1Z7NA

Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
313
Chain Sequence
YLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ATP phosphoribosyltransferase regulatory subunit
publication title Activation of the hetero-octameric ATP phosphoribosyl transferase through subunit interface rearrangement by a tRNA synthetase paralog.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 98
structure length 313
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1z7nA00
2ZZFA 4XTWA 3REXA 1EIYB 3IKLA 4X5OA 1G5HA 2PMEA 1BBUA 2IY5A 2DEQA 1SESA 3IALA 1KOGA 4P3NA 3EFRA 1SERA 4KQEA 2DKGA 1N9WA 4J15A 4K86A 1GGMA 3UGQA 1WYDA 3BJUA 1QF6A 3RL6A 1YB3A 1HXDA 1EIYA 3V7SA 4H2TA 2E65A 3V7CA 4YRLA 3HXUA 3P8TA 3A74A 3ERRA 2EWNA 2ZZEA 1EFWA 1ADJA 4BW9A 1EQRA 4Q15A 3PCOB 5C51B 3IG2A 1B7YA 2DU7A 2CJ9A 2RHSB 1YFTA 4TVYA 3M4PA 3E9HA 3HXWA 1VQZA 2ZR3A 1BBWA 3HRKA 4YRJA 3L1AA 2QHSA 3HRIA 1X54A 3V8LA 1J5WA 1NJ8A 3E9IA 2DTOA 2C7IA 2ARTA 2Q7HA 2DU5A 2ZTGA 4LNSA 4YROA 4H02A 3REUA 2EAYA 3IKMB 4YRPA 4KR2A 2ZNIA 4P3PA 2QHVA 2ZXFA 2PMFA 1B70B 3HY0A 4YRFA 3LSQA 2ZR2A 1SETA 5KNNA 1LYLA 2EJ9A 1YFRA 3HY1A 12ASA 2ZCEA 1X2GA 4XTZA 3QTCA 3VQXA 4XTXA 4P74C 4YRTA 4WI1A 4XU1A 3A7RA 3P8YA 4WJ3M 4EX5A 3A5YA 4H2SA 4XTVA 1X01A 4RQEA 3TEHA 1BIBA 2ZIOA 3HXVA 5F5WA 1WLEA 2IY5B 2EJFA 2RHQA 1G51A 1EVKA 3A7UA 3EFSA 3RKWA 2DQ3A 4HWSA 4YDQA 4UP9A 3G1ZA 4L87A 3NEMA 3RUXA 4Q6GA 2I4LA 2DXUA 2ZINA 4RDXA 2ZT6A 2E3CA 2EJGA 3P8VA 3R07A 1B7YB 3V8JA 4YYEA 3NENA 2Q7EA 3QNEA 3RKXA 4YCWA 3RGLA 1ATIA 1NJ6A 1WQWA 2E1HA 2ALYA 2E41A 1L0WA 4YRSA 4TQDA 2E10A 4TVWA 4H2UA 3NETA 4BWAA 5HGQA 1WPYA 3CMQA 1NJ5A 4CH4A 2CIMA 4XEMA 1ADYA 4H2WA 1G5IA 4CS3A 4XTYA 4P74A 3L2ZA 3OD1A 3UH0A 4YRIA 4XU2A 4P73C 3VBBA 1USYC 2DZ9A 2DTHA 2C8MA 3QO8A 4UP7A 1X55A 4OP0A 1WNLA 1YGBA 4P75C 3KFUA 1NJ1A 5ELNA 4TVAA 4YRGA 1H4VB 2DJZA 3FJPA 4K88A 4K87A 3RIRA 4UP8A 1YFSA 1JJCA 4YRNA 4G84A 4XU0A 1PYSA 4XTUA 2DDZA 4TWAA 5K1XA 1ASYA 3HXZA 4YCUA 3TEHB 2ZIMA 2AMCA 1SRYA 1NYQA 4DPGA 2RHQB 1E24A 3A31A 1B76A 2J3LA 4YP0A 4HVCA 3TEGA 1B8AA 3BFMA 1HC7A 4YRKA 3VQVA 4WJ4A 1KMNA 2ZGWA 3ICAA 2Q5HA 1E22A 1X56A 2P0LA 3HTZA 3RACA 5C52B 4P73A 4CH5A 4HWOA 1USYA 1QE0A 3I7FA 2ARUA 1Z7MA 4YRRA 4P75A 4DQ2A 4NCXA 2G4CA 2ZT5A 3VQYA 2QHUA 2ALYB 3HFZA 3WQZA 3A32A 4E51A 4CS2A 3HXXA 4AH6A 3L4GA 4H2XA 4OLFA 1BIAA 2Q7GA 5ELOA 1C0AA 3NELA 2XTIA 4HWTA 4P72C 2ARSA 4HWPA 4ZIBA 1RIQA 4YPFA 4ZTZB 2ZT8A 1EVLA 2QHTA 3QO5A 2AKWA 2I4NA 4P71C 5C53B 2HNIA 4TTVA 2CJAA 3PZCA 4TVAB 4ZTUB 3DSQA 4PG3A 4CH6A 2I4MA 3VQWA 3MF1A 3V8KA 2DQ0A 4KR3A 1EOVA 4YRQA 1H4QA 1JJCB 4O2DA 4H2VA 4HA8A 3MEYA 3LSSA 2E5AA 3LC0A 4CH3A 1PYSB 2EL9A 4XU3A 2CJBA 3A7AA 4YCVA 1WU7A 3PCOA 1Z7NA 2DTIA 2AMCB 2RHSA 1W66A 4YRMA 4RMFA 5E3IA 2ODRD 2XGTA 4HWRA 1NJ2A 1KMMA 3RKYA 1IL2A 2Q5IA 2DZCA 3TUPA 4RQFA 4H2YA 3MF2A 4G85A 2ZT7A 4PHCA 1FYFA 2FYKA 4P72A 3RF1A 2J3MA 1WQ7A 4YRCA 3UFGA 1X2HA 2DVEA 3M4QA 1E1TA 2CGHA 1H4SA 3W3SA 2I4OA 2E64A 4P3OA 4P71A 4TQFA 1B70A 3HFZB 5K1PA 3HXYA 3UGTA 3HFVA 4YREA 3L4GB 4XEOA 4CS4A 4H2XB 2ODRC 2DXTA 2ZZGA 1NYRA 1NNHA 4WF2A 2ZNJA 2P5IA 3QO7A 3V7RA 11ASA 1H4TA 4UPAA 3A5ZA 1E1OA 4EO4A 1HTTA 2AKWB 1ASZA
chains in the Genus database with same CATH superfamily
2ZZFA 4XTWA 3REXA 1EIYB 3IKLA 4X5OA 1G5HA 2PMEA 4LVMA 1BBUA 2IY5A 2DEQA 1SESA 3IALA 1KOGA 4P3NA 3EFRA 1SERA 4KQEA 2DKGA 1N9WA 4J15A 4K86A 1GGMA 3UGQA 1WYDA 3BJUA 1QF6A 3RL6A 1YB3A 1HXDA 1EIYA 3V7SA 4H2TA 2E65A 3V7CA 4YRLA 3HXUA 3P8TA 3A74A 3ERRA 2EWNA 3MQZA 2ZZEA 1EFWA 1ADJA 4BW9A 1EQRA 4Q15A 3PCOB 5C51B 3IG2A 1B7YA 2DU7A 2CJ9A 2RHSB 1YFTA 4TVYA 3M4PA 3E9HA 3HXWA 1VQZA 2ZR3A 1BBWA 3HRKA 4YRJA 3L1AA 2QHSA 3HRIA 1X54A 3V8LA 2A8EA 1J5WA 1NJ8A 3E9IA 2DTOA 2C7IA 2ARTA 2Q7HA 2DU5A 2ZTGA 4LNSA 4YROA 4H02A 3REUA 2EAYA 3IKMB 4YRPA 4KR2A 2ZNIA 4P3PA 2QHVA 2ZXFA 2PMFA 1B70B 3HY0A 4YRFA 3LSQA 2ZR2A 1SETA 5KNNA 1LYLA 2EJ9A 1YFRA 3HY1A 12ASA 2ZCEA 1X2GA 4XTZA 3QTCA 3VQXA 4XTXA 4P74C 4YRTA 4WI1A 4XU1A 3A7RA 3P8YA 4WJ3M 4EX5A 3A5YA 4H2SA 4XTVA 1X01A 4RQEA 3TEHA 1BIBA 2ZIOA 3HXVA 5F5WA 1WLEA 2IY5B 2EJFA 2RHQA 1G51A 1EVKA 3A7UA 3EFSA 3RKWA 2DQ3A 4HWSA 4YDQA 4UP9A 3G1ZA 4L87A 3NEMA 3RUXA 4Q6GA 2I4LA 2DXUA 2ZINA 4RDXA 2ZT6A 2E3CA 2EJGA 3P8VA 3R07A 1B7YB 3V8JA 4YYEA 3NENA 2Q7EA 3QNEA 3RKXA 4YCWA 3RGLA 1ATIA 1NJ6A 1WQWA 2E1HA 2ALYA 2E41A 1L0WA 4YRSA 4TQDA 2E10A 4TVWA 4H2UA 3NETA 4BWAA 5HGQA 1WPYA 3CMQA 1NJ5A 4CH4A 2CIMA 4XEMA 1ADYA 4H2WA 1G5IA 4CS3A 4XTYA 4P74A 3L2ZA 3OD1A 3UH0A 4YRIA 4XU2A 4P73C 3VBBA 1USYC 2DZ9A 2DTHA 2C8MA 3QO8A 4UP7A 1X55A 4OP0A 1WNLA 1YGBA 4P75C 3KFUA 1NJ1A 5ELNA 4TVAA 4YRGA 1H4VB 2DJZA 3FJPA 4K88A 4K87A 3RIRA 4UP8A 1YFSA 1JJCA 4YRNA 4G84A 4XU0A 1PYSA 4XTUA 2DDZA 4TWAA 5K1XA 1ASYA 3HXZA 4YCUA 3TEHB 2ZIMA 2AMCA 1SRYA 1NYQA 4DPGA 2RHQB 1E24A 3A31A 1B76A 2J3LA 4YP0A 4HVCA 3TEGA 1B8AA 3BFMA 1HC7A 4YRKA 3VQVA 4WJ4A 1KMNA 2ZGWA 3ICAA 2Q5HA 1E22A 1X56A 2P0LA 3HTZA 3RACA 5C52B 4P73A 4CH5A 4HWOA 1USYA 1QE0A 3I7FA 2ARUA 1Z7MA 4YRRA 4P75A 4DQ2A 4NCXA 2G4CA 2ZT5A 3VQYA 2QHUA 2ALYB 3HFZA 3WQZA 3A32A 4E51A 4CS2A 3HXXA 4AH6A 3L4GA 4H2XA 4OLFA 1BIAA 2Q7GA 5ELOA 1C0AA 3NELA 2XTIA 4HWTA 4P72C 2ARSA 4HWPA 4ZIBA 1RIQA 4YPFA 4ZTZB 2ZT8A 1EVLA 2QHTA 3QO5A 2AKWA 2I4NA 4P71C 5C53B 2HNIA 4TTVA 2CJAA 3PZCA 4TVAB 4ZTUB 3DSQA 4LVKA 4PG3A 4CH6A 2I4MA 3VQWA 3MF1A 3V8KA 2DQ0A 4LVLA 4KR3A 1EOVA 4YRQA 1H4QA 1JJCB 4O2DA 4H2VA 4HA8A 3MEYA 3LSSA 2E5AA 3LC0A 4CH3A 4HT4A 1PYSB 2EL9A 4XU3A 2CJBA 3A7AA 4YCVA 1WU7A 3PCOA 1Z7NA 2DTIA 2AMCB 2RHSA 1W66A 4YRMA 4RMFA 5E3IA 2ODRD 2XGTA 4HWRA 4LVJA 1NJ2A 1KMMA 3RKYA 1IL2A 2Q5IA 2NS6A 2DZCA 3TUPA 4RQFA 4H2YA 3MF2A 4G85A 2ZT7A 4PHCA 1FYFA 2FYKA 4P72A 3RF1A 2J3MA 1WQ7A 4YRCA 3UFGA 1X2HA 2DVEA 3M4QA 1E1TA 2CGHA 4LVIA 1H4SA 3W3SA 2I4OA 2E64A 4P3OA 4P71A 4TQFA 1B70A 3HFZB 5K1PA 3HXYA 3UGTA 3HFVA 4YREA 3L4GB 4XEOA 4CS4A 4H2XB 2ODRC 2DXTA 2ZZGA 1NYRA 1NNHA 4WF2A 2ZNJA 2P5IA 3QO7A 3V7RA 11ASA 1H4TA 4UPAA 3A5ZA 1E1OA 4EO4A 1HTTA 2AKWB 1ASZA
chains in the Genus database with same CATH topology
2ZZFA 4XTWA 3REXA 1EIYB 3IKLA 4X5OA 1G5HA 2PMEA 4LVMA 1BBUA 2IY5A 2DEQA 1SESA 3IALA 1KOGA 4P3NA 3EFRA 1SERA 4KQEA 2DKGA 1N9WA 4J15A 4K86A 1GGMA 3UGQA 1WYDA 3BJUA 1QF6A 3RL6A 1YB3A 1HXDA 1EIYA 3V7SA 4H2TA 2E65A 3V7CA 4YRLA 3HXUA 3P8TA 3A74A 3ERRA 2EWNA 3MQZA 2ZZEA 1EFWA 1ADJA 4BW9A 1EQRA 4Q15A 3PCOB 5C51B 3IG2A 1B7YA 2DU7A 2CJ9A 2RHSB 1YFTA 4TVYA 3M4PA 3E9HA 3HXWA 1VQZA 2ZR3A 1BBWA 3HRKA 4YRJA 3L1AA 2QHSA 3HRIA 1X54A 3V8LA 2A8EA 1J5WA 1NJ8A 3E9IA 2DTOA 2C7IA 2ARTA 2Q7HA 2DU5A 2ZTGA 4LNSA 4YROA 4H02A 3REUA 2EAYA 3IKMB 4YRPA 4KR2A 2ZNIA 4P3PA 2QHVA 2ZXFA 2PMFA 1B70B 3HY0A 4YRFA 3LSQA 2ZR2A 1SETA 5KNNA 1LYLA 2EJ9A 1YFRA 3HY1A 12ASA 2ZCEA 1X2GA 4XTZA 3QTCA 3VQXA 4XTXA 4P74C 4YRTA 4WI1A 4XU1A 3A7RA 3P8YA 4WJ3M 4EX5A 3A5YA 4H2SA 4XTVA 1X01A 4RQEA 3TEHA 1BIBA 2ZIOA 3HXVA 5F5WA 1WLEA 2IY5B 2EJFA 2RHQA 1G51A 1EVKA 3A7UA 3EFSA 3RKWA 2DQ3A 4HWSA 4YDQA 4UP9A 3G1ZA 4L87A 3NEMA 3RUXA 4Q6GA 2I4LA 2DXUA 2ZINA 4RDXA 2ZT6A 2E3CA 2EJGA 3P8VA 3R07A 1B7YB 3V8JA 4YYEA 3NENA 2Q7EA 3QNEA 3RKXA 4YCWA 3RGLA 1ATIA 1NJ6A 1WQWA 2E1HA 2ALYA 2E41A 1L0WA 4YRSA 4TQDA 2E10A 4TVWA 4H2UA 3NETA 4BWAA 5HGQA 1WPYA 3CMQA 1NJ5A 4CH4A 2CIMA 4XEMA 1ADYA 4H2WA 1G5IA 4CS3A 4XTYA 4P74A 3L2ZA 3OD1A 3UH0A 4YRIA 4XU2A 4P73C 3VBBA 1USYC 2DZ9A 2DTHA 2C8MA 3QO8A 4UP7A 1X55A 4OP0A 1WNLA 1YGBA 4P75C 3KFUA 1NJ1A 5ELNA 4TVAA 4YRGA 1H4VB 2DJZA 3FJPA 4K88A 4K87A 3RIRA 4UP8A 1YFSA 1JJCA 4YRNA 4G84A 4XU0A 1PYSA 4XTUA 2DDZA 4TWAA 5K1XA 1ASYA 3HXZA 4YCUA 3TEHB 2ZIMA 2AMCA 1SRYA 1NYQA 4DPGA 2RHQB 1E24A 3A31A 1B76A 2J3LA 4YP0A 4HVCA 3TEGA 1B8AA 3BFMA 1HC7A 4YRKA 3VQVA 4WJ4A 1KMNA 2ZGWA 3ICAA 2Q5HA 1E22A 1X56A 2P0LA 3HTZA 3RACA 5C52B 4P73A 4CH5A 4HWOA 1USYA 1QE0A 3I7FA 2ARUA 1Z7MA 4YRRA 4P75A 4DQ2A 4NCXA 2G4CA 2ZT5A 3VQYA 2QHUA 2ALYB 3HFZA 3WQZA 3A32A 4E51A 4CS2A 3HXXA 4AH6A 3L4GA 4H2XA 4OLFA 1BIAA 2Q7GA 5ELOA 1C0AA 3NELA 2XTIA 4HWTA 4P72C 2ARSA 4HWPA 4ZIBA 1RIQA 4YPFA 4ZTZB 2ZT8A 1EVLA 2QHTA 3QO5A 2AKWA 2I4NA 4P71C 5C53B 2HNIA 4TTVA 2CJAA 3PZCA 4TVAB 4ZTUB 3DSQA 4LVKA 4PG3A 4CH6A 2I4MA 3VQWA 3MF1A 3V8KA 2DQ0A 4LVLA 4KR3A 1EOVA 4YRQA 1H4QA 1JJCB 4O2DA 4H2VA 4HA8A 3MEYA 3LSSA 2E5AA 3LC0A 4CH3A 4HT4A 1PYSB 2EL9A 4XU3A 2CJBA 3A7AA 4YCVA 1WU7A 3PCOA 1Z7NA 2DTIA 2AMCB 2RHSA 1W66A 4YRMA 4RMFA 5E3IA 2ODRD 2XGTA 4HWRA 4LVJA 1NJ2A 1KMMA 3RKYA 1IL2A 2Q5IA 2NS6A 2DZCA 3TUPA 4RQFA 4H2YA 3MF2A 4G85A 2ZT7A 4PHCA 1FYFA 2FYKA 4P72A 3RF1A 2J3MA 1WQ7A 4YRCA 3UFGA 1X2HA 2DVEA 3M4QA 1E1TA 2CGHA 4LVIA 1H4SA 3W3SA 2I4OA 2E64A 4P3OA 4P71A 4TQFA 1B70A 3HFZB 5K1PA 3HXYA 3UGTA 3HFVA 4YREA 3L4GB 4XEOA 4CS4A 4H2XB 2ODRC 2DXTA 2ZZGA 1NYRA 1NNHA 4WF2A 2ZNJA 2P5IA 3QO7A 3V7RA 11ASA 1H4TA 4UPAA 3A5ZA 1E1OA 4EO4A 1HTTA 2AKWB 1ASZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZF A;  4XTW A;  3REX A;  1EIY B;  3IKL A;  4X5O A;  1G5H A;  2PME A;  1BBU A;  2IY5 A;  2DEQ A;  1SES A;  3IAL A;  1KOG A;  4P3N A;  3EFR A;  1SER A;  4KQE A;  2DKG A;  1N9W A;  4J15 A;  4K86 A;  1GGM A;  3UGQ A;  1WYD A;  3BJU A;  1QF6 A;  3RL6 A;  1YB3 A;  1HXD A;  1EIY A;  3V7S A;  4H2T A;  2E65 A;  3V7C A;  4YRL A;  3HXU A;  3P8T A;  3A74 A;  3ERR A;  2EWN A;  2ZZE A;  1EFW A;  1ADJ A;  4BW9 A;  1EQR A;  4Q15 A;  3PCO B;  5C51 B;  3IG2 A;  1B7Y A;  2DU7 A;  2CJ9 A;  2RHS B;  1YFT A;  4TVY A;  3M4P A;  3E9H A;  3HXW A;  1VQZ A;  2ZR3 A;  1BBW A;  3HRK A;  4YRJ A;  3L1A A;  2QHS A;  3HRI A;  1X54 A;  3V8L A;  1J5W A;  1NJ8 A;  3E9I A;  2DTO A;  2C7I A;  2ART A;  2Q7H A;  2DU5 A;  2ZTG A;  4LNS A;  4YRO A;  4H02 A;  3REU A;  2EAY A;  3IKM B;  4YRP A;  4KR2 A;  2ZNI A;  4P3P A;  2QHV A;  2ZXF A;  2PMF A;  1B70 B;  3HY0 A;  4YRF A;  3LSQ A;  2ZR2 A;  1SET A;  5KNN A;  1LYL A;  2EJ9 A;  1YFR A;  3HY1 A;  12AS A;  2ZCE A;  1X2G A;  4XTZ A;  3QTC A;  3VQX A;  4XTX A;  4P74 C;  4YRT A;  4WI1 A;  4XU1 A;  3A7R A;  3P8Y A;  4WJ3 M;  4EX5 A;  3A5Y A;  4H2S A;  4XTV A;  1X01 A;  4RQE A;  3TEH A;  1BIB A;  2ZIO A;  3HXV A;  5F5W A;  1WLE A;  2IY5 B;  2EJF A;  2RHQ A;  1G51 A;  1EVK A;  3A7U A;  3EFS A;  3RKW A;  2DQ3 A;  4HWS A;  4YDQ A;  4UP9 A;  3G1Z A;  4L87 A;  3NEM A;  3RUX A;  4Q6G A;  2I4L A;  2DXU A;  2ZIN A;  4RDX A;  2ZT6 A;  2E3C A;  2EJG A;  3P8V A;  3R07 A;  1B7Y B;  3V8J A;  4YYE A;  3NEN A;  2Q7E A;  3QNE A;  3RKX A;  4YCW A;  3RGL A;  1ATI A;  1NJ6 A;  1WQW A;  2E1H A;  2ALY A;  2E41 A;  1L0W A;  4YRS A;  4TQD A;  2E10 A;  4TVW A;  4H2U A;  3NET A;  4BWA A;  5HGQ A;  1WPY A;  3CMQ A;  1NJ5 A;  4CH4 A;  2CIM A;  4XEM A;  1ADY A;  4H2W A;  1G5I A;  4CS3 A;  4XTY A;  4P74 A;  3L2Z A;  3OD1 A;  3UH0 A;  4YRI A;  4XU2 A;  4P73 C;  3VBB A;  1USY C;  2DZ9 A;  2DTH A;  2C8M A;  3QO8 A;  4UP7 A;  1X55 A;  4OP0 A;  1WNL A;  1YGB A;  4P75 C;  3KFU A;  1NJ1 A;  5ELN A;  4TVA A;  4YRG A;  1H4V B;  2DJZ A;  3FJP A;  4K88 A;  4K87 A;  3RIR A;  4UP8 A;  1YFS A;  1JJC A;  4YRN A;  4G84 A;  4XU0 A;  1PYS A;  4XTU A;  2DDZ A;  4TWA A;  5K1X A;  1ASY A;  3HXZ A;  4YCU A;  3TEH B;  2ZIM A;  2AMC A;  1SRY A;  1NYQ A;  4DPG A;  2RHQ B;  1E24 A;  3A31 A;  1B76 A;  2J3L A;  4YP0 A;  4HVC A;  3TEG A;  1B8A A;  3BFM A;  1HC7 A;  4YRK A;  3VQV A;  4WJ4 A;  1KMN A;  2ZGW A;  3ICA A;  2Q5H A;  1E22 A;  1X56 A;  2P0L A;  3HTZ A;  3RAC A;  5C52 B;  4P73 A;  4CH5 A;  4HWO A;  1USY A;  1QE0 A;  3I7F A;  2ARU A;  1Z7M A;  4YRR A;  4P75 A;  4DQ2 A;  4NCX A;  2G4C A;  2ZT5 A;  3VQY A;  2QHU A;  2ALY B;  3HFZ A;  3WQZ A;  3A32 A;  4E51 A;  4CS2 A;  3HXX A;  4AH6 A;  3L4G A;  4H2X A;  4OLF A;  1BIA A;  2Q7G A;  5ELO A;  1C0A A;  3NEL A;  2XTI A;  4HWT A;  4P72 C;  2ARS A;  4HWP A;  4ZIB A;  1RIQ A;  4YPF A;  4ZTZ B;  2ZT8 A;  1EVL A;  2QHT A;  3QO5 A;  2AKW A;  2I4N A;  4P71 C;  5C53 B;  2HNI A;  4TTV A;  2CJA A;  3PZC A;  4TVA B;  4ZTU B;  3DSQ A;  4PG3 A;  4CH6 A;  2I4M A;  3VQW A;  3MF1 A;  3V8K A;  2DQ0 A;  4KR3 A;  1EOV A;  4YRQ A;  1H4Q A;  1JJC B;  4O2D A;  4H2V A;  4HA8 A;  3MEY A;  3LSS A;  2E5A A;  3LC0 A;  4CH3 A;  1PYS B;  2EL9 A;  4XU3 A;  2CJB A;  3A7A A;  4YCV A;  1WU7 A;  3PCO A;  1Z7N A;  2DTI A;  2AMC B;  2RHS A;  1W66 A;  4YRM A;  4RMF A;  5E3I A;  2ODR D;  2XGT A;  4HWR A;  1NJ2 A;  1KMM A;  3RKY A;  1IL2 A;  2Q5I A;  2DZC A;  3TUP A;  4RQF A;  4H2Y A;  3MF2 A;  4G85 A;  2ZT7 A;  4PHC A;  1FYF A;  2FYK A;  4P72 A;  3RF1 A;  2J3M A;  1WQ7 A;  4YRC A;  3UFG A;  1X2H A;  2DVE A;  3M4Q A;  1E1T A;  2CGH A;  1H4S A;  3W3S A;  2I4O A;  2E64 A;  4P3O A;  4P71 A;  4TQF A;  1B70 A;  3HFZ B;  5K1P A;  3HXY A;  3UGT A;  3HFV A;  4YRE A;  3L4G B;  4XEO A;  4CS4 A;  4H2X B;  2ODR C;  2DXT A;  2ZZG A;  1NYR A;  1NNH A;  4WF2 A;  2ZNJ A;  2P5I A;  3QO7 A;  3V7R A;  11AS A;  1H4T A;  4UPA A;  3A5Z A;  1E1O A;  4EO4 A;  1HTT A;  2AKW B;  1ASZ A; 
#chains in the Genus database with same CATH topology
 2ZZF A;  4XTW A;  3REX A;  1EIY B;  3IKL A;  4X5O A;  1G5H A;  2PME A;  4LVM A;  1BBU A;  2IY5 A;  2DEQ A;  1SES A;  3IAL A;  1KOG A;  4P3N A;  3EFR A;  1SER A;  4KQE A;  2DKG A;  1N9W A;  4J15 A;  4K86 A;  1GGM A;  3UGQ A;  1WYD A;  3BJU A;  1QF6 A;  3RL6 A;  1YB3 A;  1HXD A;  1EIY A;  3V7S A;  4H2T A;  2E65 A;  3V7C A;  4YRL A;  3HXU A;  3P8T A;  3A74 A;  3ERR A;  2EWN A;  3MQZ A;  2ZZE A;  1EFW A;  1ADJ A;  4BW9 A;  1EQR A;  4Q15 A;  3PCO B;  5C51 B;  3IG2 A;  1B7Y A;  2DU7 A;  2CJ9 A;  2RHS B;  1YFT A;  4TVY A;  3M4P A;  3E9H A;  3HXW A;  1VQZ A;  2ZR3 A;  1BBW A;  3HRK A;  4YRJ A;  3L1A A;  2QHS A;  3HRI A;  1X54 A;  3V8L A;  2A8E A;  1J5W A;  1NJ8 A;  3E9I A;  2DTO A;  2C7I A;  2ART A;  2Q7H A;  2DU5 A;  2ZTG A;  4LNS A;  4YRO A;  4H02 A;  3REU A;  2EAY A;  3IKM B;  4YRP A;  4KR2 A;  2ZNI A;  4P3P A;  2QHV A;  2ZXF A;  2PMF A;  1B70 B;  3HY0 A;  4YRF A;  3LSQ A;  2ZR2 A;  1SET A;  5KNN A;  1LYL A;  2EJ9 A;  1YFR A;  3HY1 A;  12AS A;  2ZCE A;  1X2G A;  4XTZ A;  3QTC A;  3VQX A;  4XTX A;  4P74 C;  4YRT A;  4WI1 A;  4XU1 A;  3A7R A;  3P8Y A;  4WJ3 M;  4EX5 A;  3A5Y A;  4H2S A;  4XTV A;  1X01 A;  4RQE A;  3TEH A;  1BIB A;  2ZIO A;  3HXV A;  5F5W A;  1WLE A;  2IY5 B;  2EJF A;  2RHQ A;  1G51 A;  1EVK A;  3A7U A;  3EFS A;  3RKW A;  2DQ3 A;  4HWS A;  4YDQ A;  4UP9 A;  3G1Z A;  4L87 A;  3NEM A;  3RUX A;  4Q6G A;  2I4L A;  2DXU A;  2ZIN A;  4RDX A;  2ZT6 A;  2E3C A;  2EJG A;  3P8V A;  3R07 A;  1B7Y B;  3V8J A;  4YYE A;  3NEN A;  2Q7E A;  3QNE A;  3RKX A;  4YCW A;  3RGL A;  1ATI A;  1NJ6 A;  1WQW A;  2E1H A;  2ALY A;  2E41 A;  1L0W A;  4YRS A;  4TQD A;  2E10 A;  4TVW A;  4H2U A;  3NET A;  4BWA A;  5HGQ A;  1WPY A;  3CMQ A;  1NJ5 A;  4CH4 A;  2CIM A;  4XEM A;  1ADY A;  4H2W A;  1G5I A;  4CS3 A;  4XTY A;  4P74 A;  3L2Z A;  3OD1 A;  3UH0 A;  4YRI A;  4XU2 A;  4P73 C;  3VBB A;  1USY C;  2DZ9 A;  2DTH A;  2C8M A;  3QO8 A;  4UP7 A;  1X55 A;  4OP0 A;  1WNL A;  1YGB A;  4P75 C;  3KFU A;  1NJ1 A;  5ELN A;  4TVA A;  4YRG A;  1H4V B;  2DJZ A;  3FJP A;  4K88 A;  4K87 A;  3RIR A;  4UP8 A;  1YFS A;  1JJC A;  4YRN A;  4G84 A;  4XU0 A;  1PYS A;  4XTU A;  2DDZ A;  4TWA A;  5K1X A;  1ASY A;  3HXZ A;  4YCU A;  3TEH B;  2ZIM A;  2AMC A;  1SRY A;  1NYQ A;  4DPG A;  2RHQ B;  1E24 A;  3A31 A;  1B76 A;  2J3L A;  4YP0 A;  4HVC A;  3TEG A;  1B8A A;  3BFM A;  1HC7 A;  4YRK A;  3VQV A;  4WJ4 A;  1KMN A;  2ZGW A;  3ICA A;  2Q5H A;  1E22 A;  1X56 A;  2P0L A;  3HTZ A;  3RAC A;  5C52 B;  4P73 A;  4CH5 A;  4HWO A;  1USY A;  1QE0 A;  3I7F A;  2ARU A;  1Z7M A;  4YRR A;  4P75 A;  4DQ2 A;  4NCX A;  2G4C A;  2ZT5 A;  3VQY A;  2QHU A;  2ALY B;  3HFZ A;  3WQZ A;  3A32 A;  4E51 A;  4CS2 A;  3HXX A;  4AH6 A;  3L4G A;  4H2X A;  4OLF A;  1BIA A;  2Q7G A;  5ELO A;  1C0A A;  3NEL A;  2XTI A;  4HWT A;  4P72 C;  2ARS A;  4HWP A;  4ZIB A;  1RIQ A;  4YPF A;  4ZTZ B;  2ZT8 A;  1EVL A;  2QHT A;  3QO5 A;  2AKW A;  2I4N A;  4P71 C;  5C53 B;  2HNI A;  4TTV A;  2CJA A;  3PZC A;  4TVA B;  4ZTU B;  3DSQ A;  4LVK A;  4PG3 A;  4CH6 A;  2I4M A;  3VQW A;  3MF1 A;  3V8K A;  2DQ0 A;  4LVL A;  4KR3 A;  1EOV A;  4YRQ A;  1H4Q A;  1JJC B;  4O2D A;  4H2V A;  4HA8 A;  3MEY A;  3LSS A;  2E5A A;  3LC0 A;  4CH3 A;  4HT4 A;  1PYS B;  2EL9 A;  4XU3 A;  2CJB A;  3A7A A;  4YCV A;  1WU7 A;  3PCO A;  1Z7N A;  2DTI A;  2AMC B;  2RHS A;  1W66 A;  4YRM A;  4RMF A;  5E3I A;  2ODR D;  2XGT A;  4HWR A;  4LVJ A;  1NJ2 A;  1KMM A;  3RKY A;  1IL2 A;  2Q5I A;  2NS6 A;  2DZC A;  3TUP A;  4RQF A;  4H2Y A;  3MF2 A;  4G85 A;  2ZT7 A;  4PHC A;  1FYF A;  2FYK A;  4P72 A;  3RF1 A;  2J3M A;  1WQ7 A;  4YRC A;  3UFG A;  1X2H A;  2DVE A;  3M4Q A;  1E1T A;  2CGH A;  4LVI A;  1H4S A;  3W3S A;  2I4O A;  2E64 A;  4P3O A;  4P71 A;  4TQF A;  1B70 A;  3HFZ B;  5K1P A;  3HXY A;  3UGT A;  3HFV A;  4YRE A;  3L4G B;  4XEO A;  4CS4 A;  4H2X B;  2ODR C;  2DXT A;  2ZZG A;  1NYR A;  1NNH A;  4WF2 A;  2ZNJ A;  2P5I A;  3QO7 A;  3V7R A;  11AS A;  1H4T A;  4UPA A;  3A5Z A;  1E1O A;  4EO4 A;  1HTT A;  2AKW B;  1ASZ A; 
#chains in the Genus database with same CATH homology
 2ZZF A;  4XTW A;  3REX A;  1EIY B;  3IKL A;  4X5O A;  1G5H A;  2PME A;  4LVM A;  1BBU A;  2IY5 A;  2DEQ A;  1SES A;  3IAL A;  1KOG A;  4P3N A;  3EFR A;  1SER A;  4KQE A;  2DKG A;  1N9W A;  4J15 A;  4K86 A;  1GGM A;  3UGQ A;  1WYD A;  3BJU A;  1QF6 A;  3RL6 A;  1YB3 A;  1HXD A;  1EIY A;  3V7S A;  4H2T A;  2E65 A;  3V7C A;  4YRL A;  3HXU A;  3P8T A;  3A74 A;  3ERR A;  2EWN A;  3MQZ A;  2ZZE A;  1EFW A;  1ADJ A;  4BW9 A;  1EQR A;  4Q15 A;  3PCO B;  5C51 B;  3IG2 A;  1B7Y A;  2DU7 A;  2CJ9 A;  2RHS B;  1YFT A;  4TVY A;  3M4P A;  3E9H A;  3HXW A;  1VQZ A;  2ZR3 A;  1BBW A;  3HRK A;  4YRJ A;  3L1A A;  2QHS A;  3HRI A;  1X54 A;  3V8L A;  2A8E A;  1J5W A;  1NJ8 A;  3E9I A;  2DTO A;  2C7I A;  2ART A;  2Q7H A;  2DU5 A;  2ZTG A;  4LNS A;  4YRO A;  4H02 A;  3REU A;  2EAY A;  3IKM B;  4YRP A;  4KR2 A;  2ZNI A;  4P3P A;  2QHV A;  2ZXF A;  2PMF A;  1B70 B;  3HY0 A;  4YRF A;  3LSQ A;  2ZR2 A;  1SET A;  5KNN A;  1LYL A;  2EJ9 A;  1YFR A;  3HY1 A;  12AS A;  2ZCE A;  1X2G A;  4XTZ A;  3QTC A;  3VQX A;  4XTX A;  4P74 C;  4YRT A;  4WI1 A;  4XU1 A;  3A7R A;  3P8Y A;  4WJ3 M;  4EX5 A;  3A5Y A;  4H2S A;  4XTV A;  1X01 A;  4RQE A;  3TEH A;  1BIB A;  2ZIO A;  3HXV A;  5F5W A;  1WLE A;  2IY5 B;  2EJF A;  2RHQ A;  1G51 A;  1EVK A;  3A7U A;  3EFS A;  3RKW A;  2DQ3 A;  4HWS A;  4YDQ A;  4UP9 A;  3G1Z A;  4L87 A;  3NEM A;  3RUX A;  4Q6G A;  2I4L A;  2DXU A;  2ZIN A;  4RDX A;  2ZT6 A;  2E3C A;  2EJG A;  3P8V A;  3R07 A;  1B7Y B;  3V8J A;  4YYE A;  3NEN A;  2Q7E A;  3QNE A;  3RKX A;  4YCW A;  3RGL A;  1ATI A;  1NJ6 A;  1WQW A;  2E1H A;  2ALY A;  2E41 A;  1L0W A;  4YRS A;  4TQD A;  2E10 A;  4TVW A;  4H2U A;  3NET A;  4BWA A;  5HGQ A;  1WPY A;  3CMQ A;  1NJ5 A;  4CH4 A;  2CIM A;  4XEM A;  1ADY A;  4H2W A;  1G5I A;  4CS3 A;  4XTY A;  4P74 A;  3L2Z A;  3OD1 A;  3UH0 A;  4YRI A;  4XU2 A;  4P73 C;  3VBB A;  1USY C;  2DZ9 A;  2DTH A;  2C8M A;  3QO8 A;  4UP7 A;  1X55 A;  4OP0 A;  1WNL A;  1YGB A;  4P75 C;  3KFU A;  1NJ1 A;  5ELN A;  4TVA A;  4YRG A;  1H4V B;  2DJZ A;  3FJP A;  4K88 A;  4K87 A;  3RIR A;  4UP8 A;  1YFS A;  1JJC A;  4YRN A;  4G84 A;  4XU0 A;  1PYS A;  4XTU A;  2DDZ A;  4TWA A;  5K1X A;  1ASY A;  3HXZ A;  4YCU A;  3TEH B;  2ZIM A;  2AMC A;  1SRY A;  1NYQ A;  4DPG A;  2RHQ B;  1E24 A;  3A31 A;  1B76 A;  2J3L A;  4YP0 A;  4HVC A;  3TEG A;  1B8A A;  3BFM A;  1HC7 A;  4YRK A;  3VQV A;  4WJ4 A;  1KMN A;  2ZGW A;  3ICA A;  2Q5H A;  1E22 A;  1X56 A;  2P0L A;  3HTZ A;  3RAC A;  5C52 B;  4P73 A;  4CH5 A;  4HWO A;  1USY A;  1QE0 A;  3I7F A;  2ARU A;  1Z7M A;  4YRR A;  4P75 A;  4DQ2 A;  4NCX A;  2G4C A;  2ZT5 A;  3VQY A;  2QHU A;  2ALY B;  3HFZ A;  3WQZ A;  3A32 A;  4E51 A;  4CS2 A;  3HXX A;  4AH6 A;  3L4G A;  4H2X A;  4OLF A;  1BIA A;  2Q7G A;  5ELO A;  1C0A A;  3NEL A;  2XTI A;  4HWT A;  4P72 C;  2ARS A;  4HWP A;  4ZIB A;  1RIQ A;  4YPF A;  4ZTZ B;  2ZT8 A;  1EVL A;  2QHT A;  3QO5 A;  2AKW A;  2I4N A;  4P71 C;  5C53 B;  2HNI A;  4TTV A;  2CJA A;  3PZC A;  4TVA B;  4ZTU B;  3DSQ A;  4LVK A;  4PG3 A;  4CH6 A;  2I4M A;  3VQW A;  3MF1 A;  3V8K A;  2DQ0 A;  4LVL A;  4KR3 A;  1EOV A;  4YRQ A;  1H4Q A;  1JJC B;  4O2D A;  4H2V A;  4HA8 A;  3MEY A;  3LSS A;  2E5A A;  3LC0 A;  4CH3 A;  4HT4 A;  1PYS B;  2EL9 A;  4XU3 A;  2CJB A;  3A7A A;  4YCV A;  1WU7 A;  3PCO A;  1Z7N A;  2DTI A;  2AMC B;  2RHS A;  1W66 A;  4YRM A;  4RMF A;  5E3I A;  2ODR D;  2XGT A;  4HWR A;  4LVJ A;  1NJ2 A;  1KMM A;  3RKY A;  1IL2 A;  2Q5I A;  2NS6 A;  2DZC A;  3TUP A;  4RQF A;  4H2Y A;  3MF2 A;  4G85 A;  2ZT7 A;  4PHC A;  1FYF A;  2FYK A;  4P72 A;  3RF1 A;  2J3M A;  1WQ7 A;  4YRC A;  3UFG A;  1X2H A;  2DVE A;  3M4Q A;  1E1T A;  2CGH A;  4LVI A;  1H4S A;  3W3S A;  2I4O A;  2E64 A;  4P3O A;  4P71 A;  4TQF A;  1B70 A;  3HFZ B;  5K1P A;  3HXY A;  3UGT A;  3HFV A;  4YRE A;  3L4G B;  4XEO A;  4CS4 A;  4H2X B;  2ODR C;  2DXT A;  2ZZG A;  1NYR A;  1NNH A;  4WF2 A;  2ZNJ A;  2P5I A;  3QO7 A;  3V7R A;  11AS A;  1H4T A;  4UPA A;  3A5Z A;  1E1O A;  4EO4 A;  1HTT A;  2AKW B;  1ASZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...