1Z7NA

Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
318
structure length
313
Chain Sequence
YLLPEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIKHEGQSITLRYDFTLPLVRLYSQIKDSTSARYSYFGKIFRKEKRHENYQIGIELFGESADKSELEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTELLLKKDLSGLNAFIEKNNFSKELRGLLKEIFITNELSRLENLVTNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLGMVPKMDYYTDLMFKAYSSAANQPILSGGRYDQLLSNFQEEAFAIGFCCHMDTILKALERQEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of the hetero-octameric ATP phosphoribosyl transferase through subunit interface rearrangement by a tRNA synthetase paralog.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transferase
molecule keywords ATP phosphoribosyltransferase regulatory subunit
total genus 98
structure length 313
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13393 tRNA-synt_His Histidyl-tRNA synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 1z7nA00
1GGMA 1H4SA 1NJ8A 5C51B 4YPFA 2CGHA 3QO7A 2DDZA 5K1PA 4J15A 3PZCA 1L0WA 3HRKA 3W3SA 1BIBA 2ZZGA 3DSQA 3I7FA 3REXA 1B8AA 1EQRA 4P72A 4XTXA 1B70B 2E1HA 1PYSA 1VQZA 4CS4A 2Q5HA 3P8TA 3V7CA 4RDXA 2CJBA 2EAYA 4XTVA 2ARTA 2DZ9A 3WQZA 2I4MA 4H2WA 3TEGA 4H2TA 2I4LA 3EFSA 4YREA 4P75C 4EX5A 1JJCB 4P3OA 2DTIA 4XU2A 4YRJA 2ZZEA 4H2XA 2ZR3A 3L4GA 3MEYA 1C0AA 1ADYA 3HFVA 2E64A 1BBWA 4YCUA 3IALA 2QHVA 3QO8A 1KOGA 1X2HA 2C8MA 2ODRC 2ZT5A 1BIAA 2E65A 2ZT6A 3QTCA 3VQWA 1E22A 1W66A 3OD1A 4XEMA 4OLFA 3HXUA 4TVAA 2XTIA 2ARUA 3A7RA 3VQYA 1J5WA 2ZNJA 5ELNA 5KNNA 1Z7MA 1LYLA 1YFRA 3RL6A 1X01A 3L2ZA 4TWAA 2ZZFA 1NJ6A 2AMCA 2EL9A 2DZCA 5F5WA 1WLEA 2PMFA 3HXWA 4E51A 3V7RA 3VBBA 4HA8A 4Q15A 1WQ7A 3CMQA 1B7YB 4DQ2A 3IKLA 1USYC 4HWPA 1KMNA 1N9WA 4XTUA 2AKWB 4NCXA 4YYEA 1HXDA 4XTWA 1ATIA 3P8YA 4WI1A 4XU1A 4TVAB 3MF2A 2IY5B 1H4TA 2ZINA 4CH4A 4P3NA 4BWAA 3NELA 4YRSA 2ALYB 4H2UA 4YCWA 3HXVA 2ZCEA 1EVKA 3RKYA 4P3PA 3UH0A 2CJ9A 2AKWA 2ZR2A 2EJFA 4YRNA 3A7AA 3HXYA 4YROA 1QE0A 4WF2A 2Q5IA 3NEMA 3L1AA 4H02A 1X55A 4H2VA 4YP0A 3A7UA 1WNLA 2ZT8A 3LC0A 1EVLA 4K88A 2P5IA 4EO4A 3BJUA 1B7YA 3UFGA 1RIQA 2C7IA 2IY5A 3VQVA 4L87A 1B76A 3UGTA 4RQEA 4P71A 2XGTA 3FJPA 2DJZA 2ZIOA 2RHSB 4KQEA 3NENA 4O2DA 2ZTGA 4OP0A 4YRFA 4XU3A 3V8LA 4P73C 1WPYA 2DU7A 1YFTA 4CH3A 4H2XB 1NJ2A 1H4VB 3HXZA 4HWRA 1B70A 4PHCA 3RKXA 1X56A 1ASZA 2E5AA 4TVYA 4TTVA 3KFUA 2I4OA 1Z7NA 2ZIMA 2HNIA 3A31A 3HY0A 4YRPA 2CIMA 2QHUA 2J3LA 1JJCA 1NJ1A 3G1ZA 3LSQA 3HRIA 4XTZA 1NYQA 1ASYA 4TVWA 1HC7A 5HGQA 4UP8A 1NYRA 1SETA 2QHTA 4CS3A 3ICAA 2PMEA 1EIYB 4ZTZB 4P74A 1HTTA 3NETA 3EFRA 11ASA 4P75A 4YRQA 3P8VA 4K86A 4G85A 1USYA 3HFZA 3A5ZA 3M4QA 3ERRA 4CH6A 4DPGA 1YGBA 4HVCA 4YRCA 3RIRA 2Q7EA 4XTYA 5ELOA 1NNHA 1SESA 4P74C 1G5IA 1QF6A 3A74A 3RUXA 1KMMA 3V8JA 2DEQA 2DVEA 3UGQA 1IL2A 3R07A 3TEHB 3A5YA 1H4QA 1E24A 2ZXFA 2DKGA 5C53B 2RHSA 2I4NA 4AH6A 1G5HA 1G51A 2E10A 4H2YA 1WQWA 3RGLA 4YRKA 1SERA 4BW9A 1EIYA 12ASA 3V8KA 4UP9A 3IKMB 3RKWA 3TEHA 1SRYA 2J3MA 1WYDA 3QO5A 2P0LA 4Q6GA 1X2GA 4HWSA 4RQFA 3A32A 2DXTA 3REUA 3V7SA 3PCOA 4UP7A 4UPAA 4YRGA 4RMFA 4PG3A 1WU7A 2QHSA 1ADJA 2E3CA 2DTOA 2RHQB 2EJ9A 2ODRD 4LNSA 3TUPA 4CH5A 2Q7HA 4YRLA 1YFSA 4HWOA 1FYFA 2ALYA 3MF1A 3BFMA 4ZIBA 1EFWA 2DXUA 3RF1A 4G84A 2Q7GA 2DU5A 2CJAA 3PCOB 4P73A 4YRTA 4KR3A 1E1TA 3HTZA 2EWNA 4TQFA 4XU0A 4YDQA 4XEOA 5E3IA 1NJ5A 2AMCB 2DTHA 3HXXA 5K1XA 4P71C 4WJ4A 3E9IA 3VQXA 4H2SA 1BBUA 3IG2A 2ARSA 3RACA 2E41A 1E1OA 2FYKA 3E9HA 4KR2A 4YRIA 2G4CA 2DQ3A 4P72C 3LSSA 1X54A 2RHQA 2ZNIA 4ZTUB 5C52B 4TQDA 4X5OA 2ZT7A 3QNEA 2EJGA 3HFZB 4YCVA 1YB3A 4K87A 3L4GB 4CS2A 4WJ3M 4HWTA 1PYSB 3M4PA 4YRMA 2ZGWA 1EOVA 2DQ0A 4YRRA 3HY1A
chains in the Genus database with same CATH superfamily
1GGMA 1H4SA 1NJ8A 5C51B 4YPFA 2CGHA 3QO7A 2DDZA 5K1PA 4J15A 3PZCA 1L0WA 3HRKA 3W3SA 1BIBA 2ZZGA 3DSQA 3I7FA 3REXA 1B8AA 1EQRA 4P72A 4XTXA 1B70B 2E1HA 1PYSA 1VQZA 4CS4A 2Q5HA 3P8TA 3V7CA 4RDXA 2CJBA 2EAYA 4XTVA 2ARTA 2DZ9A 3WQZA 2I4MA 4H2WA 3TEGA 4H2TA 2I4LA 3EFSA 4YREA 4P75C 4EX5A 1JJCB 4P3OA 2DTIA 4XU2A 4YRJA 2ZZEA 4H2XA 2ZR3A 3L4GA 3MEYA 1C0AA 1ADYA 3HFVA 2E64A 1BBWA 3MQZA 4YCUA 3IALA 2QHVA 3QO8A 1KOGA 1X2HA 2C8MA 2ODRC 2ZT5A 1BIAA 2E65A 2ZT6A 3QTCA 3VQWA 1E22A 2NS6A 1W66A 3OD1A 4XEMA 4OLFA 3HXUA 4TVAA 2XTIA 2ARUA 3A7RA 3VQYA 1J5WA 2ZNJA 5ELNA 5KNNA 1Z7MA 1LYLA 1YFRA 3RL6A 1X01A 3L2ZA 4TWAA 2ZZFA 1NJ6A 2AMCA 2EL9A 2DZCA 5F5WA 1WLEA 2PMFA 3HXWA 4E51A 3V7RA 3VBBA 4HA8A 4Q15A 1WQ7A 3CMQA 1B7YB 4DQ2A 3IKLA 1USYC 4HWPA 1KMNA 1N9WA 4XTUA 2AKWB 4NCXA 4YYEA 1HXDA 4XTWA 1ATIA 3P8YA 4WI1A 4XU1A 4TVAB 3MF2A 2IY5B 1H4TA 2ZINA 4CH4A 4P3NA 4BWAA 3NELA 4YRSA 2ALYB 4H2UA 4YCWA 3HXVA 2ZCEA 1EVKA 3RKYA 4P3PA 3UH0A 2CJ9A 2AKWA 2ZR2A 2EJFA 4YRNA 3A7AA 3HXYA 4YROA 1QE0A 4LVMA 4WF2A 2Q5IA 3NEMA 3L1AA 4H02A 1X55A 4H2VA 4YP0A 3A7UA 1WNLA 2ZT8A 3LC0A 1EVLA 4K88A 2P5IA 4EO4A 3BJUA 1B7YA 3UFGA 1RIQA 2C7IA 2A8EA 2IY5A 3VQVA 4L87A 1B76A 3UGTA 4RQEA 4P71A 2XGTA 3FJPA 2DJZA 2ZIOA 2RHSB 4KQEA 3NENA 4O2DA 2ZTGA 4OP0A 4YRFA 4XU3A 3V8LA 4P73C 1WPYA 2DU7A 1YFTA 4CH3A 4H2XB 1NJ2A 1H4VB 3HXZA 4HWRA 1B70A 4PHCA 3RKXA 1X56A 1ASZA 2E5AA 4TVYA 4TTVA 3KFUA 2I4OA 1Z7NA 2ZIMA 2HNIA 3A31A 4LVKA 3HY0A 4YRPA 2CIMA 2QHUA 2J3LA 1JJCA 1NJ1A 3G1ZA 3LSQA 3HRIA 4XTZA 1NYQA 1ASYA 4TVWA 1HC7A 5HGQA 4UP8A 1NYRA 1SETA 2QHTA 4CS3A 3ICAA 2PMEA 1EIYB 4ZTZB 4P74A 1HTTA 3NETA 3EFRA 11ASA 4P75A 4YRQA 3P8VA 4K86A 4G85A 1USYA 3HFZA 3A5ZA 3M4QA 3ERRA 4CH6A 4DPGA 1YGBA 4HVCA 4YRCA 4LVIA 3RIRA 2Q7EA 4XTYA 5ELOA 1NNHA 1SESA 4P74C 4LVJA 1G5IA 1QF6A 3A74A 3RUXA 1KMMA 3V8JA 2DEQA 2DVEA 4LVLA 3UGQA 1IL2A 3R07A 3TEHB 3A5YA 1H4QA 1E24A 2ZXFA 2DKGA 5C53B 2RHSA 2I4NA 4AH6A 1G5HA 1G51A 2E10A 4H2YA 4HT4A 1WQWA 3RGLA 4YRKA 1SERA 4BW9A 1EIYA 12ASA 3V8KA 4UP9A 3IKMB 3RKWA 3TEHA 1SRYA 2J3MA 1WYDA 3QO5A 2P0LA 4Q6GA 1X2GA 4HWSA 4RQFA 3A32A 2DXTA 3REUA 3V7SA 3PCOA 4UP7A 4UPAA 4YRGA 4RMFA 4PG3A 1WU7A 2QHSA 1ADJA 2E3CA 2DTOA 2RHQB 2EJ9A 2ODRD 4LNSA 3TUPA 4CH5A 2Q7HA 4YRLA 1YFSA 4HWOA 1FYFA 2ALYA 3MF1A 3BFMA 4ZIBA 1EFWA 2DXUA 3RF1A 4G84A 2Q7GA 2DU5A 2CJAA 3PCOB 4P73A 4YRTA 4KR3A 1E1TA 3HTZA 2EWNA 4TQFA 4XU0A 4YDQA 4XEOA 5E3IA 1NJ5A 2AMCB 2DTHA 3HXXA 5K1XA 4P71C 4WJ4A 3E9IA 3VQXA 4H2SA 1BBUA 3IG2A 2ARSA 3RACA 2E41A 1E1OA 2FYKA 3E9HA 4KR2A 4YRIA 2G4CA 2DQ3A 4P72C 3LSSA 1X54A 2RHQA 2ZNIA 4ZTUB 5C52B 4TQDA 4X5OA 2ZT7A 3QNEA 2EJGA 3HFZB 4YCVA 1YB3A 4K87A 3L4GB 4CS2A 4WJ3M 4HWTA 1PYSB 3M4PA 4YRMA 2ZGWA 1EOVA 2DQ0A 4YRRA 3HY1A
chains in the Genus database with same CATH topology
1GGMA 1H4SA 1NJ8A 5C51B 4YPFA 2CGHA 3QO7A 2DDZA 5K1PA 4J15A 3PZCA 1L0WA 3HRKA 3W3SA 1BIBA 2ZZGA 3DSQA 3I7FA 3REXA 1B8AA 1EQRA 4P72A 4XTXA 1B70B 2E1HA 1PYSA 1VQZA 4CS4A 2Q5HA 3P8TA 3V7CA 4RDXA 2CJBA 2EAYA 4XTVA 2ARTA 2DZ9A 3WQZA 2I4MA 4H2WA 3TEGA 4H2TA 2I4LA 3EFSA 4YREA 4P75C 4EX5A 1JJCB 4P3OA 2DTIA 4XU2A 4YRJA 2ZZEA 4H2XA 2ZR3A 3L4GA 3MEYA 1C0AA 1ADYA 3HFVA 2E64A 1BBWA 3MQZA 4YCUA 3IALA 2QHVA 3QO8A 1KOGA 1X2HA 2C8MA 2ODRC 2ZT5A 1BIAA 2E65A 2ZT6A 3QTCA 3VQWA 1E22A 2NS6A 1W66A 3OD1A 4XEMA 4OLFA 3HXUA 4TVAA 2XTIA 2ARUA 3A7RA 3VQYA 1J5WA 2ZNJA 5ELNA 5KNNA 1Z7MA 1LYLA 1YFRA 3RL6A 1X01A 3L2ZA 4TWAA 2ZZFA 1NJ6A 2AMCA 2EL9A 2DZCA 5F5WA 1WLEA 2PMFA 3HXWA 4E51A 3V7RA 3VBBA 4HA8A 4Q15A 1WQ7A 3CMQA 1B7YB 4DQ2A 3IKLA 1USYC 4HWPA 1KMNA 1N9WA 4XTUA 2AKWB 4NCXA 4YYEA 1HXDA 4XTWA 1ATIA 3P8YA 4WI1A 4XU1A 4TVAB 3MF2A 2IY5B 1H4TA 2ZINA 4CH4A 4P3NA 4BWAA 3NELA 4YRSA 2ALYB 4H2UA 4YCWA 3HXVA 2ZCEA 1EVKA 3RKYA 4P3PA 3UH0A 2CJ9A 2AKWA 2ZR2A 2EJFA 4YRNA 3A7AA 3HXYA 4YROA 1QE0A 4LVMA 4WF2A 2Q5IA 3NEMA 3L1AA 4H02A 1X55A 4H2VA 4YP0A 3A7UA 1WNLA 2ZT8A 3LC0A 1EVLA 4K88A 2P5IA 4EO4A 3BJUA 1B7YA 3UFGA 1RIQA 2C7IA 2A8EA 2IY5A 3VQVA 4L87A 1B76A 3UGTA 4RQEA 4P71A 2XGTA 3FJPA 2DJZA 2ZIOA 2RHSB 4KQEA 3NENA 4O2DA 2ZTGA 4OP0A 4YRFA 4XU3A 3V8LA 4P73C 1WPYA 2DU7A 1YFTA 4CH3A 4H2XB 1NJ2A 1H4VB 3HXZA 4HWRA 1B70A 4PHCA 3RKXA 1X56A 1ASZA 2E5AA 4TVYA 4TTVA 3KFUA 2I4OA 1Z7NA 2ZIMA 2HNIA 3A31A 4LVKA 3HY0A 4YRPA 2CIMA 2QHUA 2J3LA 1JJCA 1NJ1A 3G1ZA 3LSQA 3HRIA 4XTZA 1NYQA 1ASYA 4TVWA 1HC7A 5HGQA 4UP8A 1NYRA 1SETA 2QHTA 4CS3A 3ICAA 2PMEA 1EIYB 4ZTZB 4P74A 1HTTA 3NETA 3EFRA 11ASA 4P75A 4YRQA 3P8VA 4K86A 4G85A 1USYA 3HFZA 3A5ZA 3M4QA 3ERRA 4CH6A 4DPGA 1YGBA 4HVCA 4YRCA 4LVIA 3RIRA 2Q7EA 4XTYA 5ELOA 1NNHA 1SESA 4P74C 4LVJA 1G5IA 1QF6A 3A74A 3RUXA 1KMMA 3V8JA 2DEQA 2DVEA 4LVLA 3UGQA 1IL2A 3R07A 3TEHB 3A5YA 1H4QA 1E24A 2ZXFA 2DKGA 5C53B 2RHSA 2I4NA 4AH6A 1G5HA 1G51A 2E10A 4H2YA 4HT4A 1WQWA 3RGLA 4YRKA 1SERA 4BW9A 1EIYA 12ASA 3V8KA 4UP9A 3IKMB 3RKWA 3TEHA 1SRYA 2J3MA 1WYDA 3QO5A 2P0LA 4Q6GA 1X2GA 4HWSA 4RQFA 3A32A 2DXTA 3REUA 3V7SA 3PCOA 4UP7A 4UPAA 4YRGA 4RMFA 4PG3A 1WU7A 2QHSA 1ADJA 2E3CA 2DTOA 2RHQB 2EJ9A 2ODRD 4LNSA 3TUPA 4CH5A 2Q7HA 4YRLA 1YFSA 4HWOA 1FYFA 2ALYA 3MF1A 3BFMA 4ZIBA 1EFWA 2DXUA 3RF1A 4G84A 2Q7GA 2DU5A 2CJAA 3PCOB 4P73A 4YRTA 4KR3A 1E1TA 3HTZA 2EWNA 4TQFA 4XU0A 4YDQA 4XEOA 5E3IA 1NJ5A 2AMCB 2DTHA 3HXXA 5K1XA 4P71C 4WJ4A 3E9IA 3VQXA 4H2SA 1BBUA 3IG2A 2ARSA 3RACA 2E41A 1E1OA 2FYKA 3E9HA 4KR2A 4YRIA 2G4CA 2DQ3A 4P72C 3LSSA 1X54A 2RHQA 2ZNIA 4ZTUB 5C52B 4TQDA 4X5OA 2ZT7A 3QNEA 2EJGA 3HFZB 4YCVA 1YB3A 4K87A 3L4GB 4CS2A 4WJ3M 4HWTA 1PYSB 3M4PA 4YRMA 2ZGWA 1EOVA 2DQ0A 4YRRA 3HY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGM A;  1H4S A;  1NJ8 A;  5C51 B;  4YPF A;  2CGH A;  3QO7 A;  2DDZ A;  5K1P A;  4J15 A;  3PZC A;  1L0W A;  3HRK A;  3W3S A;  1BIB A;  2ZZG A;  3DSQ A;  3I7F A;  3REX A;  1B8A A;  1EQR A;  4P72 A;  4XTX A;  1B70 B;  2E1H A;  1PYS A;  1VQZ A;  4CS4 A;  2Q5H A;  3P8T A;  3V7C A;  4RDX A;  2CJB A;  2EAY A;  4XTV A;  2ART A;  2DZ9 A;  3WQZ A;  2I4M A;  4H2W A;  3TEG A;  4H2T A;  2I4L A;  3EFS A;  4YRE A;  4P75 C;  4EX5 A;  1JJC B;  4P3O A;  2DTI A;  4XU2 A;  4YRJ A;  2ZZE A;  4H2X A;  2ZR3 A;  3L4G A;  3MEY A;  1C0A A;  1ADY A;  3HFV A;  2E64 A;  1BBW A;  4YCU A;  3IAL A;  2QHV A;  3QO8 A;  1KOG A;  1X2H A;  2C8M A;  2ODR C;  2ZT5 A;  1BIA A;  2E65 A;  2ZT6 A;  3QTC A;  3VQW A;  1E22 A;  1W66 A;  3OD1 A;  4XEM A;  4OLF A;  3HXU A;  4TVA A;  2XTI A;  2ARU A;  3A7R A;  3VQY A;  1J5W A;  2ZNJ A;  5ELN A;  5KNN A;  1Z7M A;  1LYL A;  1YFR A;  3RL6 A;  1X01 A;  3L2Z A;  4TWA A;  2ZZF A;  1NJ6 A;  2AMC A;  2EL9 A;  2DZC A;  5F5W A;  1WLE A;  2PMF A;  3HXW A;  4E51 A;  3V7R A;  3VBB A;  4HA8 A;  4Q15 A;  1WQ7 A;  3CMQ A;  1B7Y B;  4DQ2 A;  3IKL A;  1USY C;  4HWP A;  1KMN A;  1N9W A;  4XTU A;  2AKW B;  4NCX A;  4YYE A;  1HXD A;  4XTW A;  1ATI A;  3P8Y A;  4WI1 A;  4XU1 A;  4TVA B;  3MF2 A;  2IY5 B;  1H4T A;  2ZIN A;  4CH4 A;  4P3N A;  4BWA A;  3NEL A;  4YRS A;  2ALY B;  4H2U A;  4YCW A;  3HXV A;  2ZCE A;  1EVK A;  3RKY A;  4P3P A;  3UH0 A;  2CJ9 A;  2AKW A;  2ZR2 A;  2EJF A;  4YRN A;  3A7A A;  3HXY A;  4YRO A;  1QE0 A;  4WF2 A;  2Q5I A;  3NEM A;  3L1A A;  4H02 A;  1X55 A;  4H2V A;  4YP0 A;  3A7U A;  1WNL A;  2ZT8 A;  3LC0 A;  1EVL A;  4K88 A;  2P5I A;  4EO4 A;  3BJU A;  1B7Y A;  3UFG A;  1RIQ A;  2C7I A;  2IY5 A;  3VQV A;  4L87 A;  1B76 A;  3UGT A;  4RQE A;  4P71 A;  2XGT A;  3FJP A;  2DJZ A;  2ZIO A;  2RHS B;  4KQE A;  3NEN A;  4O2D A;  2ZTG A;  4OP0 A;  4YRF A;  4XU3 A;  3V8L A;  4P73 C;  1WPY A;  2DU7 A;  1YFT A;  4CH3 A;  4H2X B;  1NJ2 A;  1H4V B;  3HXZ A;  4HWR A;  1B70 A;  4PHC A;  3RKX A;  1X56 A;  1ASZ A;  2E5A A;  4TVY A;  4TTV A;  3KFU A;  2I4O A;  1Z7N A;  2ZIM A;  2HNI A;  3A31 A;  3HY0 A;  4YRP A;  2CIM A;  2QHU A;  2J3L A;  1JJC A;  1NJ1 A;  3G1Z A;  3LSQ A;  3HRI A;  4XTZ A;  1NYQ A;  1ASY A;  4TVW A;  1HC7 A;  5HGQ A;  4UP8 A;  1NYR A;  1SET A;  2QHT A;  4CS3 A;  3ICA A;  2PME A;  1EIY B;  4ZTZ B;  4P74 A;  1HTT A;  3NET A;  3EFR A;  11AS A;  4P75 A;  4YRQ A;  3P8V A;  4K86 A;  4G85 A;  1USY A;  3HFZ A;  3A5Z A;  3M4Q A;  3ERR A;  4CH6 A;  4DPG A;  1YGB A;  4HVC A;  4YRC A;  3RIR A;  2Q7E A;  4XTY A;  5ELO A;  1NNH A;  1SES A;  4P74 C;  1G5I A;  1QF6 A;  3A74 A;  3RUX A;  1KMM A;  3V8J A;  2DEQ A;  2DVE A;  3UGQ A;  1IL2 A;  3R07 A;  3TEH B;  3A5Y A;  1H4Q A;  1E24 A;  2ZXF A;  2DKG A;  5C53 B;  2RHS A;  2I4N A;  4AH6 A;  1G5H A;  1G51 A;  2E10 A;  4H2Y A;  1WQW A;  3RGL A;  4YRK A;  1SER A;  4BW9 A;  1EIY A;  12AS A;  3V8K A;  4UP9 A;  3IKM B;  3RKW A;  3TEH A;  1SRY A;  2J3M A;  1WYD A;  3QO5 A;  2P0L A;  4Q6G A;  1X2G A;  4HWS A;  4RQF A;  3A32 A;  2DXT A;  3REU A;  3V7S A;  3PCO A;  4UP7 A;  4UPA A;  4YRG A;  4RMF A;  4PG3 A;  1WU7 A;  2QHS A;  1ADJ A;  2E3C A;  2DTO A;  2RHQ B;  2EJ9 A;  2ODR D;  4LNS A;  3TUP A;  4CH5 A;  2Q7H A;  4YRL A;  1YFS A;  4HWO A;  1FYF A;  2ALY A;  3MF1 A;  3BFM A;  4ZIB A;  1EFW A;  2DXU A;  3RF1 A;  4G84 A;  2Q7G A;  2DU5 A;  2CJA A;  3PCO B;  4P73 A;  4YRT A;  4KR3 A;  1E1T A;  3HTZ A;  2EWN A;  4TQF A;  4XU0 A;  4YDQ A;  4XEO A;  5E3I A;  1NJ5 A;  2AMC B;  2DTH A;  3HXX A;  5K1X A;  4P71 C;  4WJ4 A;  3E9I A;  3VQX A;  4H2S A;  1BBU A;  3IG2 A;  2ARS A;  3RAC A;  2E41 A;  1E1O A;  2FYK A;  3E9H A;  4KR2 A;  4YRI A;  2G4C A;  2DQ3 A;  4P72 C;  3LSS A;  1X54 A;  2RHQ A;  2ZNI A;  4ZTU B;  5C52 B;  4TQD A;  4X5O A;  2ZT7 A;  3QNE A;  2EJG A;  3HFZ B;  4YCV A;  1YB3 A;  4K87 A;  3L4G B;  4CS2 A;  4WJ3 M;  4HWT A;  1PYS B;  3M4P A;  4YRM A;  2ZGW A;  1EOV A;  2DQ0 A;  4YRR A;  3HY1 A; 
#chains in the Genus database with same CATH topology
 1GGM A;  1H4S A;  1NJ8 A;  5C51 B;  4YPF A;  2CGH A;  3QO7 A;  2DDZ A;  5K1P A;  4J15 A;  3PZC A;  1L0W A;  3HRK A;  3W3S A;  1BIB A;  2ZZG A;  3DSQ A;  3I7F A;  3REX A;  1B8A A;  1EQR A;  4P72 A;  4XTX A;  1B70 B;  2E1H A;  1PYS A;  1VQZ A;  4CS4 A;  2Q5H A;  3P8T A;  3V7C A;  4RDX A;  2CJB A;  2EAY A;  4XTV A;  2ART A;  2DZ9 A;  3WQZ A;  2I4M A;  4H2W A;  3TEG A;  4H2T A;  2I4L A;  3EFS A;  4YRE A;  4P75 C;  4EX5 A;  1JJC B;  4P3O A;  2DTI A;  4XU2 A;  4YRJ A;  2ZZE A;  4H2X A;  2ZR3 A;  3L4G A;  3MEY A;  1C0A A;  1ADY A;  3HFV A;  2E64 A;  1BBW A;  3MQZ A;  4YCU A;  3IAL A;  2QHV A;  3QO8 A;  1KOG A;  1X2H A;  2C8M A;  2ODR C;  2ZT5 A;  1BIA A;  2E65 A;  2ZT6 A;  3QTC A;  3VQW A;  1E22 A;  2NS6 A;  1W66 A;  3OD1 A;  4XEM A;  4OLF A;  3HXU A;  4TVA A;  2XTI A;  2ARU A;  3A7R A;  3VQY A;  1J5W A;  2ZNJ A;  5ELN A;  5KNN A;  1Z7M A;  1LYL A;  1YFR A;  3RL6 A;  1X01 A;  3L2Z A;  4TWA A;  2ZZF A;  1NJ6 A;  2AMC A;  2EL9 A;  2DZC A;  5F5W A;  1WLE A;  2PMF A;  3HXW A;  4E51 A;  3V7R A;  3VBB A;  4HA8 A;  4Q15 A;  1WQ7 A;  3CMQ A;  1B7Y B;  4DQ2 A;  3IKL A;  1USY C;  4HWP A;  1KMN A;  1N9W A;  4XTU A;  2AKW B;  4NCX A;  4YYE A;  1HXD A;  4XTW A;  1ATI A;  3P8Y A;  4WI1 A;  4XU1 A;  4TVA B;  3MF2 A;  2IY5 B;  1H4T A;  2ZIN A;  4CH4 A;  4P3N A;  4BWA A;  3NEL A;  4YRS A;  2ALY B;  4H2U A;  4YCW A;  3HXV A;  2ZCE A;  1EVK A;  3RKY A;  4P3P A;  3UH0 A;  2CJ9 A;  2AKW A;  2ZR2 A;  2EJF A;  4YRN A;  3A7A A;  3HXY A;  4YRO A;  1QE0 A;  4LVM A;  4WF2 A;  2Q5I A;  3NEM A;  3L1A A;  4H02 A;  1X55 A;  4H2V A;  4YP0 A;  3A7U A;  1WNL A;  2ZT8 A;  3LC0 A;  1EVL A;  4K88 A;  2P5I A;  4EO4 A;  3BJU A;  1B7Y A;  3UFG A;  1RIQ A;  2C7I A;  2A8E A;  2IY5 A;  3VQV A;  4L87 A;  1B76 A;  3UGT A;  4RQE A;  4P71 A;  2XGT A;  3FJP A;  2DJZ A;  2ZIO A;  2RHS B;  4KQE A;  3NEN A;  4O2D A;  2ZTG A;  4OP0 A;  4YRF A;  4XU3 A;  3V8L A;  4P73 C;  1WPY A;  2DU7 A;  1YFT A;  4CH3 A;  4H2X B;  1NJ2 A;  1H4V B;  3HXZ A;  4HWR A;  1B70 A;  4PHC A;  3RKX A;  1X56 A;  1ASZ A;  2E5A A;  4TVY A;  4TTV A;  3KFU A;  2I4O A;  1Z7N A;  2ZIM A;  2HNI A;  3A31 A;  4LVK A;  3HY0 A;  4YRP A;  2CIM A;  2QHU A;  2J3L A;  1JJC A;  1NJ1 A;  3G1Z A;  3LSQ A;  3HRI A;  4XTZ A;  1NYQ A;  1ASY A;  4TVW A;  1HC7 A;  5HGQ A;  4UP8 A;  1NYR A;  1SET A;  2QHT A;  4CS3 A;  3ICA A;  2PME A;  1EIY B;  4ZTZ B;  4P74 A;  1HTT A;  3NET A;  3EFR A;  11AS A;  4P75 A;  4YRQ A;  3P8V A;  4K86 A;  4G85 A;  1USY A;  3HFZ A;  3A5Z A;  3M4Q A;  3ERR A;  4CH6 A;  4DPG A;  1YGB A;  4HVC A;  4YRC A;  4LVI A;  3RIR A;  2Q7E A;  4XTY A;  5ELO A;  1NNH A;  1SES A;  4P74 C;  4LVJ A;  1G5I A;  1QF6 A;  3A74 A;  3RUX A;  1KMM A;  3V8J A;  2DEQ A;  2DVE A;  4LVL A;  3UGQ A;  1IL2 A;  3R07 A;  3TEH B;  3A5Y A;  1H4Q A;  1E24 A;  2ZXF A;  2DKG A;  5C53 B;  2RHS A;  2I4N A;  4AH6 A;  1G5H A;  1G51 A;  2E10 A;  4H2Y A;  4HT4 A;  1WQW A;  3RGL A;  4YRK A;  1SER A;  4BW9 A;  1EIY A;  12AS A;  3V8K A;  4UP9 A;  3IKM B;  3RKW A;  3TEH A;  1SRY A;  2J3M A;  1WYD A;  3QO5 A;  2P0L A;  4Q6G A;  1X2G A;  4HWS A;  4RQF A;  3A32 A;  2DXT A;  3REU A;  3V7S A;  3PCO A;  4UP7 A;  4UPA A;  4YRG A;  4RMF A;  4PG3 A;  1WU7 A;  2QHS A;  1ADJ A;  2E3C A;  2DTO A;  2RHQ B;  2EJ9 A;  2ODR D;  4LNS A;  3TUP A;  4CH5 A;  2Q7H A;  4YRL A;  1YFS A;  4HWO A;  1FYF A;  2ALY A;  3MF1 A;  3BFM A;  4ZIB A;  1EFW A;  2DXU A;  3RF1 A;  4G84 A;  2Q7G A;  2DU5 A;  2CJA A;  3PCO B;  4P73 A;  4YRT A;  4KR3 A;  1E1T A;  3HTZ A;  2EWN A;  4TQF A;  4XU0 A;  4YDQ A;  4XEO A;  5E3I A;  1NJ5 A;  2AMC B;  2DTH A;  3HXX A;  5K1X A;  4P71 C;  4WJ4 A;  3E9I A;  3VQX A;  4H2S A;  1BBU A;  3IG2 A;  2ARS A;  3RAC A;  2E41 A;  1E1O A;  2FYK A;  3E9H A;  4KR2 A;  4YRI A;  2G4C A;  2DQ3 A;  4P72 C;  3LSS A;  1X54 A;  2RHQ A;  2ZNI A;  4ZTU B;  5C52 B;  4TQD A;  4X5O A;  2ZT7 A;  3QNE A;  2EJG A;  3HFZ B;  4YCV A;  1YB3 A;  4K87 A;  3L4G B;  4CS2 A;  4WJ3 M;  4HWT A;  1PYS B;  3M4P A;  4YRM A;  2ZGW A;  1EOV A;  2DQ0 A;  4YRR A;  3HY1 A; 
#chains in the Genus database with same CATH homology
 1GGM A;  1H4S A;  1NJ8 A;  5C51 B;  4YPF A;  2CGH A;  3QO7 A;  2DDZ A;  5K1P A;  4J15 A;  3PZC A;  1L0W A;  3HRK A;  3W3S A;  1BIB A;  2ZZG A;  3DSQ A;  3I7F A;  3REX A;  1B8A A;  1EQR A;  4P72 A;  4XTX A;  1B70 B;  2E1H A;  1PYS A;  1VQZ A;  4CS4 A;  2Q5H A;  3P8T A;  3V7C A;  4RDX A;  2CJB A;  2EAY A;  4XTV A;  2ART A;  2DZ9 A;  3WQZ A;  2I4M A;  4H2W A;  3TEG A;  4H2T A;  2I4L A;  3EFS A;  4YRE A;  4P75 C;  4EX5 A;  1JJC B;  4P3O A;  2DTI A;  4XU2 A;  4YRJ A;  2ZZE A;  4H2X A;  2ZR3 A;  3L4G A;  3MEY A;  1C0A A;  1ADY A;  3HFV A;  2E64 A;  1BBW A;  3MQZ A;  4YCU A;  3IAL A;  2QHV A;  3QO8 A;  1KOG A;  1X2H A;  2C8M A;  2ODR C;  2ZT5 A;  1BIA A;  2E65 A;  2ZT6 A;  3QTC A;  3VQW A;  1E22 A;  2NS6 A;  1W66 A;  3OD1 A;  4XEM A;  4OLF A;  3HXU A;  4TVA A;  2XTI A;  2ARU A;  3A7R A;  3VQY A;  1J5W A;  2ZNJ A;  5ELN A;  5KNN A;  1Z7M A;  1LYL A;  1YFR A;  3RL6 A;  1X01 A;  3L2Z A;  4TWA A;  2ZZF A;  1NJ6 A;  2AMC A;  2EL9 A;  2DZC A;  5F5W A;  1WLE A;  2PMF A;  3HXW A;  4E51 A;  3V7R A;  3VBB A;  4HA8 A;  4Q15 A;  1WQ7 A;  3CMQ A;  1B7Y B;  4DQ2 A;  3IKL A;  1USY C;  4HWP A;  1KMN A;  1N9W A;  4XTU A;  2AKW B;  4NCX A;  4YYE A;  1HXD A;  4XTW A;  1ATI A;  3P8Y A;  4WI1 A;  4XU1 A;  4TVA B;  3MF2 A;  2IY5 B;  1H4T A;  2ZIN A;  4CH4 A;  4P3N A;  4BWA A;  3NEL A;  4YRS A;  2ALY B;  4H2U A;  4YCW A;  3HXV A;  2ZCE A;  1EVK A;  3RKY A;  4P3P A;  3UH0 A;  2CJ9 A;  2AKW A;  2ZR2 A;  2EJF A;  4YRN A;  3A7A A;  3HXY A;  4YRO A;  1QE0 A;  4LVM A;  4WF2 A;  2Q5I A;  3NEM A;  3L1A A;  4H02 A;  1X55 A;  4H2V A;  4YP0 A;  3A7U A;  1WNL A;  2ZT8 A;  3LC0 A;  1EVL A;  4K88 A;  2P5I A;  4EO4 A;  3BJU A;  1B7Y A;  3UFG A;  1RIQ A;  2C7I A;  2A8E A;  2IY5 A;  3VQV A;  4L87 A;  1B76 A;  3UGT A;  4RQE A;  4P71 A;  2XGT A;  3FJP A;  2DJZ A;  2ZIO A;  2RHS B;  4KQE A;  3NEN A;  4O2D A;  2ZTG A;  4OP0 A;  4YRF A;  4XU3 A;  3V8L A;  4P73 C;  1WPY A;  2DU7 A;  1YFT A;  4CH3 A;  4H2X B;  1NJ2 A;  1H4V B;  3HXZ A;  4HWR A;  1B70 A;  4PHC A;  3RKX A;  1X56 A;  1ASZ A;  2E5A A;  4TVY A;  4TTV A;  3KFU A;  2I4O A;  1Z7N A;  2ZIM A;  2HNI A;  3A31 A;  4LVK A;  3HY0 A;  4YRP A;  2CIM A;  2QHU A;  2J3L A;  1JJC A;  1NJ1 A;  3G1Z A;  3LSQ A;  3HRI A;  4XTZ A;  1NYQ A;  1ASY A;  4TVW A;  1HC7 A;  5HGQ A;  4UP8 A;  1NYR A;  1SET A;  2QHT A;  4CS3 A;  3ICA A;  2PME A;  1EIY B;  4ZTZ B;  4P74 A;  1HTT A;  3NET A;  3EFR A;  11AS A;  4P75 A;  4YRQ A;  3P8V A;  4K86 A;  4G85 A;  1USY A;  3HFZ A;  3A5Z A;  3M4Q A;  3ERR A;  4CH6 A;  4DPG A;  1YGB A;  4HVC A;  4YRC A;  4LVI A;  3RIR A;  2Q7E A;  4XTY A;  5ELO A;  1NNH A;  1SES A;  4P74 C;  4LVJ A;  1G5I A;  1QF6 A;  3A74 A;  3RUX A;  1KMM A;  3V8J A;  2DEQ A;  2DVE A;  4LVL A;  3UGQ A;  1IL2 A;  3R07 A;  3TEH B;  3A5Y A;  1H4Q A;  1E24 A;  2ZXF A;  2DKG A;  5C53 B;  2RHS A;  2I4N A;  4AH6 A;  1G5H A;  1G51 A;  2E10 A;  4H2Y A;  4HT4 A;  1WQW A;  3RGL A;  4YRK A;  1SER A;  4BW9 A;  1EIY A;  12AS A;  3V8K A;  4UP9 A;  3IKM B;  3RKW A;  3TEH A;  1SRY A;  2J3M A;  1WYD A;  3QO5 A;  2P0L A;  4Q6G A;  1X2G A;  4HWS A;  4RQF A;  3A32 A;  2DXT A;  3REU A;  3V7S A;  3PCO A;  4UP7 A;  4UPA A;  4YRG A;  4RMF A;  4PG3 A;  1WU7 A;  2QHS A;  1ADJ A;  2E3C A;  2DTO A;  2RHQ B;  2EJ9 A;  2ODR D;  4LNS A;  3TUP A;  4CH5 A;  2Q7H A;  4YRL A;  1YFS A;  4HWO A;  1FYF A;  2ALY A;  3MF1 A;  3BFM A;  4ZIB A;  1EFW A;  2DXU A;  3RF1 A;  4G84 A;  2Q7G A;  2DU5 A;  2CJA A;  3PCO B;  4P73 A;  4YRT A;  4KR3 A;  1E1T A;  3HTZ A;  2EWN A;  4TQF A;  4XU0 A;  4YDQ A;  4XEO A;  5E3I A;  1NJ5 A;  2AMC B;  2DTH A;  3HXX A;  5K1X A;  4P71 C;  4WJ4 A;  3E9I A;  3VQX A;  4H2S A;  1BBU A;  3IG2 A;  2ARS A;  3RAC A;  2E41 A;  1E1O A;  2FYK A;  3E9H A;  4KR2 A;  4YRI A;  2G4C A;  2DQ3 A;  4P72 C;  3LSS A;  1X54 A;  2RHQ A;  2ZNI A;  4ZTU B;  5C52 B;  4TQD A;  4X5O A;  2ZT7 A;  3QNE A;  2EJG A;  3HFZ B;  4YCV A;  1YB3 A;  4K87 A;  3L4G B;  4CS2 A;  4WJ3 M;  4HWT A;  1PYS B;  3M4P A;  4YRM A;  2ZGW A;  1EOV A;  2DQ0 A;  4YRR A;  3HY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...