1Z7NA

Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
313
Chain Sequence
YLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP phosphoribosyltransferase regulatory subunit
publication title Activation of the hetero-octameric ATP phosphoribosyl transferase through subunit interface rearrangement by a tRNA synthetase paralog.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transferase
total genus 98
structure length 313
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1z7nA00
1EQRA 4XU2A 4YCVA 4XTVA 1YB3A 4CH3A 4H2XB 2RHQB 4TVWA 1SESA 2Q7HA 4P73C 3HTZA 4H2WA 3TUPA 4LNSA 1B7YA 1EOVA 3FJPA 3UGTA 1B70A 4AH6A 4CH4A 1Z7MA 4P74C 3UFGA 3RKWA 2DU7A 1ADJA 2EL9A 3VQVA 1E22A 1NJ1A 2QHTA 4BW9A 2DTOA 1X56A 2DJZA 4YDQA 3HFZA 1L0WA 3A7RA 4TQFA 3BJUA 4H2SA 4YRMA 1ATIA 4YRFA 4RQEA 3NETA 4E51A 5K1PA 2AKWA 1ASYA 2J3LA 4H02A 4TVYA 4CS3A 4J15A 3L2ZA 4XU0A 4RQFA 4UP8A 1SRYA 1EIYA 1NNHA 4WJ4A 1B7YB 1BIBA 2DZCA 1ASZA 1B70B 3VQYA 4HVCA 3RF1A 4YRQA 1VQZA 2E65A 2DTHA 4HA8A 2ODRC 5KNNA 4HWRA 5HGQA 1NYRA 4YPFA 4P3PA 2ZZEA 1HC7A 1BIAA 4H2YA 1QF6A 3HFZB 4XTUA 4UP7A 4YRRA 1GGMA 4YRNA 4H2TA 2E10A 2ZT7A 1BBWA 3UGQA 3NELA 2AKWB 4P72A 1H4SA 2E3CA 1X2HA 2ZINA 4TVAA 1X01A 1FYFA 1WNLA 3VBBA 2FYKA 3HRKA 2ZR2A 3L1AA 4HWSA 2E5AA 4ZTUB 3IG2A 3M4QA 4YROA 2EWNA 2ZNJA 2ZT8A 2ZT5A 2ZGWA 3P8TA 2I4NA 2DVEA 4XTWA 5F5WA 3A7AA 2DKGA 3NENA 4KR3A 3MEYA 5C51B 1HTTA 4H2UA 2I4LA 1RIQA 4PG3A 4P75C 2Q5HA 3RGLA 3ICAA 3L4GA 3HXXA 3PCOA 3M4PA 2DQ3A 1H4QA 1LYLA 3IKMB 4TVAB 1X55A 2QHVA 2E1HA 2RHSA 1WQWA 3OD1A 4EX5A 2ARSA 3R07A 2ZZGA 4G85A 1JJCA 2QHUA 2ALYB 1NJ2A 3HXVA 2QHSA 4K86A 3V7RA 1C0AA 2I4OA 3QO5A 3QO8A 3PZCA 2CGHA 3LSSA 4Q15A 3V8JA 3W3SA 4YRKA 3MF1A 3MF2A 2P0LA 3L4GB 1USYA 3PCOB 1NJ6A 4CH6A 3HXUA 4WI1A 4XEMA 1EVKA 4NCXA 1NJ5A 2Q5IA 3HY1A 3A5ZA 4HWTA 4XU3A 2RHSB 3TEHB 2EJFA 2ZNIA 2IY5B 1JJCB 4CH5A 3P8VA 1EFWA 4TWAA 4KQEA 1X2GA 2DXTA 3A32A 4YCUA 2ARTA 4WJ3M 4KR2A 1B76A 1G5HA 2C8MA 3A74A 4OLFA 4Q6GA 3V7SA 2Q7GA 3EFRA 1H4TA 4CS4A 3RKYA 1WU7A 12ASA 1KOGA 3HFVA 2G4CA 4RMFA 2E64A 1WQ7A 1WYDA 3V8LA 2AMCB 3QNEA 3NEMA 2I4MA 4ZTZB 2CJAA 4P73A 4P71C 4HWOA 4HWPA 2Q7EA 2ALYA 3P8YA 1NJ8A 1SETA 4DQ2A 5ELNA 4P74A 2ARUA 4XTYA 3HRIA 4P3OA 3E9IA 1NYQA 3HXWA 4YRIA 1BBUA 4K87A 3A7UA 2PMEA 4RDXA 3RKXA 5C53B 1PYSA 1YFSA 3HXZA 1N9WA 4TTVA 2C7IA 1E24A 2ZTGA 4XEOA 2ZT6A 3REUA 2EJGA 2CJ9A 11ASA 3RL6A 1E1OA 3IKLA 3TEHA 2ZCEA 3REXA 2HNIA 2IY5A 2DDZA 2J3MA 1E1TA 1Z7NA 2CJBA 4BWAA 1EVLA 4H2VA 2DU5A 2DTIA 2ZXFA 3BFMA 4UP9A 3A5YA 5C52B 1H4VB 3QTCA 5ELOA 2XGTA 4P3NA 4O2DA 3LSQA 3RUXA 1YFTA 3E9HA 4XTXA 3UH0A 1IL2A 1PYSB 4YRPA 1SERA 4XU1A 4G84A 1B8AA 3EFSA 2XTIA 3LC0A 3VQWA 3DSQA 2ZIMA 2AMCA 3IALA 4YP0A 3HY0A 2ZZFA 3G1ZA 5K1XA 1G51A 3KFUA 1X54A 4P71A 3V8KA 1J5WA 2ODRD 1HXDA 2DQ0A 1WLEA 1KMMA 3ERRA 3I7FA 4K88A 4DPGA 4TQDA 1QE0A 4P75A 4YRCA 3TEGA 3WQZA 2P5IA 4PHCA 2EAYA 3VQXA 1USYC 4YREA 1YFRA 1YGBA 3A31A 4YRGA 2ZR3A 2PMFA 3V7CA 4EO4A 4H2XA 2RHQA 2CIMA 3CMQA 3HXYA 1G5IA 2ZIOA 4CS2A 4YRJA 3RIRA 2DZ9A 4L87A 1EIYB 2EJ9A 2E41A 2DEQA 4YRSA 2DXUA 4X5OA 4OP0A 3QO7A 4YYEA 5E3IA 3RACA 4UPAA 4ZIBA 1WPYA 1KMNA 1W66A 4YRTA 4P72C 4WF2A 4XTZA 4YCWA 4YRLA 1ADYA
chains in the Genus database with same CATH superfamily
1EQRA 4XU2A 4YCVA 4XTVA 1YB3A 4CH3A 4H2XB 2RHQB 4TVWA 1SESA 2Q7HA 4P73C 3HTZA 4H2WA 3TUPA 4LNSA 1B7YA 1EOVA 3FJPA 3UGTA 1B70A 4AH6A 4CH4A 1Z7MA 4P74C 3UFGA 3RKWA 4LVMA 2DU7A 1ADJA 2EL9A 3VQVA 1E22A 1NJ1A 2QHTA 4BW9A 2DTOA 1X56A 2DJZA 4YDQA 3HFZA 1L0WA 3A7RA 4TQFA 3BJUA 4H2SA 4YRMA 1ATIA 4YRFA 4RQEA 3NETA 4E51A 5K1PA 2AKWA 1ASYA 2J3LA 4H02A 4TVYA 4CS3A 4J15A 3L2ZA 4XU0A 4RQFA 4UP8A 1SRYA 1EIYA 1NNHA 4WJ4A 1B7YB 1BIBA 2DZCA 1ASZA 1B70B 3VQYA 4HVCA 3RF1A 4YRQA 1VQZA 2E65A 2DTHA 4HA8A 2ODRC 5KNNA 4HWRA 5HGQA 1NYRA 4YPFA 4P3PA 2ZZEA 1HC7A 1BIAA 4H2YA 1QF6A 3HFZB 4XTUA 4UP7A 4YRRA 1GGMA 4YRNA 4H2TA 2E10A 2ZT7A 1BBWA 3UGQA 3NELA 2AKWB 4P72A 1H4SA 2E3CA 4HT4A 1X2HA 2ZINA 4TVAA 1X01A 1FYFA 1WNLA 3VBBA 2FYKA 3HRKA 2ZR2A 3L1AA 4HWSA 2E5AA 4ZTUB 3IG2A 3M4QA 4YROA 2EWNA 2ZNJA 2ZT8A 2ZT5A 2ZGWA 3P8TA 2I4NA 2DVEA 4XTWA 5F5WA 3A7AA 2DKGA 3NENA 4KR3A 3MEYA 5C51B 1HTTA 4H2UA 2I4LA 1RIQA 4PG3A 4P75C 2Q5HA 3RGLA 3ICAA 3L4GA 3HXXA 3PCOA 3M4PA 2DQ3A 1H4QA 2A8EA 1LYLA 3IKMB 4TVAB 1X55A 2QHVA 2E1HA 2RHSA 1WQWA 3OD1A 4EX5A 2ARSA 3R07A 2ZZGA 4G85A 1JJCA 2QHUA 2ALYB 1NJ2A 3HXVA 2QHSA 4K86A 3V7RA 1C0AA 2I4OA 3QO5A 3QO8A 3PZCA 2CGHA 3LSSA 4Q15A 3V8JA 3W3SA 4YRKA 3MF1A 3MF2A 2P0LA 3L4GB 1USYA 3PCOB 1NJ6A 4CH6A 3HXUA 4WI1A 4XEMA 1EVKA 4NCXA 1NJ5A 2Q5IA 3HY1A 3A5ZA 4HWTA 4XU3A 2RHSB 3TEHB 2EJFA 2ZNIA 2IY5B 1JJCB 4CH5A 3P8VA 1EFWA 4TWAA 4KQEA 1X2GA 2DXTA 3A32A 4YCUA 2ARTA 4WJ3M 4KR2A 1B76A 1G5HA 2C8MA 3A74A 4LVJA 4OLFA 4Q6GA 3V7SA 2Q7GA 3EFRA 1H4TA 4CS4A 3RKYA 1WU7A 12ASA 1KOGA 3HFVA 2G4CA 4RMFA 2E64A 1WQ7A 1WYDA 3V8LA 2AMCB 3QNEA 3NEMA 2I4MA 4ZTZB 2CJAA 4P73A 4P71C 4HWOA 4HWPA 2Q7EA 2ALYA 3P8YA 1NJ8A 1SETA 4DQ2A 5ELNA 4P74A 2ARUA 4XTYA 3HRIA 4P3OA 2NS6A 3E9IA 1NYQA 3HXWA 4YRIA 1BBUA 4K87A 3A7UA 2PMEA 4RDXA 3RKXA 5C53B 1PYSA 1YFSA 3HXZA 1N9WA 4TTVA 2C7IA 1E24A 2ZTGA 4XEOA 2ZT6A 3REUA 2EJGA 4LVKA 2CJ9A 11ASA 3RL6A 1E1OA 3IKLA 3TEHA 2ZCEA 3REXA 2HNIA 2IY5A 2DDZA 2J3MA 1E1TA 1Z7NA 2CJBA 4BWAA 1EVLA 4H2VA 2DU5A 2DTIA 2ZXFA 3BFMA 4UP9A 3A5YA 5C52B 1H4VB 3QTCA 5ELOA 2XGTA 4P3NA 4O2DA 3LSQA 3RUXA 1YFTA 3E9HA 4XTXA 3MQZA 3UH0A 1IL2A 1PYSB 4YRPA 1SERA 4XU1A 4G84A 1B8AA 3EFSA 2XTIA 3LC0A 3VQWA 3DSQA 2ZIMA 2AMCA 3IALA 4LVIA 4YP0A 3HY0A 2ZZFA 3G1ZA 5K1XA 1G51A 3KFUA 1X54A 4P71A 3V8KA 1J5WA 2ODRD 1HXDA 2DQ0A 1WLEA 1KMMA 3ERRA 3I7FA 4K88A 4DPGA 4TQDA 1QE0A 4P75A 4YRCA 3TEGA 3WQZA 2P5IA 4PHCA 2EAYA 3VQXA 1USYC 4YREA 1YFRA 1YGBA 3A31A 4YRGA 2ZR3A 2PMFA 3V7CA 4EO4A 4H2XA 2RHQA 2CIMA 3CMQA 3HXYA 1G5IA 2ZIOA 4CS2A 4YRJA 3RIRA 2DZ9A 4L87A 4LVLA 1EIYB 2EJ9A 2E41A 2DEQA 4YRSA 2DXUA 4X5OA 4OP0A 3QO7A 4YYEA 5E3IA 3RACA 4UPAA 4ZIBA 1WPYA 1KMNA 1W66A 4YRTA 4P72C 4WF2A 4XTZA 4YCWA 4YRLA 1ADYA
chains in the Genus database with same CATH topology
1EQRA 4XU2A 4YCVA 4XTVA 1YB3A 4CH3A 4H2XB 2RHQB 4TVWA 1SESA 2Q7HA 4P73C 3HTZA 4H2WA 3TUPA 4LNSA 1B7YA 1EOVA 3FJPA 3UGTA 1B70A 4AH6A 4CH4A 1Z7MA 4P74C 3UFGA 3RKWA 4LVMA 2DU7A 1ADJA 2EL9A 3VQVA 1E22A 1NJ1A 2QHTA 4BW9A 2DTOA 1X56A 2DJZA 4YDQA 3HFZA 1L0WA 3A7RA 4TQFA 3BJUA 4H2SA 4YRMA 1ATIA 4YRFA 4RQEA 3NETA 4E51A 5K1PA 2AKWA 1ASYA 2J3LA 4H02A 4TVYA 4CS3A 4J15A 3L2ZA 4XU0A 4RQFA 4UP8A 1SRYA 1EIYA 1NNHA 4WJ4A 1B7YB 1BIBA 2DZCA 1ASZA 1B70B 3VQYA 4HVCA 3RF1A 4YRQA 1VQZA 2E65A 2DTHA 4HA8A 2ODRC 5KNNA 4HWRA 5HGQA 1NYRA 4YPFA 4P3PA 2ZZEA 1HC7A 1BIAA 4H2YA 1QF6A 3HFZB 4XTUA 4UP7A 4YRRA 1GGMA 4YRNA 4H2TA 2E10A 2ZT7A 1BBWA 3UGQA 3NELA 2AKWB 4P72A 1H4SA 2E3CA 4HT4A 1X2HA 2ZINA 4TVAA 1X01A 1FYFA 1WNLA 3VBBA 2FYKA 3HRKA 2ZR2A 3L1AA 4HWSA 2E5AA 4ZTUB 3IG2A 3M4QA 4YROA 2EWNA 2ZNJA 2ZT8A 2ZT5A 2ZGWA 3P8TA 2I4NA 2DVEA 4XTWA 5F5WA 3A7AA 2DKGA 3NENA 4KR3A 3MEYA 5C51B 1HTTA 4H2UA 2I4LA 1RIQA 4PG3A 4P75C 2Q5HA 3RGLA 3ICAA 3L4GA 3HXXA 3PCOA 3M4PA 2DQ3A 1H4QA 2A8EA 1LYLA 3IKMB 4TVAB 1X55A 2QHVA 2E1HA 2RHSA 1WQWA 3OD1A 4EX5A 2ARSA 3R07A 2ZZGA 4G85A 1JJCA 2QHUA 2ALYB 1NJ2A 3HXVA 2QHSA 4K86A 3V7RA 1C0AA 2I4OA 3QO5A 3QO8A 3PZCA 2CGHA 3LSSA 4Q15A 3V8JA 3W3SA 4YRKA 3MF1A 3MF2A 2P0LA 3L4GB 1USYA 3PCOB 1NJ6A 4CH6A 3HXUA 4WI1A 4XEMA 1EVKA 4NCXA 1NJ5A 2Q5IA 3HY1A 3A5ZA 4HWTA 4XU3A 2RHSB 3TEHB 2EJFA 2ZNIA 2IY5B 1JJCB 4CH5A 3P8VA 1EFWA 4TWAA 4KQEA 1X2GA 2DXTA 3A32A 4YCUA 2ARTA 4WJ3M 4KR2A 1B76A 1G5HA 2C8MA 3A74A 4LVJA 4OLFA 4Q6GA 3V7SA 2Q7GA 3EFRA 1H4TA 4CS4A 3RKYA 1WU7A 12ASA 1KOGA 3HFVA 2G4CA 4RMFA 2E64A 1WQ7A 1WYDA 3V8LA 2AMCB 3QNEA 3NEMA 2I4MA 4ZTZB 2CJAA 4P73A 4P71C 4HWOA 4HWPA 2Q7EA 2ALYA 3P8YA 1NJ8A 1SETA 4DQ2A 5ELNA 4P74A 2ARUA 4XTYA 3HRIA 4P3OA 2NS6A 3E9IA 1NYQA 3HXWA 4YRIA 1BBUA 4K87A 3A7UA 2PMEA 4RDXA 3RKXA 5C53B 1PYSA 1YFSA 3HXZA 1N9WA 4TTVA 2C7IA 1E24A 2ZTGA 4XEOA 2ZT6A 3REUA 2EJGA 4LVKA 2CJ9A 11ASA 3RL6A 1E1OA 3IKLA 3TEHA 2ZCEA 3REXA 2HNIA 2IY5A 2DDZA 2J3MA 1E1TA 1Z7NA 2CJBA 4BWAA 1EVLA 4H2VA 2DU5A 2DTIA 2ZXFA 3BFMA 4UP9A 3A5YA 5C52B 1H4VB 3QTCA 5ELOA 2XGTA 4P3NA 4O2DA 3LSQA 3RUXA 1YFTA 3E9HA 4XTXA 3MQZA 3UH0A 1IL2A 1PYSB 4YRPA 1SERA 4XU1A 4G84A 1B8AA 3EFSA 2XTIA 3LC0A 3VQWA 3DSQA 2ZIMA 2AMCA 3IALA 4LVIA 4YP0A 3HY0A 2ZZFA 3G1ZA 5K1XA 1G51A 3KFUA 1X54A 4P71A 3V8KA 1J5WA 2ODRD 1HXDA 2DQ0A 1WLEA 1KMMA 3ERRA 3I7FA 4K88A 4DPGA 4TQDA 1QE0A 4P75A 4YRCA 3TEGA 3WQZA 2P5IA 4PHCA 2EAYA 3VQXA 1USYC 4YREA 1YFRA 1YGBA 3A31A 4YRGA 2ZR3A 2PMFA 3V7CA 4EO4A 4H2XA 2RHQA 2CIMA 3CMQA 3HXYA 1G5IA 2ZIOA 4CS2A 4YRJA 3RIRA 2DZ9A 4L87A 4LVLA 1EIYB 2EJ9A 2E41A 2DEQA 4YRSA 2DXUA 4X5OA 4OP0A 3QO7A 4YYEA 5E3IA 3RACA 4UPAA 4ZIBA 1WPYA 1KMNA 1W66A 4YRTA 4P72C 4WF2A 4XTZA 4YCWA 4YRLA 1ADYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EQR A;  4XU2 A;  4YCV A;  4XTV A;  1YB3 A;  4CH3 A;  4H2X B;  2RHQ B;  4TVW A;  1SES A;  2Q7H A;  4P73 C;  3HTZ A;  4H2W A;  3TUP A;  4LNS A;  1B7Y A;  1EOV A;  3FJP A;  3UGT A;  1B70 A;  4AH6 A;  4CH4 A;  1Z7M A;  4P74 C;  3UFG A;  3RKW A;  2DU7 A;  1ADJ A;  2EL9 A;  3VQV A;  1E22 A;  1NJ1 A;  2QHT A;  4BW9 A;  2DTO A;  1X56 A;  2DJZ A;  4YDQ A;  3HFZ A;  1L0W A;  3A7R A;  4TQF A;  3BJU A;  4H2S A;  4YRM A;  1ATI A;  4YRF A;  4RQE A;  3NET A;  4E51 A;  5K1P A;  2AKW A;  1ASY A;  2J3L A;  4H02 A;  4TVY A;  4CS3 A;  4J15 A;  3L2Z A;  4XU0 A;  4RQF A;  4UP8 A;  1SRY A;  1EIY A;  1NNH A;  4WJ4 A;  1B7Y B;  1BIB A;  2DZC A;  1ASZ A;  1B70 B;  3VQY A;  4HVC A;  3RF1 A;  4YRQ A;  1VQZ A;  2E65 A;  2DTH A;  4HA8 A;  2ODR C;  5KNN A;  4HWR A;  5HGQ A;  1NYR A;  4YPF A;  4P3P A;  2ZZE A;  1HC7 A;  1BIA A;  4H2Y A;  1QF6 A;  3HFZ B;  4XTU A;  4UP7 A;  4YRR A;  1GGM A;  4YRN A;  4H2T A;  2E10 A;  2ZT7 A;  1BBW A;  3UGQ A;  3NEL A;  2AKW B;  4P72 A;  1H4S A;  2E3C A;  1X2H A;  2ZIN A;  4TVA A;  1X01 A;  1FYF A;  1WNL A;  3VBB A;  2FYK A;  3HRK A;  2ZR2 A;  3L1A A;  4HWS A;  2E5A A;  4ZTU B;  3IG2 A;  3M4Q A;  4YRO A;  2EWN A;  2ZNJ A;  2ZT8 A;  2ZT5 A;  2ZGW A;  3P8T A;  2I4N A;  2DVE A;  4XTW A;  5F5W A;  3A7A A;  2DKG A;  3NEN A;  4KR3 A;  3MEY A;  5C51 B;  1HTT A;  4H2U A;  2I4L A;  1RIQ A;  4PG3 A;  4P75 C;  2Q5H A;  3RGL A;  3ICA A;  3L4G A;  3HXX A;  3PCO A;  3M4P A;  2DQ3 A;  1H4Q A;  1LYL A;  3IKM B;  4TVA B;  1X55 A;  2QHV A;  2E1H A;  2RHS A;  1WQW A;  3OD1 A;  4EX5 A;  2ARS A;  3R07 A;  2ZZG A;  4G85 A;  1JJC A;  2QHU A;  2ALY B;  1NJ2 A;  3HXV A;  2QHS A;  4K86 A;  3V7R A;  1C0A A;  2I4O A;  3QO5 A;  3QO8 A;  3PZC A;  2CGH A;  3LSS A;  4Q15 A;  3V8J A;  3W3S A;  4YRK A;  3MF1 A;  3MF2 A;  2P0L A;  3L4G B;  1USY A;  3PCO B;  1NJ6 A;  4CH6 A;  3HXU A;  4WI1 A;  4XEM A;  1EVK A;  4NCX A;  1NJ5 A;  2Q5I A;  3HY1 A;  3A5Z A;  4HWT A;  4XU3 A;  2RHS B;  3TEH B;  2EJF A;  2ZNI A;  2IY5 B;  1JJC B;  4CH5 A;  3P8V A;  1EFW A;  4TWA A;  4KQE A;  1X2G A;  2DXT A;  3A32 A;  4YCU A;  2ART A;  4WJ3 M;  4KR2 A;  1B76 A;  1G5H A;  2C8M A;  3A74 A;  4OLF A;  4Q6G A;  3V7S A;  2Q7G A;  3EFR A;  1H4T A;  4CS4 A;  3RKY A;  1WU7 A;  12AS A;  1KOG A;  3HFV A;  2G4C A;  4RMF A;  2E64 A;  1WQ7 A;  1WYD A;  3V8L A;  2AMC B;  3QNE A;  3NEM A;  2I4M A;  4ZTZ B;  2CJA A;  4P73 A;  4P71 C;  4HWO A;  4HWP A;  2Q7E A;  2ALY A;  3P8Y A;  1NJ8 A;  1SET A;  4DQ2 A;  5ELN A;  4P74 A;  2ARU A;  4XTY A;  3HRI A;  4P3O A;  3E9I A;  1NYQ A;  3HXW A;  4YRI A;  1BBU A;  4K87 A;  3A7U A;  2PME A;  4RDX A;  3RKX A;  5C53 B;  1PYS A;  1YFS A;  3HXZ A;  1N9W A;  4TTV A;  2C7I A;  1E24 A;  2ZTG A;  4XEO A;  2ZT6 A;  3REU A;  2EJG A;  2CJ9 A;  11AS A;  3RL6 A;  1E1O A;  3IKL A;  3TEH A;  2ZCE A;  3REX A;  2HNI A;  2IY5 A;  2DDZ A;  2J3M A;  1E1T A;  1Z7N A;  2CJB A;  4BWA A;  1EVL A;  4H2V A;  2DU5 A;  2DTI A;  2ZXF A;  3BFM A;  4UP9 A;  3A5Y A;  5C52 B;  1H4V B;  3QTC A;  5ELO A;  2XGT A;  4P3N A;  4O2D A;  3LSQ A;  3RUX A;  1YFT A;  3E9H A;  4XTX A;  3UH0 A;  1IL2 A;  1PYS B;  4YRP A;  1SER A;  4XU1 A;  4G84 A;  1B8A A;  3EFS A;  2XTI A;  3LC0 A;  3VQW A;  3DSQ A;  2ZIM A;  2AMC A;  3IAL A;  4YP0 A;  3HY0 A;  2ZZF A;  3G1Z A;  5K1X A;  1G51 A;  3KFU A;  1X54 A;  4P71 A;  3V8K A;  1J5W A;  2ODR D;  1HXD A;  2DQ0 A;  1WLE A;  1KMM A;  3ERR A;  3I7F A;  4K88 A;  4DPG A;  4TQD A;  1QE0 A;  4P75 A;  4YRC A;  3TEG A;  3WQZ A;  2P5I A;  4PHC A;  2EAY A;  3VQX A;  1USY C;  4YRE A;  1YFR A;  1YGB A;  3A31 A;  4YRG A;  2ZR3 A;  2PMF A;  3V7C A;  4EO4 A;  4H2X A;  2RHQ A;  2CIM A;  3CMQ A;  3HXY A;  1G5I A;  2ZIO A;  4CS2 A;  4YRJ A;  3RIR A;  2DZ9 A;  4L87 A;  1EIY B;  2EJ9 A;  2E41 A;  2DEQ A;  4YRS A;  2DXU A;  4X5O A;  4OP0 A;  3QO7 A;  4YYE A;  5E3I A;  3RAC A;  4UPA A;  4ZIB A;  1WPY A;  1KMN A;  1W66 A;  4YRT A;  4P72 C;  4WF2 A;  4XTZ A;  4YCW A;  4YRL A;  1ADY A; 
#chains in the Genus database with same CATH topology
 1EQR A;  4XU2 A;  4YCV A;  4XTV A;  1YB3 A;  4CH3 A;  4H2X B;  2RHQ B;  4TVW A;  1SES A;  2Q7H A;  4P73 C;  3HTZ A;  4H2W A;  3TUP A;  4LNS A;  1B7Y A;  1EOV A;  3FJP A;  3UGT A;  1B70 A;  4AH6 A;  4CH4 A;  1Z7M A;  4P74 C;  3UFG A;  3RKW A;  4LVM A;  2DU7 A;  1ADJ A;  2EL9 A;  3VQV A;  1E22 A;  1NJ1 A;  2QHT A;  4BW9 A;  2DTO A;  1X56 A;  2DJZ A;  4YDQ A;  3HFZ A;  1L0W A;  3A7R A;  4TQF A;  3BJU A;  4H2S A;  4YRM A;  1ATI A;  4YRF A;  4RQE A;  3NET A;  4E51 A;  5K1P A;  2AKW A;  1ASY A;  2J3L A;  4H02 A;  4TVY A;  4CS3 A;  4J15 A;  3L2Z A;  4XU0 A;  4RQF A;  4UP8 A;  1SRY A;  1EIY A;  1NNH A;  4WJ4 A;  1B7Y B;  1BIB A;  2DZC A;  1ASZ A;  1B70 B;  3VQY A;  4HVC A;  3RF1 A;  4YRQ A;  1VQZ A;  2E65 A;  2DTH A;  4HA8 A;  2ODR C;  5KNN A;  4HWR A;  5HGQ A;  1NYR A;  4YPF A;  4P3P A;  2ZZE A;  1HC7 A;  1BIA A;  4H2Y A;  1QF6 A;  3HFZ B;  4XTU A;  4UP7 A;  4YRR A;  1GGM A;  4YRN A;  4H2T A;  2E10 A;  2ZT7 A;  1BBW A;  3UGQ A;  3NEL A;  2AKW B;  4P72 A;  1H4S A;  2E3C A;  4HT4 A;  1X2H A;  2ZIN A;  4TVA A;  1X01 A;  1FYF A;  1WNL A;  3VBB A;  2FYK A;  3HRK A;  2ZR2 A;  3L1A A;  4HWS A;  2E5A A;  4ZTU B;  3IG2 A;  3M4Q A;  4YRO A;  2EWN A;  2ZNJ A;  2ZT8 A;  2ZT5 A;  2ZGW A;  3P8T A;  2I4N A;  2DVE A;  4XTW A;  5F5W A;  3A7A A;  2DKG A;  3NEN A;  4KR3 A;  3MEY A;  5C51 B;  1HTT A;  4H2U A;  2I4L A;  1RIQ A;  4PG3 A;  4P75 C;  2Q5H A;  3RGL A;  3ICA A;  3L4G A;  3HXX A;  3PCO A;  3M4P A;  2DQ3 A;  1H4Q A;  2A8E A;  1LYL A;  3IKM B;  4TVA B;  1X55 A;  2QHV A;  2E1H A;  2RHS A;  1WQW A;  3OD1 A;  4EX5 A;  2ARS A;  3R07 A;  2ZZG A;  4G85 A;  1JJC A;  2QHU A;  2ALY B;  1NJ2 A;  3HXV A;  2QHS A;  4K86 A;  3V7R A;  1C0A A;  2I4O A;  3QO5 A;  3QO8 A;  3PZC A;  2CGH A;  3LSS A;  4Q15 A;  3V8J A;  3W3S A;  4YRK A;  3MF1 A;  3MF2 A;  2P0L A;  3L4G B;  1USY A;  3PCO B;  1NJ6 A;  4CH6 A;  3HXU A;  4WI1 A;  4XEM A;  1EVK A;  4NCX A;  1NJ5 A;  2Q5I A;  3HY1 A;  3A5Z A;  4HWT A;  4XU3 A;  2RHS B;  3TEH B;  2EJF A;  2ZNI A;  2IY5 B;  1JJC B;  4CH5 A;  3P8V A;  1EFW A;  4TWA A;  4KQE A;  1X2G A;  2DXT A;  3A32 A;  4YCU A;  2ART A;  4WJ3 M;  4KR2 A;  1B76 A;  1G5H A;  2C8M A;  3A74 A;  4LVJ A;  4OLF A;  4Q6G A;  3V7S A;  2Q7G A;  3EFR A;  1H4T A;  4CS4 A;  3RKY A;  1WU7 A;  12AS A;  1KOG A;  3HFV A;  2G4C A;  4RMF A;  2E64 A;  1WQ7 A;  1WYD A;  3V8L A;  2AMC B;  3QNE A;  3NEM A;  2I4M A;  4ZTZ B;  2CJA A;  4P73 A;  4P71 C;  4HWO A;  4HWP A;  2Q7E A;  2ALY A;  3P8Y A;  1NJ8 A;  1SET A;  4DQ2 A;  5ELN A;  4P74 A;  2ARU A;  4XTY A;  3HRI A;  4P3O A;  2NS6 A;  3E9I A;  1NYQ A;  3HXW A;  4YRI A;  1BBU A;  4K87 A;  3A7U A;  2PME A;  4RDX A;  3RKX A;  5C53 B;  1PYS A;  1YFS A;  3HXZ A;  1N9W A;  4TTV A;  2C7I A;  1E24 A;  2ZTG A;  4XEO A;  2ZT6 A;  3REU A;  2EJG A;  4LVK A;  2CJ9 A;  11AS A;  3RL6 A;  1E1O A;  3IKL A;  3TEH A;  2ZCE A;  3REX A;  2HNI A;  2IY5 A;  2DDZ A;  2J3M A;  1E1T A;  1Z7N A;  2CJB A;  4BWA A;  1EVL A;  4H2V A;  2DU5 A;  2DTI A;  2ZXF A;  3BFM A;  4UP9 A;  3A5Y A;  5C52 B;  1H4V B;  3QTC A;  5ELO A;  2XGT A;  4P3N A;  4O2D A;  3LSQ A;  3RUX A;  1YFT A;  3E9H A;  4XTX A;  3MQZ A;  3UH0 A;  1IL2 A;  1PYS B;  4YRP A;  1SER A;  4XU1 A;  4G84 A;  1B8A A;  3EFS A;  2XTI A;  3LC0 A;  3VQW A;  3DSQ A;  2ZIM A;  2AMC A;  3IAL A;  4LVI A;  4YP0 A;  3HY0 A;  2ZZF A;  3G1Z A;  5K1X A;  1G51 A;  3KFU A;  1X54 A;  4P71 A;  3V8K A;  1J5W A;  2ODR D;  1HXD A;  2DQ0 A;  1WLE A;  1KMM A;  3ERR A;  3I7F A;  4K88 A;  4DPG A;  4TQD A;  1QE0 A;  4P75 A;  4YRC A;  3TEG A;  3WQZ A;  2P5I A;  4PHC A;  2EAY A;  3VQX A;  1USY C;  4YRE A;  1YFR A;  1YGB A;  3A31 A;  4YRG A;  2ZR3 A;  2PMF A;  3V7C A;  4EO4 A;  4H2X A;  2RHQ A;  2CIM A;  3CMQ A;  3HXY A;  1G5I A;  2ZIO A;  4CS2 A;  4YRJ A;  3RIR A;  2DZ9 A;  4L87 A;  4LVL A;  1EIY B;  2EJ9 A;  2E41 A;  2DEQ A;  4YRS A;  2DXU A;  4X5O A;  4OP0 A;  3QO7 A;  4YYE A;  5E3I A;  3RAC A;  4UPA A;  4ZIB A;  1WPY A;  1KMN A;  1W66 A;  4YRT A;  4P72 C;  4WF2 A;  4XTZ A;  4YCW A;  4YRL A;  1ADY A; 
#chains in the Genus database with same CATH homology
 1EQR A;  4XU2 A;  4YCV A;  4XTV A;  1YB3 A;  4CH3 A;  4H2X B;  2RHQ B;  4TVW A;  1SES A;  2Q7H A;  4P73 C;  3HTZ A;  4H2W A;  3TUP A;  4LNS A;  1B7Y A;  1EOV A;  3FJP A;  3UGT A;  1B70 A;  4AH6 A;  4CH4 A;  1Z7M A;  4P74 C;  3UFG A;  3RKW A;  4LVM A;  2DU7 A;  1ADJ A;  2EL9 A;  3VQV A;  1E22 A;  1NJ1 A;  2QHT A;  4BW9 A;  2DTO A;  1X56 A;  2DJZ A;  4YDQ A;  3HFZ A;  1L0W A;  3A7R A;  4TQF A;  3BJU A;  4H2S A;  4YRM A;  1ATI A;  4YRF A;  4RQE A;  3NET A;  4E51 A;  5K1P A;  2AKW A;  1ASY A;  2J3L A;  4H02 A;  4TVY A;  4CS3 A;  4J15 A;  3L2Z A;  4XU0 A;  4RQF A;  4UP8 A;  1SRY A;  1EIY A;  1NNH A;  4WJ4 A;  1B7Y B;  1BIB A;  2DZC A;  1ASZ A;  1B70 B;  3VQY A;  4HVC A;  3RF1 A;  4YRQ A;  1VQZ A;  2E65 A;  2DTH A;  4HA8 A;  2ODR C;  5KNN A;  4HWR A;  5HGQ A;  1NYR A;  4YPF A;  4P3P A;  2ZZE A;  1HC7 A;  1BIA A;  4H2Y A;  1QF6 A;  3HFZ B;  4XTU A;  4UP7 A;  4YRR A;  1GGM A;  4YRN A;  4H2T A;  2E10 A;  2ZT7 A;  1BBW A;  3UGQ A;  3NEL A;  2AKW B;  4P72 A;  1H4S A;  2E3C A;  4HT4 A;  1X2H A;  2ZIN A;  4TVA A;  1X01 A;  1FYF A;  1WNL A;  3VBB A;  2FYK A;  3HRK A;  2ZR2 A;  3L1A A;  4HWS A;  2E5A A;  4ZTU B;  3IG2 A;  3M4Q A;  4YRO A;  2EWN A;  2ZNJ A;  2ZT8 A;  2ZT5 A;  2ZGW A;  3P8T A;  2I4N A;  2DVE A;  4XTW A;  5F5W A;  3A7A A;  2DKG A;  3NEN A;  4KR3 A;  3MEY A;  5C51 B;  1HTT A;  4H2U A;  2I4L A;  1RIQ A;  4PG3 A;  4P75 C;  2Q5H A;  3RGL A;  3ICA A;  3L4G A;  3HXX A;  3PCO A;  3M4P A;  2DQ3 A;  1H4Q A;  2A8E A;  1LYL A;  3IKM B;  4TVA B;  1X55 A;  2QHV A;  2E1H A;  2RHS A;  1WQW A;  3OD1 A;  4EX5 A;  2ARS A;  3R07 A;  2ZZG A;  4G85 A;  1JJC A;  2QHU A;  2ALY B;  1NJ2 A;  3HXV A;  2QHS A;  4K86 A;  3V7R A;  1C0A A;  2I4O A;  3QO5 A;  3QO8 A;  3PZC A;  2CGH A;  3LSS A;  4Q15 A;  3V8J A;  3W3S A;  4YRK A;  3MF1 A;  3MF2 A;  2P0L A;  3L4G B;  1USY A;  3PCO B;  1NJ6 A;  4CH6 A;  3HXU A;  4WI1 A;  4XEM A;  1EVK A;  4NCX A;  1NJ5 A;  2Q5I A;  3HY1 A;  3A5Z A;  4HWT A;  4XU3 A;  2RHS B;  3TEH B;  2EJF A;  2ZNI A;  2IY5 B;  1JJC B;  4CH5 A;  3P8V A;  1EFW A;  4TWA A;  4KQE A;  1X2G A;  2DXT A;  3A32 A;  4YCU A;  2ART A;  4WJ3 M;  4KR2 A;  1B76 A;  1G5H A;  2C8M A;  3A74 A;  4LVJ A;  4OLF A;  4Q6G A;  3V7S A;  2Q7G A;  3EFR A;  1H4T A;  4CS4 A;  3RKY A;  1WU7 A;  12AS A;  1KOG A;  3HFV A;  2G4C A;  4RMF A;  2E64 A;  1WQ7 A;  1WYD A;  3V8L A;  2AMC B;  3QNE A;  3NEM A;  2I4M A;  4ZTZ B;  2CJA A;  4P73 A;  4P71 C;  4HWO A;  4HWP A;  2Q7E A;  2ALY A;  3P8Y A;  1NJ8 A;  1SET A;  4DQ2 A;  5ELN A;  4P74 A;  2ARU A;  4XTY A;  3HRI A;  4P3O A;  2NS6 A;  3E9I A;  1NYQ A;  3HXW A;  4YRI A;  1BBU A;  4K87 A;  3A7U A;  2PME A;  4RDX A;  3RKX A;  5C53 B;  1PYS A;  1YFS A;  3HXZ A;  1N9W A;  4TTV A;  2C7I A;  1E24 A;  2ZTG A;  4XEO A;  2ZT6 A;  3REU A;  2EJG A;  4LVK A;  2CJ9 A;  11AS A;  3RL6 A;  1E1O A;  3IKL A;  3TEH A;  2ZCE A;  3REX A;  2HNI A;  2IY5 A;  2DDZ A;  2J3M A;  1E1T A;  1Z7N A;  2CJB A;  4BWA A;  1EVL A;  4H2V A;  2DU5 A;  2DTI A;  2ZXF A;  3BFM A;  4UP9 A;  3A5Y A;  5C52 B;  1H4V B;  3QTC A;  5ELO A;  2XGT A;  4P3N A;  4O2D A;  3LSQ A;  3RUX A;  1YFT A;  3E9H A;  4XTX A;  3MQZ A;  3UH0 A;  1IL2 A;  1PYS B;  4YRP A;  1SER A;  4XU1 A;  4G84 A;  1B8A A;  3EFS A;  2XTI A;  3LC0 A;  3VQW A;  3DSQ A;  2ZIM A;  2AMC A;  3IAL A;  4LVI A;  4YP0 A;  3HY0 A;  2ZZF A;  3G1Z A;  5K1X A;  1G51 A;  3KFU A;  1X54 A;  4P71 A;  3V8K A;  1J5W A;  2ODR D;  1HXD A;  2DQ0 A;  1WLE A;  1KMM A;  3ERR A;  3I7F A;  4K88 A;  4DPG A;  4TQD A;  1QE0 A;  4P75 A;  4YRC A;  3TEG A;  3WQZ A;  2P5I A;  4PHC A;  2EAY A;  3VQX A;  1USY C;  4YRE A;  1YFR A;  1YGB A;  3A31 A;  4YRG A;  2ZR3 A;  2PMF A;  3V7C A;  4EO4 A;  4H2X A;  2RHQ A;  2CIM A;  3CMQ A;  3HXY A;  1G5I A;  2ZIO A;  4CS2 A;  4YRJ A;  3RIR A;  2DZ9 A;  4L87 A;  4LVL A;  1EIY B;  2EJ9 A;  2E41 A;  2DEQ A;  4YRS A;  2DXU A;  4X5O A;  4OP0 A;  3QO7 A;  4YYE A;  5E3I A;  3RAC A;  4UPA A;  4ZIB A;  1WPY A;  1KMN A;  1W66 A;  4YRT A;  4P72 C;  4WF2 A;  4XTZ A;  4YCW A;  4YRL A;  1ADY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...