A;  1H2G A;  3QG5 A;  4FFB A;  1U96 A;  5BMV B;  3WB0 A;  1HNX B;  1KB9 F;  3RL6 A;  3EFF K;  1IDS A;  3HTZ A;  2NNU A;  4LVJ A;  2WPD G;  3TGU H;  2ZT9 B;  3C3S A;  3EFR A;  4FZ0 A;  1TUB A;  4FVM A;  1NH2 B;  1KKD A;  3BCC H;  2Q6A A;  4UCU A;  4IIJ A;  3SJC C;  4B3S B;  3OGC C;  4KL1 A;  2Q5I A;  4JYC A;  1NU1 H;  2CTP A;  2QGN A;  1H2L A;  1QU7 A;  2E5L O;  2ZE5 A;  3G80 A;  3JYC A;  3B8M A;  4X65 B;  3ICA A;  3TCU A;  4P75 C;  4MTO A;  1F4N A;  3SYQ A;  4B08 A;  2EJ9 A;  1QLN A;  3A8T A;  4H33 A;  1ASZ A;  1WLE A;  3LUT B;  4PJ0 Z;  4H0L B;  5EIB C;  1FYJ A;  2QWQ B;  4J41 A;  4JI3 B;  4G27 B;  4RO2 A;  5GON A;  4JI5 B;  2ZXF A;  4MVM A;  2DTH A;  1Q86 W;  4QPK A;  1Q43 A;  2JVD A;  1NNH A;  3DC6 A;  3ZX6 A;  1YTF D;  1VQL V;  1YJ9 V;  2JGD A;  1XMQ O;  2PI5 A;  3U11 A;  4K0K O;  4MVR A;  3SJB C;  1NR7 A;  2UU9 O;  4RQF A;  1N33 B;  4GX2 A;  4HWP A;  1V55 C;  3UQ8 A;  4NR1 A;  3OR7 C;  4JZ2 A;  4W4L A;  1GM8 A;  4JI4 B;  1OZ0 A;  2EJG A;  2NN4 A;  2Q5H A;  2LGW A;  3A5Z A;  1IL2 A;  3H1K H;  1BIA A;  1E1O A;  1G5H A;  3FB5 C;  1JJC B;  4OX9 B;  3ZRW A;  3UGQ A;  3SR2 C;  5JJE B;  2GDS A;  2YS8 A;  2PUS A;  4DV6 B;  3JAW B;  4UCV A;  3OW2 U;  3HKE A;  5KA6 A;  4JI7 B;  3REU A;  4JV5 B;  3QO7 A;  4X66 O;  4TQF A;  2UXX A;  4JPR A;  1ADY A;  4PA6 A;  2ZZE A;  1Y6X A;  2HLD G;  1H2N A;  1EVL A;  2O57 A;  1EFW A;  3T1Y B;  3AG2 B;  5CA1 A;  3H01 A;  1GO3 F;  4XTZ A;  1O9H A;  1EQR A;  4JI6 B;  2EJR A;  5JVD A;  4B3T B;  4AH6 A;  4X64 B;  3J7A U;  2CH7 B;  3WFV A;  1X2H A;  2ZCE A;  4ZI7 A;  3TEH A;  2Q67 A;  5FLX N;  1VEW A;  1M93 A;  2DYR B;  1F23 A;  4H2S A;  1NYR A;  1N4C A;  2VQE O;  1YTF B;  3JD3 A;  3NEN A;  4ZHQ B;  5JH7 A;  4LVM A;  3FB8 C;  5F2V O;  1SA0 B;  2ZE8 A;  3T1C A;  2X0L A;  1GN2 A;  1FPO A;  2WLK A;  1QNM A;  2Y69 B;  1ZLZ A;  1Q6H A;  4WF2 A;  4O4J A;  3P8T A;  3APQ A;  4AHC A;  5LP6 A;  4I0X A;  4DRX A;  2XT9 A;  3RYH A;  1VF7 A;  3BA9 A;  4MVS A;  1XDC A;  2EIM B;  5HFM A;  4X1I A;  3D36 A;  3BPZ A;  1BIB A;  4TV9 A;  4YJ3 B;  4YRP A;  1CXZ B;  1FXV A;  2G4C A;  5KA5 A;  5L3G A;  2X6C A;  3JAS B;  3CCE V;  5EC1 C;  3RYC B;  2EIK B;  1K34 A;  2AKW A;  4XU2 A;  4I55 A;  3CB2 A;  2OIE A;  2P5I A;  5J2T B;  3DXR A;  2DDZ A;  3U10 A;  4JAV A;  3HFV A;  4PDV A;  2BOC C;  2Q0A A;  4O4I A;  2OT5 A;  1NZ6 A;  3VQY A;  5HGQ A;  2CE4 A;  3E22 B;  1YSC A;  5B3S C;  3P32 A;  4DR7 O;  1SC5 B;  3JD1 A;  1EZV H;  4H2Y A;  4A5U B;  1B70 A;  4WI1 A;  3CJH A;  4YRF A;  2IJH A;  1L1F A;  1HWY A;  1FYF A;  3P8V A;  1TGO A;  4P3P A;  3K5M A;  1XL6 A;  3FAV A;  3M4Q A;  5B1N A;  4X65 O;  1DF5 A;  2IJJ A;  4UUJ C;  2OIG A;  4U7O A;  5DM6 V;  4XTX A;  1SF9 A;  2A06 H;  2HFE C;  1SQB H;  2EIJ C;  3ETG A;  4NTY A;  1M57 B;  4X1K A;  3HRI A;  1MOF A;  2RMK B;  3F7V C;  1ATI A;  4GT1 A;  3HKD B;  1WNL A;  2GV9 A;  1YEW A;  4GKK B;  2WSS G;  3K5N A;  4DR6 O;  2ZM6 O;  1L8D A;  5ELO A;  4YYE A;  5IJ9 A;  5EZY B;  2LGQ A;  2QR4 A;  1BHB A;  2OWO A;  2BSK A;  5LYJ B;  1UPG A;  2EWN A;  3SDL A;  2ZT6 A;  4WFF A;  3RGL A;  1XNQ O;  5F5W A;  3ZJZ A;  1S5J A;  2ITC C;  3B40 A;  4HWR A;  3ETQ A;  2VRZ A;  5LHI A;  2CGO A;  4JGS A;  5H9C A;  3X2Q B;  3AG1 C;  5CB4 A;  1EOV A;  1M5I A;  1QLE B;  1Z5W A;  3OGI B;  1RM1 B;  4HVC A;  3G67 A;  1KUQ A;  1KOG A;  1SKV A;  2DU5 A;  2RHQ A;  5IWA B;  2DWD C;  3BA8 A;  3K9A A;  1Q3E A;  2QM7 A;  2JRI A;  1VQZ A;  3K0G A;  4NTX A;  1ARO P;  1YZB A;  3TEG A;  1VP7 A;  3P3N A;  4TV8 A;  4I4T A;  2EAY A;  2H3O A;  4X89 A;  1Y76 B;  1H4T A;  4O2B A;  1Q6U A;  1XI1 A;  1YIJ V;  3SJA C;  1IUR A;  2E1H A;  2ZNI A;  4H37 A;  2OCC C;  1BBU A;  1CP9 A;  4RQE A;  1WYD A;  2QWN B;  3A32 A;  3SPH A;  3Q4H A;  3E9H A;  4P73 C;  3MHS C;  1QLE C;  1YI2 V;  1DF4 A;  4FJC C;  5IYZ A;  5LMU B;  1PYS B;  4N21 A;  2DWE C;  1S72 V;  1G8M A;  4Q15 A;  4LCU C;  4TTV A;  2UXB O;  1Q8I A;  3WG7 C;  3N2G B;  4DV0 B;  4RMF A;  3T2M A;  4YRS A;  3JAK B;  2ZT8 A;  1HNX O;  1FXK A;  1PNK A;  2YIB A;  3L70 H;  5A2Q N;  1OCC B;  3P30 A;  1H4V B;  3CD6 V;  4QGP A;  1R6K A;  2JGU A;  1ZAU A;  2F23 A;  4JI4 O;  5E1A C;  1ZX3 A;  1X54 A;  2WLH A;  4FFK A;  4HZ3 A;  3UT5 B;  3V7C A;  4UFZ A;  3CME V;  3ZBH A;  1Y4M A;  3PZC A;  3K0D A;  3D3Q A;  1USY C;  1MNG A;  1KD1 W;  1WQ7 A;  2P6J A;  5LOV A;  3RKX A;  2ODR C;  4LVL A;  1GM9 A;  2Y69 C;  4LFC O;  4DK1 A;  1HW7 A;  4PA7 A;  4WFG A;  4EB6 A;  1NTK H;  2R9A A;  1IZ3 A;  3DSQ A;  1NTZ H;  2GBO A;  4MT8 A;  2IU0 A;  4NYK A;  5KHG A;  4JI3 O;  4EKW A;  2AW9 A;  4YJ2 A;  2RDC A;  1H4S A;  1SES A;  1Z5V A;  3UM7 A;  2R72 A;  2LFR A;  3D36 C;  5IWA O;  1EZJ A;  2HEP A;  3L4G A;  1LYL A;  2CTQ A;  2ETN A;  5L3B A;  1D2D A;  5KLV H;  1TUE B;  1Q82 W;  2EX3 A;  1WPY A;  4TOI A;  1SQV H;  2ADQ B;  2YEV B;  3JSL A;  4TQD A;  4RUE A;  3OMA B;  3CX5 F;  3L73 H;  4UVA A;  2P06 A;  4YIO A;  4RUF A;  3ZRX A;  5CMU A;  3EHB B;  2LO1 A;  1WB7 A;  1V54 B;  1H38 A;  4B7E A;  3QO5 A;  2IW5 A;  4ZOL B;  4YRQ A;  1GKF A;  3KG2 A;  1WPB A;  1BBW A;  1EIY B;  2E41 A;  1SQP H;  4TVA B;  3CHX A;  3RVY A;  2PZS A;  1GTO A;  1PD3 A;  3OMI B;  3JD4 A;  1SQX H;  1FFX A;  4GKJ B;  2WLL B;  3ASN C;  1O9G A;  2FL4 A;  1BZK A;  1XL4 A;  2CDY A;  3ASO C;  4X88 A;  1KC8 W;  3K58 A;  2EZP A;  3T1H O;  4UB6 Z;  3TJT A;  1KP3 A;  1JQ0 A;  1I0H A;  2ZR3 A;  4DV7 B;  4LNU B;  4CS4 A;  1I94 B;  3K57 A;  1T5E A;  4L87 A;  1H2M A;  1KMI Z;  2Y0I A;  5KHJ A;  4FM0 A;  3K04 A;  2R9I A;  3UO3 A;  3MQZ A;  3N27 A;  4F6R B;  3TUP A;  4P74 C;  1N0J A;  4J10 A;  4NVP A;  1L0W A;  1P84 F;  3AG2 C;  4LF7 B;  1AVM A;  4KP4 A;  1NTM H;  4XBF A;  4LFA B;  3CEI A;  1AJQ A;  3L1A A;  1P4R A;  3S3W A;  2YC0 A;  4P3N A;  4FLY A;  4P9P A;  3V8L A;  1BCC H;  1L0N H;  3K79 A;  12AS A;  3V7S A;  1XNR O;  1WP8 A;  4QPJ A;  4LWS B;  3MHH C;  4X20 A;  5E3I A;  4JI1 B;  2DJZ A;  4DYL A;  4PHC A;  1AI4 A;  1QE0 A;  3PCO A;  4JZG A;  4J7Z A;  2DVE A;  1YIT V;  2ZGW A;  2FB5 A;  4J9Y B;  3BRC A;  3JAT B;  2HG5 C;  3MD0 A;  1SQG A;  3W7T A;  4WBN A;  4FM1 A;  4FPP A;  4ABM A;  1IX9 A;  1R6T A;  4LC1 A;  2QKC A;  2EJF A;  3LC0 A;  4X1Y B;  2I4N A;  2IU3 A;  3CYO A;  1N36 O;  1P49 A;  2E76 B;  2P4V A;  4PD4 F;  1ORQ C;  3J80 N;  3QO8 A;  2XAQ A;  2Q4P A;  2CUG A;  2P0L A;  1KU9 A;  1TUB B;  1ZL8 B;  4LFB B;  5C8Y A;  3AK3 A;  1HNW O;  4IIJ B;  4WFE A;  1OHH G;  3CCV V;  2DN9 A;  4MTF A;  4UV8 A;  4C7U A;  3CCJ V;  3AK2 A;  2DU7 A;  2QKA A;  1J95 A;  3F5W C;  4DR5 B;  2DZ9 A;  4I50 B;  5B1O A;  2FYK A;  1XOU A;  2EIN B;  5K1X A;  2DYS B;  5J9P C;  1SER A;  1CEZ A;  3W7W A;  4J80 A;  3ZMZ A;  1P7B A;  3OM3 B;  1PP9 H;  1R73 A;  3JD0 A;  3D3I A;  1VQ6 V;  3A31 A;  4LH6 A;  4XDJ A;  5D5P A;  3HB3 B;  4JI7 O;  4UB8 Z;  1BQ0 A;  1GRJ A;  3P8Y A;  3TXS A;  4DUY O;  3UH0 A;  2WA4 A;  4TUY A;  2XTA A;  1YFT A;  3BFM A;  4YRE A;  5CA0 B;  1EN4 A;  2M6Y A;  4UPA A;  2OCH A;  5LHG A;  2QHV A;  2EIN C;  4XTV A;  1MSD A;  3SPI A;  4K87 A;  3HXZ A;  4UP9 A;  1VQM V;  1SQF A;  2GHY A;  3E8B A;  4GKK O;  4H2T A;  3RAC A;  1ENV A;  4G85 A;  2F4V B;  4J7K A;  1BL8 A;  4XEO A;  4LP8 A;  3U0Z A;  5K1P A;  3SYO A;  1HR0 B;  1H2K A;  4BW5 A;  3W7X A;  5C93 A;  3RN4 A;  2DYR C;  1JJC A;  1BQZ A;  4DUZ O;  4CC5 A;  4E4E A;  2MW2 B;  2VQF O;  1K33 A;  2PGG A;  4UP8 A;  5JQG B;  5JCO A;  3K08 A;  2QTO A;  3BJU A;  3JAW A;  5IY5 C;  4GX5 A;  2HJF C;  1SZX A;  1JJO A;  3HKE B;  1TVK B;  2QDO A;  1WP7 A;  2Q9L A;  5LP6 C;  3ZS8 C;  3IKL A;  1KMM A;  2NS6 A;  1N34 O;  5GW7 A;  3A0B Z;  4MVO A;  4DV3 O;  1HP8 A;  1VQN V;  4YRR A;  4DR3 B;  1J5E B;  4PA4 A;  5H6R A;  4I9W A;  1BT8 A;  2B1I A;  4HWT A;  1A32 A;  3AG1 B;  2A8E A;  3HXX A;  4P2Z A;  3RYI B;  5ELN A;  3ZED A;  5KUM A;  1AI5 A;  3A7A A;  3ZRS A;  3FB6 C;  3I7F A;  1GAX A;  5JVD B;  1W0J G;  1H2S B;  1K97 A;  3T4D A;  1W66 A;  1DK1 A;  2RCV A;  1IBL B;  3AG4 C;  4ZTZ B;  4ZI7 B;  3TEH B;  1Z7N A;  2AGA A;  4MW3 A;  2QEX V;  1WB8 A;  4TSF G;  3G6B A;  1KBH A;  2QHU A;  1EFR G;  1PM9 A;  4ZHQ A;  5JH7 B;  2F93 B;  1YJW V;  2EIL C;  1B7Y B;  1SA0 A;  1DTO A;  3G1Z A;  2HP8 A;  1LUW A;  1Q5O A;  1XUQ A;  3LNM B;  5KAI Z;  3LDD A;  4HAM A;  5LP6 B;  1XNR B;  4DRX B;  3RYH B;  1URF A;  4MS2 A;  3CPW U;  3RT3 C;  3M4P A;  1MZF A;  4LF8 B;  4HNA A;  4X1I B;  4Z1M G;  3ASO B;  4TV9 B;  1Q7Y W;  4O4H A;  2B9Z A;  2HVJ C;  4HA8 A;  1H8H G;  4CS2 A;  4DV3 B;  4LF5 B;  3A74 A;  5H6Q A;  4G84 A;  2A0L A;  1N32 B;  1G4Y B;  1VF6 C;  3CRM A;  3OT7 A;  3CCL V;  5KNN A;  1AP5 A;  2YIB D;  4BR6 A;  1D5N A;  4RDX A;  2UXC O;  3HY1 A;  3PN1 A;  4LH7 A;  1NS1 A;  1YFS A;  5FL7 G;  3I5D A;  4O4I B;  5B1B B;  1EM1 A;  1OCR B;  3RGB A;  4JTA B;  2P90 A;  1M9N A;  3ABM C;  1HNZ O;  3QTC A;  3LSQ A;  4FLU A;  1K7D A;  2F4V O;  3J81 N;  1B70 B;  3E8F A;  1COW G;  2EIM C;  1IXB A;  4NKG B;  4E2L A;  3REX A;  3L75 H;  3H1H H;  3A0H Z;  4GUN A;  4O2A B;  3HFZ B;  4TVW A;  1OJH A;  3THO A;  2AHZ A;  4IT5 A;  3RUX A;  2ALY A;  1NKD A;  4NB5 A;  5ITZ B;  1XMQ B;  3TET A;  3B09 A;  5B1B C;  3OTO O;  2YI9 A;  5LL6 Y;  4LFA O;  1RSO B;  4H02 A;  1ZUQ A;  3QF7 A;  5EYP B;  5FNV B;  4KFM A;  3CC2 V;  1MG1 A;  1YF2 A;  3ZHQ A;  5IJ9 B;  4X9Q A;  5EZY A;  5KMG B;  2PYL A;  1OV9 A;  1NJ8 A;  3K5O A;  2CIM A;  1LR1 A;  2P22 C;  4MSW C;  4P72 A;  5LYJ A;  3IC9 A;  1I5X A;  2LW1 A;  2VWK A;  3BAA A;  4JI5 O;  1NVP D;  1FS0 G;  4UCS A;  4YRG A;  1QVF U;  4DR2 O;  3OD1 A;  3SYP A;  4YP0 A;  5CB4 B;  2IH3 C;  1M1K W;  1OCO B;  5J2U A;  3RKW A;  3EXA A;  4WJ4 A;  4DR4 O;  1HNW B;  3KFU A;  2I4L A;  1HR0 O;  4NXN O;  4NXM B;  3VQV A;  2K1E A;  3T4Z A;  2UUA O;  2UUC O;  2KSD A;  4DPG A;  5IY5 B;  4I4T B;  4JAS A;  3OTO B;  4P71 C;  1VF6 A;  2XAH A;  4MTX A;  3E89 A;  3KZI Z;  2Q73 A;  3OEE G;  1X56 A;  3R66 A;  4QE7 A;  2KG7 A;  4O4L B;  3E9I A;  3Q4H B;  5LGU A;  1HC7 A;  3AG4 B;  2N74 A;  4DO2 A;  1GH6 A;  2PTM A;  5IYZ B;  4CS3 A;  4PDR A;  1ADJ A;  3CXH F;  5C52 B;  4DV4 B;  4B3M B;  1XQ8 A;  2DXT A;  4P75 A;  3RF1 A;  2B1G A;  2LQT A;  2CGN A;  4WFA V;  1EBO A;  3N2G A;  5EBL C;  1BE3 H;  3CMQ A;  3L72 H;  1S3J A;  1B76 A;  1H8E G;  3E2E A;  2ZXW B;  3ZHR A;  1FXH A;  2ZT5 A;  5H5N A;  2C2A A;  4EEQ A;  3JAR B;  4YRI A;  4TWA A;  4JI8 B;  1P7G A;  3HKB B;  2A3Q A;  1TA8 A;  2PI4 A;  2ARU A;  3NEM A;  5KHH A;  4LF6 O;  4Q20 A;  4Z1V A;  1QF6 A;  4LF5 O;  3S3X A;  1RFY A;  1SQQ H;  3UT5 A;  2XAF A;  3T1Y O;  3AG7 A;  3K06 A;  1LUV A;  4JI8 O;  1R3L C;  4ZTU B;  2J3L A;  2V1D A;  1JX9 A;  1Q81 W;  1B3Q A;  4B3M O;  3FYI B;  3QVN A;  1WNS A;  3SGI A;  3V7R A;  1RPO A;  4IHJ B;  2H8P C;  3BEH A;  3G4S V;  4DV6 O;  1VQ5 V;  1JFF A;  4YJ2 B;  4OX9 O;  1JVM A;  1K73 W;  1GN3 A;  2B5U A;  3SYA A;  3OMN B;  4GCZ A;  2GTA A;  4FLV A;  1QCE A;  2EUL A;  4UCO A;  1HDJ A;  1RIQ A;  1IBL O;  1VIB A;  1WA8 B;  4PI0 A;  3RYF A;  1PL4 A;  5EIB D;  2E74 B;  5B5E Z;  1NR1 A;  2CAZ C;  4ZBM A;  2Y0P A;  3ABL B;  3R65 A;  1NJ2 A;  1ROP A;  1F4M A;  2LP7 A;  4DR4 B;  5EBM C;  3P3P A;  1F7Y A;  3HKC A;  2A7W A;  2P7T C;  4DW0 A;  2XAG A;  3CRQ A;  1GN6 A;  4G28 B;  4H2V A;  4OPH A;  5L3E A;  1EIY A;  2UUB O;  2ATK C;  3OUF A;  2QM8 A;  4AQY O;  4FLT A;  2DQ3 A;  2X6B A;  5E79 Z;  4EO4 A;  4CH6 A;  3KCX A;  4YRC A;  3JCZ A;  2QHS A;  1E79 G;  4ICG A;  2LJ2 A;  1G5I A;  2JEX A;  3UO2 A;  1FJG O;  5IE9 A;  1PNM A;  3OAA G;  3FX7 A;  2AZ0 A;  1HXD A;  2J3M A;  4HWO A;  4QJF B;  3E86 A;  2PME A;  3RWR D;  4H2X A;  1OCC C;  4OP0 A;  2RNB A;  4GKJ O;  4LNU A;  4DQ2 A;  3ZRV A;  1XNQ B;  4FLZ A;  1NBM G;  4G2K A;  4B3S O;  1N0N A;  3SPJ A;  2YIA A;  1K92 A;  5LGT A;  3CS5 A;  2GTS A;  3ML0 A;  3CP1 A;  4XU3 A;  2WLI A;  3RVZ A;  5TIS Z;  3B4S A;  2WWW A;  1XBL A;  3B2E E;  2RQ6 A;  3BAB A;  3IAY A;  5EBW C;  3ZIA G;  1QR8 A;  4RAI A;  3BVO A;  3HXW A;  2XGT A;  1AR1 B;  3MDS A;  2Q69 A;  2QSA A;  1YCI A;  4X5O A;  4X62 O;  1JCH A;  1Z2G A;  2HVK C;  1HNZ B;  1FAF A;  3B8N A;  1K4D C;  3O65 A;  3NET A;  1WQW A;  4UXN A;  4XDK A;  1VQ4 V;  3MF1 A;  3HXU A;  3STZ C;  3JAT A;  5JJJ B;  4QIW F;  3AG3 B;  1KMN A;  2QE7 G;  4YXW G;  3NXS A;  4WBN B;  4PDL A;  2AZ2 A;  1GMG A;  4LFC B;  1Y74 A;  3MEY A;  1XIL A;  2ZDI C;  3H1I H;  1IBK B;  4JI2 O;  2CJA A;  1JMK C;  1AR4 A;  1W0K G;  1AJP A;  1Q6I A;  1UFI A;  2CJB A;  5CBG A;  3FYE B;  1SET A;  1GGM A;  11AS A;  4XU0 A;  1ZL8 A;  1B04 A;  5C8Y B;  2RJZ A;  3E8G A;  2ZT7 A;  4X62 B;  4PA3 A;  4JV5 O;  2Z0A A;  5L3D A;  5L3F A;  2LFS A;  3HXY A;  2HKO A;  2XUM A;  2ARH A;  3IJ4 A;  2AMC B;  1G1X B;  5L3C A;  3ZHU A;  4I50 A;  4DV2 O;  3OUS A;  4FM2 A;  3H9V A;  4MVZ A;  3EVK A;  4TVY A;  1PV0 A;  4FLW A;  1ZWI C;  4JF3 A;  5JJN B;  2EJ7 A;  2BTQ B;  2RN9 A;  2XHB A;  3FJP A;  4LVI A;  1X2G A;  5DED A;  5EC2 C;  2UUC B;  1Q90 D;  4J15 A;  1AP6 A;  4BIZ A;  5LMU O;  2I4O A;  1RP3 B;  4MW8 A;  4WFB V;  2UU9 B;  2V4D A;  4I9Q A;  5CN0 A;  4NXM O;  1S77 D;  3OE7 G;  3CCM V;  4YRK A;  4TUY B;  1N34 B;  4J9Z B;  3FD9 A;  5CA0 A;  2DYS C;  4LF7 O;  1J5E O;  1S5H C;  3IC7 A;  1KQS U;  1I7F A;  1ASY A;  2WA3 A;  2ARS A;  3CCS V;  2RHS B;  4J7J A;  3ABL C;  4RWU A;  1IBM O;  2YXH A;  4PEL A;  5LGN A;  3ZCC A;  2EIK C;  3N2K B;  2LW7 A;  3ABK B;  2XOK G;  4YDQ A;  2E5A A;  4KR3 A;  5KX5 A;  3K3W A;  4TWK A;  4DUZ B;  2R9R B;  3HY0 A;  2JJ1 G;  3KKY A;  3LSS A;  1BHA A;  3H1L H;  1LNQ A;  2P4K A;  1QR9 A;  5JQG A;  3K59 A;  4OLF A;  3B77 A;  4MVU A;  2IY5 A;  3UGT A;  2QWO B;  1TVK A;  4QNH B;  1XEQ A;  5LXT A;  4LR3 A;  2Q8V A;  2E10 A;  4NCX A;  5CBF A;  1X59 A;  3ZMU A;  3A0R A;  3MAQ A;  1NJ1 A;  1YHQ V;  4NTW A;  1WPX A;  4D7S A;  3ABU A;  1DLB A;  4UP7 A;  1ZTE A;  1XHZ A;  3WG7 B;  2QTS A;  4DR1 O;  3E8H A;  2DOS A;  2DXU A;  4PI2 A;  3BHP A;  1N9W A;  3RYI A;  1VQ8 V;  2GUZ A;  3DTU B;  4XTW A;  2BCC H;  4YY3 O;  2ILM A;  2YID A;  3OEH G;  5B1A C;  1X55 A;  1N8R W;  4U3J A;  4WFH A;  4P30 A;  1M90 W;  4JI0 B;  3JSN A;  3LDC A;  3W7U A;  1B7Y A;  1Y66 A;  3H1J H;  4LFB O;  4MTG A;  1US6 A;  5JCO C;  4LF6 B;  4BW9 A;  1FD9 A;  2F66 C;  4K86 A;  4MVQ A;  2PYJ A;  4J11 A;  2QA4 V;  4IGG A;  3AEI A;  5C51 B;  2ART A;  2E75 B;  2L35 A;  1B06 A;  2E3C A;  1RM1 C;  5BR8 O;  3OD4 A;  1K4C C;  4LF4 O;  2W0F C;  4HNA B;  4X8A A;  4DW1 A;  4O4H B;  3MF2 A;  1YDX A;  5IYB O;  3GVM A;  2Q68 A;  2QHT A;  4PHZ A;  4CZZ A;  4P3O A;  3ZN0 A;  3BFR A;  3L71 H;  5IJ0 A;  2FYU H;  3JAL A;  4YHH O;  2ZZG A;  2UXN A;  4FIP C;  3CWB H;  3L74 H;  2EBO A;  1R3I C;  3M8A A;  1J5W A;  4LVK A;  3ZHV A;  4JI1 O;  3ABT A;  4LF9 B;  4I5S A;  4JTC B;  3FFQ A;  4DV1 O;  1PPJ H;  2UXB B;  3F7Y C;  1MMM A;  2X7R B;  2VQE B;  5B66 Z;  1C0A A;  1JA8 A;  4LF4 B;  3ABK C;  1XRE A;  5AG2 A;  4O2A A;  2OYQ A;  4NXN B;  2W6I G;  3HFZ A;  2YIC A;  3GWO A;  3JCU Z;  3K03 A;  4JAU A;  5GTI Z;  4HWS A;  4H2U A;  2ALY B;  2N04 A;  4HBN A;  4DK0 A;  5ITZ A;  1K9M W;  4ASU G;  5B3S B;  4YRN A;  1UJW B;  3W7S A;  4OXS A;  4YIP A;  1K3E A;  2JJ2 G;  5LA6 B;  2CGH A;  2P5O A;  1RSO A;  4FFB B;  3ETD A;  5BMV A;  4UVB A;  2BTO A;  2YUA A;  3AK1 A;  5EYP A;  5FNV A;  3I56 V;  2Q5Z A;  2FTK A;  2KB1 A;  1MAB G;  5KMG A;  2ZQM A;  3CMA V;  4J42 A;  3T1H B;  2M7W A;  1JJ2 U;  2QJ1 A;  4WCE V;  4LNS A;  4B3R B;  1B6Q A;  2WLM A;  2W6J G;  2Q7G A;  3SYC A;  2ZR2 A;  5J2U B;  3JAM N;  5EK0 A;  2QKS A;  2DE0 X;  1AI7 A;  2ODM A;  4B7K A;  3E83 A;  3IKM B;  1VQ7 V;  4B3R O;  1B8A A;  2ZM6 B;  2R70 A;  2UUA B;  4UVC A;  3OTF A;  4O2D A;  5KUK A;  4K0K B;  2Y4T A;  4KR2 A;  4KHP O;  2DTO A;  4DV5 O;  5GON B;  2Q0O C;  4U3F H;  1R3K C;  2BOB C;  2KG7 B;  2PF4 E;  3DGE A;  4O4L A;  3G71 V;  2UXC B;  4GYC B;  5KHI A;  3RKY A;  1MZE A;  4JAA A;  4DR5 O;  3W3S A;  1YVW A;  2JGD B;  5IDJ A;  4EFE A;  1VAR A;  4D6T H;  4JYB A;  4WF9 V;  1BGY H;  4AI8 A;  4AQY B;  1IBM B;  1XMO B;  2UUB B;  1N32 O;  1NYQ A;  3WU2 Z;  4PG3 A;  1D5A A;  2ZE7 A;  1WU7 A;  2JS5 A;  3FB7 C;  1N36 B;  5GTH Z;  3ZRW B;  3JD2 A;  2CTW A;  3KCY A;  3CSX A;  4H2W A;  1AB3 A;  3JAR A;  2ITD C;  2Q7H A;  2YXY A;  1K5Q A;  4UCT A;  3O9O A;  3HKB A;  4LF9 O;  4P71 A;  5BXZ A;  4TT3 G;  4XTY A;  4CBC A;  2ZDI A;  1PKX A;  3TXQ A;  2MK3 A;  1M4U A;  3CCU V;  4DV1 B;  2D2C B;  2D3O W;  4HT4 A;  4DV4 O;  1QVG U;  1V54 C;  1VQP V;  3ZMT A;  5CA1 B;  4EFB A;  2ZZF A;  3QNE A;  3CRC A;  1NJ6 A;  1BSM A;  4YHH B;  1G6U A;  4P74 A;  2A9H A;  1MA1 A;  1V55 B;  3L9D A;  4DXW A;  4IHJ A;  1R3J C;  3WB2 A;  1M57 C;  1E24 A;  3ZN1 A;  2CH7 A;  4N23 A;  5BR8 B;  1JFF B;  2FML A;  2DQ0 A;  5A9G A;  4BIU A;  1NJI W;  4K35 A;  4FLX A;  1IVS A;  1MSW D;  2DMX A;  3HR0 A;  1U97 A;  1KEC A;  4BWA A;  4DR3 O;  1NQT A;  2DZC A;  3ABM B;  3RW0 A;  3A7R A;  4AIL C;  2X6A A;  1AR5 A;  5KAF Z;  1EVK A;  4E51 A;  1WA8 A;  3RYF B;  3SPC A;  2W0X A;  2FKX A;  2K9P A;  4JI6 O;  4O4J B;  1DGS A;  5H2F Z;  4I0X B;  4DR2 B;  1W2B U;  2Z3Y A;  5C53 B;  4XDL A;  1L0L H;  3HKC B;  4YRL A;  2DJV A;  1SZT A;  4YJ3 A;  2E65 A;  2IBZ H;  1EN6 A;  5CA3 A;  2HHH B;  3K5L A;  4ZIB A;  4YRJ A;  1W59 A;  3JAS A;  5CBH A;  1X01 A;  4YY3 B;  3RYC A;  1JOY A;  2AKW B;  4JYA B;  1WAZ A;  3C3T A;  4OPA A;  4I55 B;  3RFR A;  2ZE6 A;  2NR5 A;  5IYC O;  5J2T A;  2YXL A;  3FKS G;  1SS3 A;  3DXR B;  4DR6 B;  4F4L A;  3OR6 C;  2JK5 C;  4GX0 A;  2EL9 A;  4FK5 C;  4H2X B;  3E22 A;  4D7T A;  1FXK C;  4IL6 Z;  5BZB A;  2Z5U A;  1PNL A;  1OCZ B;  3CJH B;  3CXC U;  2WLI B;  2HHH O;  2PMF A;  1VQO V;  2ZIM A;  1KKC A;  3V8J A;  3FAV B;  1QBZ A;  3OFN G;  2OCC B;  2C8M A;  4JTD B;  3WQZ A;  3CRA A;  1I5Y A;  2IM9 A;  1FKA O;  1K8A W;  1YB3 A;  2ZNJ A;  2OTJ V;  4X1K B;  4BAY A;  4P9O A;  2DKG A;  3HKD A;  4DR7 B;  1GK9 A;  4K88 A;  4JYY A;  2NLJ C;  3AG3 C;  1R6N A;  3LSU A;  2DW4 A;  2EIL B;  2Q7E A;  2BSK B;  4WJ3 M;  4PV1 B;  4IYI A;  1NVP B;  4EX5 A;  3V8K A;  4YCU A;  3UCS C;  2HR3 A;  5D5Q A;  2QM4 A;  4LBE C;  1QHT A;  2HNI A;  2DEQ A;  1Y74 B;  4PA9 A;  2F43 G;  3VQX A;  3K9S A;  5IYD O;  1YJN V;  2AHY A;  3BY6 A;  1EN5 A;  5LMN O;  1Z7M A;  2YI8 A;  2RHQ B;  3IFX A;  1AIL A;  1E1R G;  1BS3 A;  4GX1 A;  2XAS A;  4K8Z A;  4IYH A;  4DV0 O;  5DEC A;  4TV8 B;  4YCW A;  5LHH A;  5LMN B;  1Y76 A;  1NH2 D;  1G51 A;  3UFG A;  4O2B B;  3M7M X;  1M56 B;  4BIO A;  2CTR A;  2VS0 A;  4FZ1 A;  5KHK A;  2I4M A;  2QWR B;  4H44 B;  2AMC A;  1USY A;  4XEM A;  3CE2 A;  2OTL V;  3IAL A;  4QE9 A;  1IBK O;  4JI2 B;  2ADP A;  1YXB A;  2IH1 C;  1V9P A;  1OCO C;  2GSM B;  3ZHT A;  1PYS A;  5DN6 G;  4YRM A;  3E35 A;  4F6E A;  3RBZ A;  2BTQ A;  3UKM A;  4YCV A;  3CC7 V;  4JI0 O;  3GB7 C;  4B3T O;  3JAK A;  3L2Z A;  3D8C A;  2G38 A;  1IXM A;  1VQK V;  1HTT A;  2F1M A;  3HPL C;  1FXK B;  2QWP B;  4UCR A; 
#chains in the Genus database with same CATH homology
 1N9W A;  3RYI A;  5FPO A;  2ZIN A;  4RDX A;  2CJ9 A;  3PN1 A;  3HY1 A;  4LH7 A;  4XTW A;  4YRO A;  5CB4 A;  1YFS A;  1EOV A;  1M5I A;  4O4I B;  3RGB A;  1Z5W A;  4HVC A;  4KHP B;  3A5Y A;  1WN7 A;  1KOG A;  1X55 A;  2RHS A;  1SKV A;  3QTC A;  2ZTG A;  3LSQ A;  4XU1 A;  2DU5 A;  4FLU A;  4DR1 B;  2RHQ A;  5IWA B;  4X66 B;  4U3J A;  3BA8 A;  1Q3E A;  1VQZ A;  1B70 B;  1X4T A;  4JI0 B;  3JSN A;  3N2K A;  3TEG A;  1B7Y A;  4TV8 A;  4I4T A;  2EAY A;  3IG2 A;  5JCO C;  5KX5 B;  1H4T A;  3REX A;  4LF6 B;  4BW9 A;  4O2B A;  4O2A B;  1XI1 A;  2F66 C;  3HFZ B;  4K86 A;  3SJA C;  2PYJ A;  3THO A;  4TVW A;  2E1H A;  5LOV B;  2ZNI A;  3HRK A;  3RUX A;  1BBU A;  1WYD A;  4RQE A;  5C51 B;  1E1T A;  2ALY A;  2ART A;  3A32 A;  4EB6 B;  4YPF A;  4K8X A;  5ITZ B;  1XMQ B;  2IY5 B;  2E3C A;  3E9H A;  4P73 C;  5LXT B;  2XTI A;  2YI9 A;  4HNA B;  5IYZ A;  5LMU B;  1PYS B;  4CH3 A;  4Q15 A;  4H02 A;  3QF7 A;  3VQW A;  4O4H B;  5EYP B;  5FNV B;  4TTV A;  3MF2 A;  1FJG B;  3L4G B;  1Q8I A;  5IJ9 B;  5EZY A;  5KMG B;  2PYL A;  3NEL A;  1NJ8 A;  3K5O A;  2QHT A;  4PHZ A;  2CIM A;  3N2G B;  4DV0 B;  4RMF A;  2P22 C;  4P72 A;  4YRS A;  3JAK B;  4P3O A;  5LYJ A;  2ZT8 A;  3VBB A;  2VWJ A;  2VWK A;  3BAA A;  1YFR A;  5IJ0 A;  2F95 B;  2YIB A;  3JAL A;  4UCS A;  4YRG A;  2ZZG A;  1XHX A;  1H4V B;  3OD1 A;  3R07 A;  2VQF B;  3ICX A;  4YP0 A;  1J5W A;  2ZIO A;  5CB4 B;  4LVK A;  3RKW A;  5J2U A;  4WJ4 A;  2E5L B;  4LF9 B;  1HNW B;  3KFU A;  4P73 A;  2ODR D;  4ZOL A;  4DV5 B;  2I4L A;  1QQC A;  2JGU A;  3FFQ A;  1ZAU A;  4NXM B;  3HXV A;  2UXB B;  1TAE A;  4U3J B;  3VQV A;  3EFS A;  1X54 A;  3UT5 B;  2VQE B;  4TVA A;  3V7C A;  4UFZ A;  3A7U A;  2C7I A;  1C0A A;  4DPG A;  4L8J A;  4I4T B;  3PZC A;  3OTO B;  4LF4 B;  4P71 C;  1FFX B;  1USY C;  1WQ7 A;  2KKW A;  4CH5 A;  2OYQ A;  4O2A A;  4NXN B;  3HFZ A;  5LOV A;  1X56 A;  2ODR C;  3RKX A;  3RIR A;  4HWS A;  4LVL A;  4O4L B;  4DK1 A;  4H2U A;  1HW7 A;  2ALY B;  3E9I A;  4HBN A;  4DK0 A;  4EB6 A;  4P72 C;  1HC7 A;  5ITZ A;  2R9A A;  3DSQ A;  4DV2 B;  1NJ5 A;  4YRN A;  4DUY B;  5KHG A;  5LA6 B;  4YJ2 A;  2PTM A;  5IYZ B;  2CGH A;  1H4S A;  4CS3 A;  1RSO A;  2P5O A;  1Z5V A;  4FFB B;  1ADJ A;  1SES A;  5BMV A;  1NT2 B;  3ERR A;  1H4Q A;  2BTO A;  2R72 A;  5C52 B;  5EYP A;  5FNV A;  4DV4 B;  4F6R A;  4B3M B;  2HEP A;  1XQ8 A;  1LYL A;  3L4G A;  4YRT A;  2DXT A;  4P75 A;  5KMG A;  3RF1 A;  1E22 A;  3T1H B;  2UXD B;  3N2G A;  2PY5 A;  2E64 A;  2EX3 A;  1WPY A;  4TOI A;  3CMQ A;  1B76 A;  2QJ1 A;  3JSL A;  4Q6G A;  4TQD A;  5IJ0 B;  4CH4 A;  4LNS A;  2DTI A;  3JAL B;  4B3R B;  2ZT5 A;  4EEQ A;  3JAR B;  2Q7G A;  4CC6 A;  4YRI A;  4TWA A;  2ZR2 A;  4GLX A;  4JI8 B;  5J2U B;  3HKB B;  4X20 B;  1TA8 A;  3WB1 A;  2ARU A;  3NEM A;  3QO5 A;  4ZOL B;  4YRQ A;  5KHH A;  1QF6 A;  1WPB A;  3IKM B;  1BBW A;  1B8A A;  1EIY B;  2ZM6 B;  1SRY A;  2E41 A;  3PCO B;  3UT5 A;  4TVA B;  3CHX A;  3LNN A;  2PZS A;  2R70 A;  3A2F A;  2UUA B;  3OTF A;  4O2D A;  4ZTU B;  2J3L A;  1FFX A;  4GKJ B;  4K0K B;  4KR2 A;  1O9G A;  2DTO A;  5GON B;  4KQE A;  4O4L A;  1WNS A;  3SGI A;  3V7R A;  4IHJ B;  2UXC B;  4GYC B;  5KHI A;  4X1Y A;  3RKY A;  3K58 A;  4XTU A;  3W3S A;  5FPR A;  1JFF A;  4YJ2 B;  5LA6 A;  4DV7 B;  1YGB A;  2ZR3 A;  4LNU B;  4CS4 A;  3QG5 A;  4EFE A;  1I94 B;  4FFB A;  3K57 A;  5BMV B;  3WB0 A;  1T5E A;  4L87 A;  1HNX B;  1KMI Z;  5KHJ A;  4FM0 A;  3RL6 A;  3MQZ A;  4F6R B;  4AQY B;  3TUP A;  1IBM B;  3HTZ A;  1XMO B;  4P74 C;  2UUB B;  4LVJ A;  4NVP A;  4FLV A;  1NYQ A;  1L0W A;  4UCO A;  1RIQ A;  3EFR A;  1TUB A;  4FVM A;  4PI0 A;  4PG3 A;  1D5A A;  3RYF A;  4LF7 B;  4UCU A;  1WU7 A;  2JS5 A;  4IIJ A;  4LFA B;  3SJC C;  1N36 B;  5EIB D;  4B3S B;  3L1A A;  4KL1 A;  2Q5I A;  2CAZ C;  4FLY A;  4P3N A;  3V8L A;  3CSX A;  4H2W A;  3JAR A;  1NJ2 A;  2Q7H A;  12AS A;  3V7S A;  4UCT A;  3HKB A;  4X20 A;  4DR4 B;  4P71 A;  5E3I A;  4JI1 B;  2DJZ A;  4X65 B;  3ICA A;  3HKC A;  4XTY A;  4PHC A;  1M4U A;  4P75 C;  4H2V A;  4DV1 B;  4B08 A;  2EJ9 A;  1QE0 A;  3PCO A;  1EIY A;  4HT4 A;  1ASZ A;  1WLE A;  4FLT A;  2DVE A;  2ZGW A;  2DQ3 A;  5EIB C;  3BRC A;  3JAT B;  4EO4 A;  5CA1 B;  4CH6 A;  4EFB A;  2ZZF A;  4YRC A;  4JI3 B;  2QHS A;  3QNE A;  1NJ6 A;  1SQG A;  4YHH B;  1G5I A;  4WBN A;  5GON A;  4FM1 A;  4JI5 B;  1G6U A;  4P74 A;  2ZXF A;  2J3M A;  1HXD A;  4HWO A;  4IHJ A;  2DTH A;  1Q43 A;  2JVD A;  2PME A;  3RWR D;  3WB2 A;  1NNH A;  2EJF A;  3LC0 A;  4X1Y B;  2I4N A;  1E24 A;  5BR8 B;  1JFF B;  3U11 A;  4H2X A;  4OP0 A;  2DQ0 A;  4LNU A;  3SJB C;  4DQ2 A;  4FLX A;  1XNQ B;  4RQF A;  4FLZ A;  1P49 A;  1N33 B;  4HWP A;  2YIA A;  3UQ8 A;  4BWA A;  2DZC A;  3QO8 A;  4JI4 B;  4XU3 A;  2EJG A;  2Q5H A;  2P0L A;  3A7R A;  1KU9 A;  4AIL C;  3A5Z A;  1TUB B;  1EVK A;  4E51 A;  1IL2 A;  4LFB B;  5C8Y A;  3RYF B;  1BIA A;  3B2E E;  4IIJ B;  1E1O A;  2RQ6 A;  3BAB A;  1G5H A;  3IAY A;  4O4J B;  4OX9 B;  1JJC B;  2DU7 A;  3UGQ A;  1DGS A;  3SR2 C;  5JJE B;  3HXW A;  2XGT A;  4DR2 B;  4DR5 B;  2PUS A;  2DZ9 A;  4I50 B;  4DV6 B;  3JAW B;  4UCV A;  2FYK A;  5C53 B;  3HKE A;  4JI7 B;  5K1X A;  3REU A;  3HKC B;  1SER A;  4X5O A;  4YRL A;  4JV5 B;  3QO7 A;  4TQF A;  4YJ3 A;  2E65 A;  1ADY A;  1HNZ B;  2ZZE A;  3NET A;  2HHH B;  1WQW A;  3K5L A;  4ZIB A;  3MF1 A;  3A31 A;  4YRJ A;  4LH6 A;  3JAS A;  1EVL A;  1X01 A;  5D5P A;  4YY3 B;  3HXU A;  3RYC A;  3T1Y B;  1EFW A;  3JAT A;  2AKW B;  5CA1 A;  5JJJ B;  4JYA B;  3RFR A;  4I55 B;  1KMN A;  3P8Y A;  3UH0 A;  4WBN B;  4XTZ A;  1O9H A;  2YXL A;  5J2T A;  4DR6 B;  4TUY A;  1EQR A;  1YFT A;  4JI6 B;  3BFM A;  4LFC B;  3MEY A;  4YRE A;  5CA0 B;  5JVD A;  4B3T B;  4AH6 A;  4UPA A;  4X64 B;  1IBK B;  2QHV A;  2CJA A;  2EL9 A;  4XTV A;  1JMK C;  1X2H A;  4H2X B;  3E22 A;  4D7T A;  2ZCE A;  3HXZ A;  4K87 A;  4ZI7 A;  4UP9 A;  3TEH A;  1M93 A;  1SQF A;  4H2T A;  3RAC A;  4H2S A;  2CJB A;  1NYR A;  4G85 A;  2F4V B;  1SET A;  1GGM A;  11AS A;  3NEN A;  4ZHQ B;  5JH7 A;  4LVM A;  4XEO A;  3U0Z A;  2PMF A;  4XU0 A;  1SA0 B;  1B04 A;  5C8Y B;  5K1P A;  2ZIM A;  2RJZ A;  1HR0 B;  3V8J A;  2ZT7 A;  4X62 B;  4WF2 A;  4O4J A;  1JJC A;  2C8M A;  3P8T A;  3WQZ A;  4CC5 A;  4AHC A;  3HXY A;  5LP6 A;  2PGG A;  4DRX A;  4UP8 A;  2IM9 A;  5JCO A;  3RYH A;  5JQG B;  2AMC B;  4I50 A;  1VF7 A;  3BA9 A;  4FM2 A;  1YB3 A;  3BJU A;  2ZNJ A;  3JAW A;  4X1K B;  1JJO A;  3HKE B;  4TVY A;  1TVK B;  5LP6 C;  3ZS8 C;  4FLW A;  4X1I A;  2DKG A;  3BPZ A;  3HKD A;  4DR7 B;  1BIB A;  4TV9 A;  5JJN B;  4YJ3 B;  4YRP A;  2G4C A;  3IKL A;  1KMM A;  2NS6 A;  4K88 A;  2BTQ B;  2XHB A;  4LVI A;  3FJP A;  1X2G A;  3JAS B;  4YRR A;  4DR3 B;  1J5E B;  2Q7E A;  3RYC B;  2UUC B;  4J15 A;  2AKW A;  4XU2 A;  4WJ3 M;  2I4O A;  4I55 A;  3CB2 A;  4HWT A;  2UU9 B;  2V4D A;  2A8E A;  4I9Q A;  2P5I A;  3HXX A;  4EX5 A;  3V8K A;  4YCU A;  5J2T B;  5D5Q A;  4YRK A;  4TUY B;  1N34 B;  2QM4 A;  3RYI B;  3ZED A;  1QHT A;  2DDZ A;  5ELN A;  3U10 A;  2HNI A;  2DEQ A;  3A7A A;  3I7F A;  3HFV A;  5JVD B;  5CA0 A;  1H2S B;  3VQX A;  2Q0A A;  4O4I A;  3VQY A;  5HGQ A;  1W66 A;  1I7F A;  1ASY A;  1IBL B;  3E22 B;  4ZTZ B;  1Z7M A;  4ZI7 B;  3TEH B;  1Z7N A;  2ARS A;  2RHS B;  2YI8 A;  2RHQ B;  2QHU A;  4H2Y A;  1B70 A;  4WI1 A;  4YRF A;  4K8Z A;  4ZHQ A;  5JH7 B;  3N2K B;  2F93 B;  1B7Y B;  3G1Z A;  1SA0 A;  4TV8 B;  1FYF A;  4YCW A;  3P8V A;  1TGO A;  5LMN B;  4P3P A;  4YDQ A;  3K5M A;  2E5A A;  1G51 A;  5KX5 A;  3UFG A;  4KR3 A;  4O2B B;  1Q5O A;  3M4Q A;  3M7M X;  4DUZ B;  3HY0 A;  5KHK A;  3LSS A;  2I4M A;  5LP6 B;  4XTX A;  1XNR B;  4DRX B;  3RYH B;  5JQG A;  3K59 A;  1USY A;  2AMC A;  4XEM A;  4OLF A;  3IAL A;  2IY5 A;  4X1K A;  3HRI A;  3UGT A;  1TVK A;  4JI2 B;  3M4P A;  4LF8 B;  5LXT A;  4LR3 A;  1ATI A;  1V9P A;  4HNA A;  4X1I B;  2E10 A;  4NCX A;  3HKD B;  1WNL A;  1PYS A;  4TV9 B;  2GV9 A;  1YEW A;  4GKK B;  3K5N A;  4YRM A;  3MAQ A;  4O4H A;  1L8D A;  5ELO A;  4HA8 A;  4YYE A;  4CS2 A;  4DV3 B;  4LF5 B;  3A74 A;  4G84 A;  2BTQ A;  5IJ9 A;  1NJ1 A;  5EZY B;  1N32 B;  4D7S A;  4YCV A;  2OWO A;  4UP7 A;  3JAK A;  3L2Z A;  5LYJ B;  2EWN A;  5KNN A;  1XHZ A;  2ZT6 A;  1HTT A;  2F1M A;  2YIB D;  5F5W A;  3RGL A;  1S5J A;  4HWR A;  3ETQ A;  4UCR A;  2DXU A;  4PI2 A;  3BHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...