2FYKA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with adp and biotin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
b'MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--protein ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fykA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2fykA01
5LJ3f 4M78F 3ICAA 4M75E 3HFZB 2ZNIA 3HRIA 4YRGA 3MF2A 4XEMA 5GAOn 5GAMg 3A7RA 5GAMj 3QNEA 4P73A 4JLIA 2ODRC 1BBUA 4K87A 1X2HA 3M4PA 3JCMc 1B8AA 4HWPA 4M75A 4PJOB 12ASA 3LSSA 3WQZA 2DKGA 2VC8A 1G51A 4YREA 4H2XB 2DTIA 4TVAB 4RCCA 11ASA 4C92G 2AKWA 3VQXA 4XU3A 5LJ3h 3JCMW 1ATIA 3RERA 4YPFA 1B70A 4M78E 4C8QF 1NJ8A 2Q5IA 1NJ2A 4N0AC 4XEOA 4YRSA 4P72C 4P3NA 1N9WA 3PCOA 4CS2A 3TUPA 1B7YB 1E1TA 3RKXA 4H2VA 3HFNA 4M78A 3RF1A 1KMMA 4M75D 3REXA 4BWAA 4H2SA 4YP0A 4H2UA 2ZCEA 3JCMP 2ZTGA 4P73C 2HNIA 4M77G 1EVKA 4C8QE 3IALA 4C92B 4TWAA 2ZIOA 4JUVA 3UH0A 4LNSA 3R07A 4HWOA 2Q5HA 4YRRA 2Q7EA 4WI1A 1B34B 4ZIBA 3PZCA 5GANf 4A53A 2QHUA 4M78D 3A5ZA 3RUXA 1X55A 2XGTA 1HTTA 3HTZA 2EJ9A 4CH6A 3A74A 4YRLA 2RHSB 4M7DF 3SWNC 5LJ5e 1H4SA 1PYSB 3VU3C 3E9HA 1B76A 2I2LA 4M78C 3RESA 4NCXA 2RM4A 2QHSA 4XQ3A 4K86A 4M77B 1C0AA 4TQDA 3A5YA 3SB2A 3FB9A 3JCMf 5GMKm 3RL6A 4J6WA 2J3MA 3W3SA 2DEQA 4EMKA 2DQ0A 3TEGA 3HFOA 4M7DE 2VXEA 3JCMJ 1I4K1 2CIMA 4XTZA 4EMHA 3L4GB 1EIYB 4X9CA 4C8QC 2VXFA 4YYEA 4G84A 3TEHB 1X2GA 4WF2A 4AH6A 4RDXA 4CS4A 2C7IA 1NJ1A 3JCMV 4YCVA 4CH4A 3EFRA 3RIRA 2QHVA 1NYQA 5GAOm 4M75G 1WU7A 3HXXA 2FYKA 5LJ5g 3HFVA 4J6YA 5LJ5j 3NENA 4OP0A 5GANg 5GANj 2CJAA 4EMKC 2DQ3A 4J15A 1WQ7A 1Y96A 2ZT7A 3JB9G 3L1AA 1QE0A 1M8VA 3JCMb 4K88A 3E9IA 4TQFA 5HGQA 1X54A 4YCUA 1JBMA 4M78G 3HY1A 4YRIA 5KNNA 2CGHA 2YHTA 4M7DC 2EL9A 2IY5B 4CH3A 3A7UA 1I8FA 3RKWA 4M75B 2Q7HA 4HVCA 3JB9H 2Y90A 3QO8A 3LC0A 1D3BA 1QF6A 1NJ5A 5C52B 1LJOA 3HXWA 3JCMg 1B70B 2ALYB 4KQEA 3SWNA 4DPGA 3RGLA 3V7RA 2ZZGA 4C92F 1GGMA 5GAN7 2EJFA 4NL2A 5LJ3d 5GAN2 3M4QA 4TVWA 1YFRA 4TVAA 2E5AA 4WJ4A 1KQ1A 4M78B 1LOJA 2DXUA 1SETA 1JJCA 1USYC 2CJBA 3P8YA 5GAOp 1J5WA 3I7FA 1B7YA 2DJZA 3NETA 3QO5A 2JN0A 2DU5A 3V8JA 2I4LA 3DSQA 5LJ5f 2RB6A 3INZA 5C53B 1LNXA 5GAN3 1NJ6A 3UFGA 4C92E 4CS3A 4ZTZB 4M7AF 3UGTA 4M77F 4Q6GA 4XTYA 3HXVA 4C8QA 2EAYA 1HK9A 1WLEA 4UPAA 3VQVA 5GMKe 4C92A 4EMGA 1YFSA 3OD1A 3QHSA 4P71C 2YLCA 4YRCA 2ZIMA 2ARTA 4EO4A 4JRKA 3IKMB 5LJ5h 2C8MA 4NOYA 4M7AE 2RHQA 2G4CA 1H641 4M77E 2EWNA 3VQYA 5GANh 4C8QD 1SERA 3EFSA 2RA2A 2DVEA 4PNOA 1HXDA 4X5OA 4XTWA 1YGBA 1NYRA 1H4VB 2I4OA 4C92D 1U1SA 4M7AA 1Z7NA 4P75A 4EMKB 1FYFA 3JB9I 2ZZEA 3PGGA 2P5IA 2E10A 2QTXA 2AMCA 4F7UF 5GAMd 4M7DA 4XU1A 5GAMe 4V2SA 5E3IA 4C92C 4H2WA 2EJGA 2K57A 1JRIA 3BY7A 1VQZA 1HC7A 4KR2A 1Z7MA 2E41A 5K1PA 1SRYA 3UGQA 3JCMh 4M7AD 4Y91A 5GMKj 3CMQA 3HRKA 4PJOF 4TTVA 4HWSA 4F7UE 4M7DD 4M75F 3MF1A 4HT8A 4YRMA 4RQEA 4QVDA 1BIBA 1N9SA 3NEMA 4P75C 4M7AC 4P3PA 2E65A 4M77C 2E1HA 5GAOq 1USYA 3ERRA 3RACA 3QO3A 4NL3A 5F5WA 4XU2A 3P8TA 4Q15A 3GIBA 4F7UA 1G5IA 3HSBA 1EOVA 3REUA 4CH5A 1EVLA 1H4QA 3JB9F 4HWRA 2DZCA 4BW9A 4UP8A 3FIFA 4PJOE 5GAOr 3HFZA 2PMFA 5I21A 5GMKl 4XTUA 4H2YA 3VQWA 4YDQA 1TH7A 5ELOA 2YLBA 1I5LA 2AKWB 2ZGWA 3V7CA 1BIAA 3HXYA 4OLFA 1D3BB 1WPYA 5CAIA 2ZZFA 4YRQA 3L2ZA 4P74C 4PJOA 1YFTA 2IY5A 3PCOB 3SWNB 5LJ3e 4UP7A 4H2XA 2J3LA 4P71A 4C8QG 3M4GA 4P3OA 2ZR3A 3QSUA 4HWTA 4L87A 3JCMX 3MEYA 1KOGA 2DTHA 2ALYA 2ARUA 3QO7A 4KR3A 4EX5A 2RD1A 1KQ2A 1JJCB 2ZT6A 4YRFA 1ASZA 2XTIA 3BDUA 5GAOl 5GMKi 1SESA 2P0LA 1IL2A 3IKLA 4PJOD 5GAN4 4G85A 5C51B 3HXUA 1YB3A 1U1TA 4QVCA 4YCWA 4JRIA 1ADYA 2DXTA 2ZT8A 5DY9A 1E1OA 2I4NA 1I81A 4C8QB 3A31A 4H2TA 2Q7GA 4M7AG 3BW1A 2ZXFA 4PJOC 3JB9D 1B34A 4M75C 3V8KA 1G5HA 5GMKh 3P8VA 4H02A 4HT9A 4M7DG 2ARSA 4YRJA 4YRPA 1E24A 4YROA 2RHSA 1ADJA 5LJ3g 2RHQB 5LJ3j 1PYSA 2ZNJA 5GAMf 1M5Q1 4MMLA 2DZ9A 5LJ5d 2ZT5A 1MGQA 4DQ2A 4RMFA 1EFWA 4PHCA 3QUIA 4RQFA 5GAN6 5ELNA 5GANd 4M77A 3V7SA 5GANe 1WQWA 4M7AB 1E22A 3HY0A 1KMNA 4YRKA 4J6XA 1NNHA 3LSQA 1X56A 2DTOA 4XTXA 1WYDA 3V8LA 1N9RA 2I4MA 4O2DA 2AMCB 3JB9J 4M7DB 1WNLA 2DDZA 4UP9A 3A32A 4RCBA 1BBWA 2E3CA 1H4TA 3BJUA 1X01A 4F7UG 5GAMh 3L4GA 1EIYA 1LYLA 4XU0A 2DU7A 4M77D 2ZINA 1L0WA 4YRNA 3TEHA 4P74A 4MMKA 4WJ3M 3RKYA 3QTCA 5K1XA 3JCMQ 1RIQA 3JCMd 3KFUA 4PG3A 3JCMe 4X9DA 5GAN5 2FB7A 1W66A 3A7AA 4TVYA 2ZR2A 3G1ZA 2CJ9A 4J5YA 2E64A 4XTVA 2PMEA 3AHUA 4PJOG 1Y96B 3FJPA 3NELA 1YCYA 4YRTA 3HXZA 4N0AA 4E51A 4P72A 2QHTA 4ZTUB 1ASYA 1EQRA 3BFMA 4HA8A 4F7UB 5GAN8 2ODRD 3VBBA 4A54A 3IG2A
chains in the Genus database with same CATH superfamily
1VQOT 2RHIA 1WXBA 4D8KA 8AT1B 3L2QA 1TUDA 3TU4K 5GAMg 2FL7A 3OYDA 4ZGJB 4P73A 2XI9A 4UC4A 2ODRC 3VS7A 3CC2A 2EKOA 2A36A 2IIMA 1K0SA 1WGSA 1B8AA 2VC8A 4HT4A 2DD5A 3MP8A 1W2BP 3LWIA 4XU3A 2EQIA 1RI9A 2GNCA 4M78E 2XK0A 1M1GA 4N0AC 4P72C 1N9WA 2RI5A 3HP9A 2PUOB 1WJRA 3TUPA 1OPLA 2SEMA 4E7HA 3M0PA 3HFNA 2ZPEB 4ZNXA 1VQMT 2K7AA 4ZN3A 1VA7A 4BWAA 1VQOA 6AT1B 4YP0A 4C0DC 1U5SA 2YXYA 1N8RU 4FYWB 3G6EA 2DNUA 2LQNA 3CCVT 1VIFA 4M77G 4C8QE 4PL6A 4JUVA 5D6WA 3OYEA 1KHCA 3MCAB 1X6GA 1SSFA 2GFUA 4HWOA 1Y7XA 1C6VX 1B34B 2P4TA 3PZCA 5GANf 4A53A 2GTJA 1M2OA 4IURA 1M90C 1S72T 3A5ZA 2DIQA 3CCRT 2D1XA 2EYZA 1FMKA 3KFVA 4OMOA 1GCQC 1PYSB 1N5ZA 1AOJA 3E9HA 3A8MB 3OB9A 3CCEQ 2L3SA 3S3OA 4N4IA 1S1NA 2BKDN 3I9QA 1QMCA 3MO8A 3D7SB 2J3MA 3FJ5A 3W3SA 2DEQA 1M1KR 1OULA 1K8AC 2VXEA 3OA6A 4LDVA 4E7SA 2DF6A 1UHCA 3L4GB 4X9CA 4FCYA 3AT1B 4YYEA 3VRYA 1D0YA 4LDWA 3ZFJA 4HXJA 2O4XA 1WHMA 4E7ZA 1WIEA 3QWYA 2MWOA 2A3LA 1JJ2A 4CS4A 2C7IA 3JCMV 4JRQA 1XTDA 2AT1B 5J3BA 1NYQA 5GAOm 4KBMB 3M55A 2KK4A 2V8JA 5LJ5g 2JS0A 4J6YA 4A4FA 4PJMA 3CCJT 4OP0A 5IT9E 5GANg 2E3HA 2DA9A 2VWFA 1TOVA 2CJAA 3R6OA 4EMKC 5FLXE 5KYNA 4CC4B 1G5VA 2D8JA 4FL6A 5HGQA 4RTZA 2COWA 4YCUA 4M78G 3HY1A 5KNNA 3WVDB 3A1PA 4A63B 4M75B 2RF0A 2GCXA 3CCUQ 4HVCA 1KQSP 3CPWA 2MI6A 1YHQQ 1QF6A 3HXWA 2EGEA 3MKDA 5FROA 2DPPB 2ALYB 2BZYA 4KQEA 2ED0A 4FSXA 3A98A 2EIFA 1Q86R 2D8HA 1YFRA 4FM4B 1VQ9T 2D0NA 1BI1A 2RJEA 4BD3A 3KUFA 4LN2A 5I11A 2X4JA 2J6OA 3EG9B 2JN0A 4NS5A 4J9GA 3G4SQ 2CP5A 3V8JA 3CD6T 2R57A 3DKMA 1LNXA 2FZKB 4PJJA 2CUBA 4M77F 1JJ2S 3HXVA 1HK9A 2FO0A 1XNIA 3O8VA 2FZCB 1Q7YR 1H92A 1WHHA 2MOXA 1WLPB 3QHSA 1SEMA 1GFDA 4JRKA 5I22A 3IKMB 1ZLMA 2GF7A 5A0DA 2C8MA 4RUGA 3M0RA 4NOYA 2LQWA 4LXCA 4PNOA 2HSPA 1YGBA 1WI7A 1NYRA 2K4YA 1H4VB 1VQ7Q 3RR6A 9ATCB 3CCQT 3MEWA 4EMKB 1FYFA 2ROLA 2ZZEA 2AKKA 2D9TA 1E7OA 4E7IA 1QVFA 2LTOA 1QCOA 4XU1A 1WXUA 3L2WA 4V2SA 3CC7Q 4C92C 4OMLA 4L6V5 3CMET 5K1PA 3MPUB 1SRYA 3NHNA 1V1CA 1WHLA 1VOMA 2MK5A 1IXDA 3HKSA 1TU0B 4BI4A 1UJYA 5GMKj 1YJ9Q 2F2VA 3HRKA 4C0ZA 2QAZA 4PJOF 2EW3A 4TTVA 1ZSGA 4HWSA 2CZ7B 4F7UE 1NEBA 4IKFA 3MF1A 2KY9A 1R0BG 1T0HA 3NEMA 4CC2A 1U3OA 2QG9B 4M7AC 1OV3A 5GAOq 3ERRA 2HCKA 4QQGA 4XU2A 3P8TA 1E6GA 3M9QA 4Q15A 2V1QA 1ARKA 7AT1B 1WDXA 4CH5A 2NWMA 2VGMA 2JMAA 3SEMA 3HFZA 2PMFA 5FU6C 5FW9A 3VQWA 1W4SA 1G3YA 1TH7A 5ELOA 2KROA 1I5LA 2X4YA 3V7CA 2RMOA 3E19A 2QYZA 5CAIA 2ZZFA 4P74C 2DJQA 3SHWA 4PFPA 1JU5C 1YJWQ 4P71A 4HWTA 1PCXA 4L87A 2YRDA 3QKJA 4ZTFA 2KAFA 4O5VA 1PD1A 5AYFA 1BKBA 2ALYA 3QO7A 4EX5A 3OYFA 2ZPBB 2A37A 1M90U 1OQKA 1ASZA 3CC4Q 4BDYA 1QVFS 5GMKi 4BE2A 1YJNA 1VQ4Q 3GP8A 3EG2A 5C51B 5KYXA 4QVCA 2PTKA 4YCWA 4RTVA 2P0PA 2DXTA 5DY9A 4JJCA 4C8QB 2VASA 4H2TA 3EG9A 3HHTB 2HAXA 2V1RA 1TSFA 3JB9D 3V8KA 4AG1C 2CP2A 5GMKh 4M7DG 4LUDA 1K8AU 4YRPA 4L59A 3PIOA 1O9SA 2CS7A 2RHSA 3PT9A 1N8RR 1ADJA 2PU9B 1Q95G 1JEGA 5LJ3j 2KMTA 1M5Q1 2KYBA 4HVUA 3QZ9B 4J9IA 2OAWA 2NUTB 1YIJT 1EFWA 2IG0A 5GAN6 3ME9A 4M77A 3H0IA 4M7AB 5KYWB 2DE0X 2CP7A 3J81E 3EG0A 4J6XA 3HTRA 3LSQA 2Z0WA 5CVIA 4FU6A 1WJQA 2AMCB 2COZA 1SF9A 3QXEB 1BBWA 3JV3A 3EGDB 1OI1A 4F7UG 4CI0C 2O31A 2CH4A 2VVKA 2JVVA 2C0OA 2ZINA 4M77D 4MMKA 2QDLA 1MV3A 4FIBA 4WJ3M 1RIQA 3JCMd 4PG3A 1D1AA 1VQOQ 4A4GA 4HCBA 4J5YA 4XTVA 2PMEA 2LQ8A 1AWOA 1M3AA 3AHUA 2M02A 2EFIA 4ZTUB 1UGSB 1BK2A 5FRMA 5GAN8 3BDLA 2XTIA 3RDVA 1YP5A 2JZ2A 5LJ3f 4D8DA 3QJYA 4C5HA 1YI2A 1ZA2B 2NUPA 3OYAA 4M75E 3P8HA 1ZUYA 2QGGA 4LUEA 4OB2B 2O9VA 5GAMj 3PNWC 4JLIA 2RJFA 1R77A 2A8EA 3CCMT 1W2BA 4K87A 1U06A 3JCMc 2DBMA 2O9SA 3G71T 12ASA 3WQZA 3LSSA 3CC7A 2LVMA 3G1JA 3VQXA 4BE0A 2EYQA 5LJ3h 3JCMW 4JJNK 1NJ8A 1T3SA 1D1CA 3UT1A 2JUFA 1NJ2A 2F5TX 4AFQC 1X2KA 3CCVQ 4HKEA 4GLKA 1YJ9A 3RKXA 1MMAA 5CR2A 4FYVB 2JJ9A 1E1TA 2EQMA 2JNGA 3P8BB 2EPDA 4M78A 3NTKA 1KMMA 2M51A 1PWTA 2EQJA 4J9HA 4H2UA 5KE2A 4AFZC 1S72Q 2ZTGA 4M4ZA 2HQXA 3CCRQ 2KVQG 2XU8A 2HNIA 4OGCA 2X3WD 1FMWA 3IALA 1M9SA 1K73C 3GOXA 2ZIOA 2DL3A 4LNSA 2GQVA 4YRRA 2H3JA 2J06A 4WI1A 4J9BA 3G71A 2QHUA 2L8DA 4M78D 4DEYA 1X55A 2DETA 3J7AF 5C0MA 4OVAA 4M7DF 4VUBA 1CKAA 3QYGB 5CKFA 3P8DA 1B76A 1YJWA 1M2VA 2NS6A 2FRWA 4XQ3A 4K86A 4OB1B 2EYYA 2MPXC 3EAEA 1LPLA 3EH2A 4C5IA 1NYGA 4DBFA 1MMNA 4J6WA 2LNHB 2XHCA 1M3CA 4JRPA 1W2BS 4QQ6A 3TEGA 2G6FX 2VYTA 2RHZA 1Y57A 3HFOA 4MZMA 3JCMJ 2BE7D 2B8AA 5KYWA 2CIMA 3CBPA 3H6ZA 2BE9B 3DB4A 4C0GA 1EIYB 4XAXB 1JQQA 3CCSA 2BIVA 2VXFA 4EPCA 2PNIA 4G84A 3N5BB 3OYKA 3CCJQ 4BI8B 3EGDA 4KGXB 1MMDA 3REBB 3I55T 3OQ5A 2KT1A 3EH1A 1ZSZA 1JB0E 3EGXA 4M75G 2Y4YA 3HXXA 2FYKA 3X25B 3VS3A 3HFVA 5LJ5j 2RHYA 3RMSA 4J9FA 2YUOA 3GF5A 3M57A 4FW2A 5GANj 3I5RA 1WQ7A 3JB9G 2D0QB 3L1AA 2OI3A 2RHXA 4QT7A 3E9IA 4TQFA 1MV0B 1QVGP 3M0UA 3CCLT 1X54A 3E9GA 1EX4A 3EFOA 1B7TA 1TUCA 2QASA 2CGHA 2F1LA 2IY5B 1Z9QA 1PKSA 1IO6A 1VQNT 1M4ZA 5D6YA 5KYUB 1VQ9Q 2P0QA 3JB9H 1VQPA 4FYYB 3I55A 3TVTA 2EGAA 1B70B 1PM3A 3SWNA 4LD9K 1B07A 5GAN2 2XDBA 1UGQB 3CD6Q 4TVWA 1NG2A 1YITT 5HY6A 1RLQC 3SD4A 4HVWA 1QWFA 2E70A 1JJCA 1OU9A 4AG2C 3P8YA 2V8KA 3R6NA 4KH1B 4JZ3A 2DJZA 4EDUA 2LRQA 5LJ5f 1MHNA 5FWBA 5C53B 1NJ6A 3UFGA 4C92E 3OY9A 4ZTZB 4IUVA 3I5SA 1YWPA 1SPKA 2I0NA 1GBQA 2DM1A 2X35A 4BUGA 4C0FA 2EAYA 3URGA 3HL8A 3QDRB 1WLEA 3CXCP 4PJNA 4EMGA 1X6OA 1K9MC 4II1A 1FWZA 5KYYB 4P71C 2YLCA 4YRCA 2ZIMA 1NEGA 3CMAT 1SRLA 2K6DA 5FRNA 2ED1A 2L3QA 1Z9ZA 5LJ5h 1VQMA 2HZYA 4M7AE 3VQYA 5GANh 1KIKA 1IHWA 1UB4A 4BY6C 1HXDA 5FU7B 4D6WA 2QEXT 3CCVA 3CMEQ 1Q81C 2K3XA 1U1SA 1Z7NA 1OYXA 4P75A 1VQ8T 1K4US 3H8ZA 2FZGB 3U23A 1TS9A 3QYHB 4FSSA 4BE1A 3PGGA 2P5IA 2C06A 4RTUA 1G3SA 1IGQA 2CH4W 1M8MA 4M7DA 5GAMe 1GL5A 1KG1A 1S72A 4H2WA 3LGFA 1KK7A 4MZTA 3CCRA 3BY7A 1VQZA 2LC4A 1D09B 2E41A 3NGPA 4ZGDB 2ZCFB 3UGQA 3ER0A 2HEQA 1NPPA 1M90R 4Y91A 4XK8E 2LT1A 1YJNQ 4EIKA 4FYXB 3PTAA 4M7DD 4M75F 1NM7A 4KUIA 4HT8A 4QVDA 1N9SA 4P3PA 2E65A 4M77C 2QEXA 1USYA 1HYOA 2QA4T 3RACA 2JXBA 4C0DB 5F5WA 2RJDA 2F2XA 4F7UA 1G5IA 2CZ6B 4AFUC 2MIOA 2P84A 3REUA 1H4QA 3JB9F 2DO3A 4BW9A 2KGTA 3FIFA 3ZBDA 1BI0A 2D6FA 1DJ7B 1K8AR 5GAOr 2J05A 4YDQA 2DIGA 4FT2A 3TSWA 3HRUA 2WSEE 1D3BB 4F04B 4YRQA 3L2ZA 2IY5A 4MDXA 1Q7YC 5IH2A 1KC8C 2R5MA 4C8QG 3OS5A 1LVKA 3CCJA 1XOVA 1NLPC 4B9WA 3OW2A 4PFOA 2KRNA 3GPLA 1M3BA 3F70A 3LH5A 4C5GA 2XDDA 3MEYA 1KOGA 2DTHA 1AD5A 2KRSA 2ARUA 5HKCA 2RD1A 1KQ2A 3M59A 2QA4A 5GAOl 2RHUA 3HXUA 2JS2A 2V8IA 1UUEA 2RK1A 2YT6A 1UJ0A 2I4NA 1I81A 2PQWA 1F1BB 2XIDA 3JSCA 5EC7A 1ACMB 4M7AG 4E47A 3BW1A 1BBZA 3VUBA 4PJOC 1WJSA 1AWJA 2QI2A 1YIJQ 1B34A 4DA4A 1Q82C 3NMZC 5J26A 1BCOA 5CQXA 1SHFA 3H0HA 1NJIR 2M9UA 1VQ9A 4YROA 1NE8A 2RHQB 2ZNJA 1PYSA 1FXXA 4MMLA 3REAB 2DZ9A 1YI2Q 5KYYA 2ZT5A 4OMMA 3ULRB 4ATOA 3QUIA 4RQFA 5ELNA 2P4RA 1HSQA 3V7SA 5GANe 3CD6A 1WQWA 2E6NA 4J8OA 3GBQA 1KHIA 4R0KA 4YRKA 1GFCA 2LJ0A 3CPWS 2EBPA 4XTXA 1ZQ1A 2JW4A 2ROTA 2I4MA 4O2DA 4UP9A 3SFMA 2K3YA 2HL5C 3PVLA 3L4GA 3QIIA 1QP2A 3OS2A 2VUBA 3FC3A 2DXCA 3OW2S 3QTCA 4DBRA 3KFUA 3QBYA 1V29B 5CK9A 1QW1A 1WA7A 4X9DA 3A7AA 5D7UA 1VYUA 2K79A 5CKDA 2DL5A 2A08A 3FJPA 2RK2A 2FPEA 1YCYA 3CCQA 3OSVA 4N0AA 4P72A 1JJ2P 2QHTA 2NUZA 1EQRA 2DERA 3TEEA 3BFMA 3NTIA 2O2OA 3DLMA 2ODRD 3EG3A 4A54A 5DLOA 4YRNA 3G71Q 1OEBA 1AT1B 4M78F 3ICAA 1G3WA 5AT1B 1K0XA 3MEUA 1OPKA 1IGUA 4BACA 3CMEA 3MF2A 1R8OB 5GAOn 3A7RA 1OX9A 2A7YA 4RG8A 2B86A 3VUZA 1VUBA 3M4PA 1AEYA 2CP3A 4HWPA 4M75A 4PJOB 2J6FA 2DKGA 3QZ5B 5J39A 4YREA 4H2XB 2DTIA 4LVMA 2RQUA 2K5LA 1ATIA 1D0XA 4YPFA 4C8QF 2Q5IA 4XEOA 1PRMC 2JTMA 1G8XA 1IREB 1N8RC 1X75C 5LL6S 1GCQA 1ZBXA 3Q1JA 2DD4A 4H2VA 4R56A 1ZBJA 1K9MU 1RAGB 4M75D 3CCSQ 2MMPA 3REXA 4KGZB 1YHQT 1X27A 1UE9A 3VYHB 1RI0A 4A4HA 2ZCEA 3JCMP 5A0GA 2E5QA 1YFNA 1V76A 1AWWA 4P73C 2DILA 1WFWA 1EVKA 2ABLA 1RACB 4N4HA 4C92B 4TWAA 3OYJA 2Q5HA 2MCNA 2OTJT 1EZZB 4ZIBA 2BZXA 2CKKA 1Q81U 3JRZA 2W0ZA 3RUXA 3HTZA 2EJ9A 4OB0B 1EIFA 1ZA1B 3A74A 3SWNC 3CBOA 2HKNA 2HSEB 3G4ST 1H4SA 1PHTA 3VU3C 3QPHA 1SKUB 2LZ6B 2DL4A 2I2LA 3OYHA 4NCXA 1NLOC 2RM4A 1KD1C 4LE9A 2QHSA 2E6ZA 4TQDA 2KQWA 1A0NB 2RQWA 3A5YA 3E2UA 2DRKA 5HK0A 4R55A 3OYCA 3SB2A 3FB9A 3JCMf 5GMKm 3L2UA 3RL6A 2H8HA 1VQPQ 4EMKA 3VS4A 1JXOA 3I55Q 4E7LA 4DBHA 5FU6B 4MDWA 1VQ6T 4QVZA 2L5QA 5CKEA 4XTZA 3X26B 1B3QA 3C4SA 1I0CA 4EMHA 2XICA 4LNPA 1OX8A 3DLLA 3TEHB 2LDMA 2NYSA 4KRTA 1X2GA 2K5FA 2AZVA 4WF2A 4AH6A 1UDLA 4RDXA 4BI3A 3FEOA 4ELZC 2CREA 3OYMA 1QVFP 2L3PA 3OS1A 1VQLT 4YCVA 2KEAA 4CH4A 1X69A 1YIJA 4LD6A 1QQJA 3RIRA 2QHVA 2JM8A 2QDYB 1WU7A 1BCMA 3I56T 2DLPA 1VQ5T 2LQKA 4RTYA 1TUGB 1TWBA 3CPFA 4IIMA 3PVQA 3NENA 4X1VA 1QVGA 2CT4A 3LWHA 1KC8U 1M1FA 1RL2A 2BUDA 1VQNQ 2DQ3A 4J15A 3ZL7C 2HMAA 5CIUA 1QE0A 5EG2A 1PNJA 4IUTA 2K2MA 5HK3A 3BE3A 3MJXA 2FG0A 2CSQA 4RTXA 4M7DC 2EL9A 4CH3A 1WHKA 1G83A 4LDYA 2YWWA 3JAME 1VQMQ 2HQEA 2AHJB 2Y90A 4JJDA 2ZPIB 3VYGA 5ECAA 4WTOB 3LC0A 2ZZDA 1NJ5A 5CO7A 1VQLA 4RTWA 3JCMg 2KI7A 4J9EA 4DPGA 3RGLA 3V7RA 1RUWA 1GGMA 3MQZA 4AFSC 2EJFA 5LJ3d 3I56A 1VQ5A 2E5KA 3CQTA 1ZX6A 4WJ4A 2RO0A 2NLUA 1WHGA 1KQ1A 3M5AA 1LOJA 1SETA 3O5ZA 1Q82U 1ABOA 1USYC 4B6MA 2CJBA 5GAOp 1J5WA 2JTFA 5L8RE 2M0OA 2DU5A 3DSQA 1IRXA 4HCZA 1YCSB 3X20B 4F14A 3CCMA 3RMQA 4CS3A 3C94A 3M54A 3CMAQ 1UTIA 2QXFA 4Q6GA 3UGTA 4XTYA 4C8QA 2CT3A 1KSWA 4JDSA 1T3LA 2K5IA 2KR3A 3VQVA 3A5ZB 5GMKe 4C92A 1GCPA 3CC4T 2EQUA 2L0AA 1PSFA 2QEXQ 2KT8A 4EO4A 1VQ8Q 1X43A 1KJWA 1CSKA 3LW5E 4LDUA 1H641 4M77E 2EWNA 5A2QE 4C8QD 2DVEA 2NUTA 4XTWA 2I4OA 1PSEA 4C92D 1J3TA 4PLLA 2YUPA 2RI3A 4M7AA 2VGNA 2A0FB 2E10A 4FW1A 1ZUKA 1BB9A 3S3MA 2AMCA 4F7UF 5GAMd 2FRYA 5E3IA 1T0JA 2EJGA 3OS0A 4IIOA 1JRIA 2O4XB 1HC7A 4KR2A 1Z7MA 3I35A 2KXDA 4JLGA 2HQHA 2CP0A 2QA4Q 3CC2T 4M7AD 2M0YA 1UG1A 2KBTA 4CC7A 3CMQA 5CQYA 2RQVA 3VS1A 4L5GA 2HD0A 1RADB 1SSHA 1K76A 2P0KA 3ZEHA 4RQEA 1BIBA 2KDSA 1PC0A 1KFZA 2E1HA 3QO3A 3J80E 4NL3A 5DLQE 3X28B 3HSBA 1EOVA 1UEBA 2X9HA 4BDZA 3MEAA 1KQSA 3A8OB 2RQRA 1EVLA 1FYNA 2DZCA 4UP8A 3TREA 2X4XA 1VYVA 2XG8D 4PJOE 2HL3A 5I21A 1QP3A 3A8GB 3G6ET 4H2YA 4Y28E 1I1JA 2YLBA 2AKWB 1K1ZA 3META 1P92A 3HXYA 1WPYA 2FHDA 1U8RA 2G3RA 3PCOB 4Z02A 2PUKB 4UP7A 5LJ3e 2J3LA 4ESRA 4P3OA 2LX9A 2ESWA 1IHVA 1WX6A 5IXBA 1UGRB 2XDPA 4N4GA 1RAFB 3PMIA 3RBBB 1VQKT 2ZT6A 2L3RA 4YRFA 3E1SA 3CCLA 1MMGA 2P0LA 1IL2A 3IKLA 5IHKA 5GAN4 1M1KC 4G85A 1K9AA 2GQIA 1MUZA 1D1BA 1VQNA 4JRIA 1AHJB 3C12A 2VB6A 1KD1U 3EGUA 2VV5A 2DBKA 1QCFA 4OMNA 2LNVA 2ZXFA 2W10A 2A28A 2YUQA 4HVVA 3VJPA 4ZGEB 3C95A 4M75C 3CCQQ 1G5HA 3P8VA 3LGLA 4HT9A 2JMCA 4OB3B 1YITA 2ARSA 2M1HA 2KE9A 2QGFB 5KCOA 1E24A 2RH2A 1M27C 2X4WA 5LJ5d 4JS5A 2KYMA 1VQKA 1JO8A 4DQ2A 1NPRA 4RMFA 1KQSS 3OYBA 5GANd 2DRMA 3KBGA 1KMNA 1GRIA 1UGPB 3OYGA 4OMQA 2DVJA 3VS5A 4QQDA 5KE3A 2AZSA 1WYDA 2ZPFB 1N9RA 2HDAA 2DFUA 5IHIA 3JB9J 1WNLA 2DDZA 3A32A 3UA6A 2QTVA 2E3CA 1X01A 1QWEA 1EIYA 2OTLT 2DU7A 3CMAA 2F69A 2FPFA 1L0WA 1R0CB 3GNGA 3RKYA 5K1XA 3THKA 1NBEB 4J83A 1K9MR 2LX7A 1Q86C 3G1ZA 2E64A 4J7IA 1ZHIA 4KULA 4PJOG 1Y96B 4YTLA 2GBQA 3HXZA 1JXMA 1VQ8A 1QLYA 8ATCB 1ZUUA 3VBBA 3IG2A 2CZ1B 3M56A 1Q81R 5IN1A 1IB8A 1W6XA 4F17A 3M58A 2RPNA 3HFZB 2EVRA 2ZNIA 3HRIA 4YRGA 2E12A 4XEMA 2IPOB 3QNEA 1UGVA 2X3XD 4FT4A 2OTLA 1BBUA 1X2HA 2KNBB 2LJ3A 2XKOC 1E6HA 2ZAEA 2SRCA 5KYUA 1GBRA 1G51A 1K73U 3CBMA 4TVAB 4RCCA 11ASA 4ZN1A 3RNJA 4C92G 2AKWA 4MZPA 3SDZA 3RERA 1B70A 1OOTA 1NJIC 4YRSA 4P3NA 3PCOA 2CSIA 2ENMA 3X24B 4E7KA 2FVUA 4CS2A 4BY6B 1B7YB 2MF2A 3A8LB 2M16A 3RF1A 1XJWB 2OTJQ 2JOYA 5KYXB 4H2SA 2LCLA 3E9FA 1OU8A 3OYYA 2YDLA 1TG0A 3L2RA 2PVGB 2LT4A 1UHFA 2L2PA 2QQAA 4CRIA 3UH0A 3R07A 3OMGA 2Q7EA 5A0LA 2HKQB 1QVPA 2F2WA 3WXMB 4B9XA 3IQLA 3L42A 1GXIE 2V26A 4LVKA 2XGTA 1HTTA 4CH6A 2WACA 1OZ2A 5CKBA 4YRLA 2RHSB 1RLPC 4K11A 1KC8R 5LJ5e 1NYFA 4PFZA 2KRMA 1D0ZA 4M78C 3RESA 1H8KA 1IZ6A 1VQ6Q 4M77B 1C0AA 1VYTA 1SRMA 2ZPGB 3LX7A 3S3NA 1AVZC 1HJDA 2QQBA 1LCKA 3EHRA 1PD0A 2DQ0A 3CCET 3M0QA 4M7DE 5IXFA 4KT0E 1VQLQ 1I4K1 4LVJA 2LP5A 1BI3A 4ELYC 2DYBA 1W70A 2KSSA 4C8QC 1RAEB 2R58A 2CZ0B 3I56Q 1VQ5Q 3H41A 4DEXA 2LCCA 2H3EB 1AZEA 2YSQA 4P5NA 3VS2A 3OYLA 1NJ1A 5D6XA 1Q82R 4ZTJA 4J9CA 2CYZB 4E6RA 3EFRA 1UFFA 4X34A 2COYA 2DMOA 2OX7A 3QWXX 4JPBW 3CCMQ 2O01E 4CC3A 2EGCA 5GJWB 4JS4A 4OF1A 1SHGA 2MYSA 3EHQA 2ZPHB 1WZOA 2O88A 1FX7A 1Y96A 3QDFA 2ZT7A 4ORZA 1X6BA 2NUPB 1M8VA 1RAAB 3JCMb 3CCEA 4K88A 1YBYA 1JBMA 2K3BA 3UA7A 1YJNT 2GTOA 3H0FA 2JM9A 3LLRA 4YRIA 3NFCA 2YHTA 1RAIB 2CDTA 3FDRA 2GGRA 2LCSA 3A7UA 1I8FA 3RKWA 2Q7HA 2DAQA 2PVDB 2X51A 1M1KU 3VS6A 4DOVA 3QO8A 1ZSZC 1D3BA 5C52B 1LJOA 1PRLC 1Y71A 5IHNA 2C0IA 4HCCA 2ZZGA 4C92F 3OSSC 3CPWP 5GAN7 4NL2A 3M4QA 2R5AA 4TVAA 2E5AA 4C5EA 4RKUE 3CCUT 3MHXA 4M78B 2DXUA 2YUNA 2FEIA 5KCHA 1N6AA 3I7FA 1B7YA 3NETA 3OW2P 3QO5A 3DB3A 3ASKA 2I4LA 4O6JA 2RB6A 3INZA 4IUUA 4WCIA 3QG1A 1HD3A 1VIEA 5M9OA 5GAN3 3C0CA 4M7AF 5FWCA 1W1FA 2RN8A 3L2VA 2GFAA 5HCKA 3QJ6A 4AT1B 4E2FB 4UPAA 1BU1A 1YNZA 1FMVA 1YFSA 1WXTA 1SG5A 2J6KA 2MAMA 4KUDK 3PE0A 3PIPA 3OD1A 2L89A 3UDCA 2ARTA 1M2VB 3A8HB 2RHQA 2BTTA 5IAYA 3CCUA 2G4CA 2Y4XA 1YHQA 4BB7A 1SERA 4IUPA 3TSZA 2DK3A 3EFSA 1M30A 4RTTA 2RA2A 1PKTA 2EYWA 4X5OA 2IVWA 2DX1A 3VS0A 2FPDA 3M0TA 4GBQA 3HRTA 1C0MA 3MP1A 1Q86U 2EYXA 4PKCC 4RG2A 3OBWA 3JB9I 2J7IA 3G7ZA 4ANJA 2LMJA 2OJ2A 1H3HA 3CC2Q 2OTJA 2QTXA 3UATA 1BYMA 5KH6A 4QW2A 2QK0A 3WVEB 2BZ8A 1YI2T 2K57A 2VKNA 2DEUA 2YRCA 1VQ7T 1NZ9A 3OBYA 2QQ9A 3S6WA 3G4SA 3JCMh 3HPWA 2AIRB 3VV0A 1ZSZB 3EGXB 4KH0B 2WSCE 3CCLQ 2C0TA 4DOWA 2DL8A 2K9GA 3PMTA 2MWPA 3CC7T 3UWNA 2E3IA 1BI2A 3PFSA 1I5OB 1Q7YU 1OZ3A 3M0SA 4YRMA 4LVIA 4P75C 1KD1R 4GY5A 3G6EQ 4OMFB 2HBPA 3OYNA 1RABB 4GLMA 1YJ9T 1VQ6A 3GIBA 1NJIU 1H3ZA 1Y07A 4PK4A 4HWRA 3EFOB 1I07A 1YITQ 1TTHB 3NPFA 1UECA 1AWXA 4XTUA 5GMKl 1WHJA 2RNAA 1VQ7A 2ZGWA 1BIAA 4OLFA 2LJ1A 3M4YA 3MP6A 1VQKQ 4Y92A 2DXBA 1XQHA 4IUQA 3FLGA 4PJOA 3LH0A 1YFTA 4TVRA 4Q5WA 3SWNB 5DM7R 4H2XA 4DBQA 2JT4A 3H9NA 3M4GA 2ZR3A 1G3TA 3GNFB 3QSUA 3LYIA 1QKWA 1MNEA 3JCMX 2PVOB 4PLIA 1PG5B 4OMPA 4JJBA 4KR3A 3UF4A 2AK5A 1JJCB 3UPUA 1O75A 1YWOA 4Z89A 3BDUA 4LDXA 1YJWT 3CEYA 1SESA 5I2SA 2RJCA 3T9NA 4PJOD 1EFNA 4HCKA 3CXCA 1YB3A 1U1TA 2XD0A 5L23A 2JTEA 1ADYA 4ME7A 2ZT8A 1E1OA 5I2MA 2AKLA 3EG1A 3A31A 2Q7GA 2EKHA 1QCNA 4J7FA 4A4KA 5CCAA 2E4HA 3OYIA 1VQ4T 2DL7A 2KXCA 3OMCA 4E7JA 4H02A 3CCST 2OAUA 4Z88A 1QVGS 4LVLA 2HBWA 4YRJA 5LJ3g 5GAMf 2DYIA 1MGQA 3TQ7P 2RQTA 4PHCA 5CKHA 3FRNA 2F5KA 2OTLQ 2QQRA 1E22A 3HY0A 1CKBA 1NNHA 3M53A 1TXQA 4AMCA 2K2VA 1YN8A 1X56A 4KGVB 1QKXA 1X2QA 2DTOA 1AZGB 3V8LA 4J9DA 1ABQA 1WYXA 4QKUA 1K73R 4M7DB 2ATCB 4JZ4A 4RCBA 2EQKA 1H4TA 3CC4A 3BJUA 5GAMh 2CUDA 2RI2A 1Y0MA 1G2BA 4Z8AA 1VQ4A 1LYLA 4XU0A 3VRZA 1RAHB 4P74A 3MEVA 3TEHA 3JCMQ 3JCMe 3TCJA 1MNDA 4F16A 2XMFA 2FB7A 5GAN5 2YRVA 1VQPT 1W66A 4TVYA 3GLXA 3KXTA 2ZR2A 2CJ9A 5GJVB 4RMOA 1C1AA 2QQSA 4OGEA 4A4EA 2ECZA 3CXCS 2CP6A 3NELA 2PZ1A 2WSFE 4YRTA 3NTHA 4E51A 4PJLA 5C6SA 1ASYA 1N27A 4HA8A 5FU7C 4F7UB 3VKIA 3HRSA
chains in the Genus database with same CATH topology
1VQOT 2RHIA 3L2QA 3TU4K 5GAMg 2FL7A 3OYDA 4ZGJB 4P73A 2XI9A 4UC4A 2ODRC 3CC2A 2EKOA 1WGSA 1B8AA 2VC8A 4HT4A 2DD5A 3MP8A 3LWIA 4XU3A 4M78E 2XK0A 1M1GA 4N0AC 4P72C 1N9WA 2RI5A 3HP9A 2PUOB 1WJRA 3TUPA 4E7HA 3HFNA 2ZPEB 1VQMT 4ZN3A 4BWAA 1VQOA 4YP0A 4C0DC 3G6EA 3CCVT 1VIFA 4M77G 4C8QE 4PL6A 4JUVA 5D6WA 3OYEA 1KHCA 3MCAB 2GFUA 1SSFA 4HWOA 1Y7XA 1B34B 2P4TA 3PZCA 5GANf 4A53A 4IURA 1M90C 1S72T 3A5ZA 2DIQA 3CCRT 1PYSB 3E9HA 3A8MB 3OB9A 3S3OA 4N4IA 2BKDN 3MO8A 2J3MA 3W3SA 2DEQA 1K8AC 2VXEA 3OA6A 4LDVA 3L4GB 4X9CA 4YYEA 4LDWA 3ZFJA 2O4XA 2MWOA 2A3LA 1JJ2A 4CS4A 2C7IA 3JCMV 4JRQA 1XTDA 5J3BA 1NYQA 5GAOm 4KBMB 3M55A 2KK4A 2V8JA 5LJ5g 4J6YA 4A4FA 3CCJT 4OP0A 5IT9E 5GANg 2CJAA 3R6OA 4EMKC 5FLXE 1G5VA 4FL6A 5HGQA 4YCUA 4M78G 3HY1A 5KNNA 3WVDB 4M75B 2GCXA 4HVCA 3CPWA 2MI6A 1QF6A 3HXWA 5FROA 2DPPB 2ALYB 4KQEA 4FSXA 2EIFA 1YFRA 4FM4B 1VQ9T 1BI1A 2RJEA 4BD3A 3KUFA 2X4JA 2JN0A 4NS5A 3V8JA 3CD6T 2R57A 3DKMA 1LNXA 4M77F 1JJ2S 3HXVA 1HK9A 1XNIA 3O8VA 3QHSA 4JRKA 3IKMB 2GF7A 5A0DA 2C8MA 4NOYA 4PNOA 1YGBA 1NYRA 2K4YA 1H4VB 3CCQT 3MEWA 4EMKB 1FYFA 2ZZEA 2D9TA 4E7IA 1QVFA 2LTOA 4XU1A 3L2WA 4V2SA 4C92C 4L6V5 3CMET 5K1PA 1SRYA 3HKSA 4BI4A 5GMKj 3HRKA 4C0ZA 4PJOF 4TTVA 4HWSA 2CZ7B 4F7UE 4IKFA 3MF1A 2KY9A 3NEMA 4M7AC 5GAOq 3ERRA 4QQGA 4XU2A 3P8TA 3M9QA 4Q15A 4CH5A 2VGMA 3HFZA 2PMFA 5FU6C 3VQWA 1W4SA 1G3YA 1TH7A 5ELOA 1I5LA 2X4YA 3V7CA 3E19A 5CAIA 2ZZFA 4P74C 4P71A 4HWTA 4L87A 3QKJA 4ZTFA 2KAFA 4O5VA 5AYFA 1BKBA 2ALYA 3QO7A 4EX5A 3OYFA 2ZPBB 1M90U 1ASZA 4BDYA 1QVFS 5GMKi 4BE2A 1YJNA 3GP8A 5C51B 4QVCA 4YCWA 2P0PA 2DXTA 5DY9A 4C8QB 4H2TA 3HHTB 2HAXA 3JB9D 3V8KA 5GMKh 4M7DG 1K8AU 4YRPA 4L59A 3PIOA 1O9SA 2CS7A 2RHSA 3PT9A 1ADJA 2PU9B 5LJ3j 2KMTA 1M5Q1 3QZ9B 1YIJT 1EFWA 2IG0A 5GAN6 3ME9A 4M77A 4M7AB 3J81E 4J6XA 3LSQA 5CVIA 4FU6A 1WJQA 2AMCB 3QXEB 1BBWA 1OI1A 4F7UG 4CI0C 2JVVA 2ZINA 4M77D 4MMKA 4FIBA 4WJ3M 1RIQA 3JCMd 4PG3A 4A4GA 4HCBA 4J5YA 4XTVA 2PMEA 2LQ8A 3AHUA 2EFIA 4ZTUB 1UGSB 5FRMA 5GAN8 3BDLA 2XTIA 2JZ2A 5LJ3f 3QJYA 4C5HA 1YI2A 3OYAA 4M75E 3P8HA 4OB2B 5GAMj 3PNWC 4JLIA 2RJFA 2A8EA 3CCMT 1W2BA 4K87A 3JCMc 3G71T 12ASA 3WQZA 3LSSA 3CC7A 2LVMA 3VQXA 4BE0A 2EYQA 5LJ3h 3JCMW 4JJNK 1NJ8A 3UT1A 2JUFA 1NJ2A 2F5TX 4HKEA 4GLKA 1YJ9A 3RKXA 5CR2A 1E1TA 2EQMA 2JNGA 3P8BB 4M78A 3NTKA 1KMMA 2EQJA 4H2UA 5KE2A 2ZTGA 2HQXA 2KVQG 2XU8A 2HNIA 4OGCA 3IALA 1M9SA 1K73C 3GOXA 2ZIOA 4LNSA 2GQVA 4YRRA 2H3JA 4WI1A 3G71A 2QHUA 2L8DA 4M78D 1X55A 3J7AF 5C0MA 4OVAA 4M7DF 4VUBA 3QYGB 5CKFA 3P8DA 1B76A 1YJWA 2NS6A 4XQ3A 4K86A 4OB1B 3EAEA 4C5IA 4J6WA 2XHCA 4JRPA 1W2BS 4QQ6A 3TEGA 2VYTA 2RHZA 3HFOA 4MZMA 3JCMJ 2B8AA 2CIMA 3CBPA 3H6ZA 3DB4A 4C0GA 1EIYB 4XAXB 3CCSA 2BIVA 2VXFA 4EPCA 4G84A 3N5BB 3OYKA 4BI8B 3I55T 3OQ5A 1JB0E 4M75G 2Y4YA 3HXXA 2FYKA 3X25B 3HFVA 5LJ5j 2RHYA 3RMSA 3GF5A 3M57A 5GANj 1WQ7A 3JB9G 2D0QB 3L1AA 2RHXA 3E9IA 4TQFA 3CCLT 1X54A 3E9GA 2CGHA 2IY5B 1VQNT 1M4ZA 5D6YA 2P0QA 3JB9H 1VQPA 3I55A 1B70B 3SWNA 4LD9K 5GAN2 2XDBA 1UGQB 4TVWA 1YITT 5HY6A 3SD4A 2E70A 1JJCA 3P8YA 2V8KA 2DJZA 4EDUA 2LRQA 5LJ5f 1MHNA 5C53B 1NJ6A 3UFGA 4C92E 3OY9A 4ZTZB 4IUVA 2X35A 4C0FA 4BUGA 2EAYA 3URGA 3HL8A 3QDRB 1WLEA 4EMGA 1X6OA 1K9MC 4II1A 1FWZA 4P71C 2YLCA 4YRCA 2ZIMA 3CMAT 5FRNA 5LJ5h 1VQMA 4M7AE 3VQYA 5GANh 1UB4A 4BY6C 1HXDA 5FU7B 4D6WA 2QEXT 3CCVA 1Q81C 2K3XA 1U1SA 1Z7NA 1OYXA 4P75A 1VQ8T 3H8ZA 3QYHB 4BE1A 3PGGA 2P5IA 2C06A 1G3SA 4M7DA 5GAMe 1KG1A 1S72A 4H2WA 3LGFA 4MZTA 3CCRA 3BY7A 1VQZA 2LC4A 2E41A 4ZGDB 2ZCFB 3UGQA 3ER0A 1NPPA 4Y91A 4XK8E 2LT1A 3PTAA 4M7DD 4M75F 4KUIA 4HT8A 4QVDA 1N9SA 4P3PA 2E65A 4M77C 2QEXA 1USYA 2QA4T 3RACA 5F5WA 4C0DB 2RJDA 4F7UA 1G5IA 2CZ6B 3REUA 1H4QA 3JB9F 2DO3A 4BW9A 3FIFA 3ZBDA 1BI0A 2D6FA 1DJ7B 5GAOr 4YDQA 2DIGA 4FT2A 3HRUA 2WSEE 1D3BB 4YRQA 3L2ZA 2IY5A 4MDXA 1Q7YC 1KC8C 2R5MA 4C8QG 3OS5A 3CCJA 1XOVA 4B9WA 3OW2A 3GPLA 3F70A 4C5GA 2XDDA 3MEYA 1KOGA 2DTHA 2ARUA 5HKCA 2RD1A 1KQ2A 3M59A 2QA4A 5GAOl 2RHUA 3HXUA 2V8IA 2RK1A 2I4NA 1I81A 2PQWA 2XIDA 3JSCA 4M7AG 4E47A 3BW1A 3VUBA 4PJOC 1WJSA 2QI2A 1B34A 4DA4A 1Q82C 5J26A 5CQXA 2M9UA 1VQ9A 4YROA 1NE8A 2RHQB 2ZNJA 1PYSA 1FXXA 4MMLA 2DZ9A 2ZT5A 4ATOA 3QUIA 4RQFA 5ELNA 3V7SA 3CD6A 5GANe 1WQWA 2E6NA 4J8OA 1KHIA 4YRKA 3CPWS 4XTXA 1ZQ1A 2I4MA 4O2DA 4UP9A 3SFMA 2K3YA 3L4GA 3QIIA 1QP2A 3OS2A 2VUBA 3FC3A 2DXCA 3OW2S 3QTCA 3KFUA 3QBYA 1V29B 5CK9A 1QW1A 4X9DA 3A7AA 5CKDA 3FJPA 2RK2A 1YCYA 3CCQA 3OSVA 4N0AA 4P72A 2QHTA 1EQRA 3TEEA 3BFMA 3NTIA 2ODRD 3DLMA 4A54A 5DLOA 4YRNA 4M78F 3ICAA 1G3WA 3MEUA 4BACA 3CMEA 3MF2A 1R8OB 5GAOn 3A7RA 2A7YA 4RG8A 3VUZA 1VUBA 3M4PA 4HWPA 4M75A 4PJOB 2DKGA 3QZ5B 5J39A 4YREA 4H2XB 2DTIA 4LVMA 2K5LA 1ATIA 4YPFA 4C8QF 2Q5IA 4XEOA 2JTMA 1IREB 1N8RC 1X75C 5LL6S 1ZBXA 3Q1JA 2DD4A 4H2VA 4R56A 1K9MU 4M75D 3REXA 2MMPA 1YHQT 3VYHB 1RI0A 4A4HA 2ZCEA 3JCMP 5A0GA 2E5QA 4P73C 1EVKA 4N4HA 4C92B 4TWAA 3OYJA 2Q5HA 2OTJT 4ZIBA 2CKKA 1Q81U 3JRZA 3RUXA 3HTZA 2EJ9A 4OB0B 1EIFA 3A74A 3SWNC 3CBOA 3G4ST 1H4SA 3VU3C 3QPHA 2I2LA 3OYHA 4NCXA 2RM4A 1KD1C 2QHSA 2E6ZA 4TQDA 2KQWA 3A5YA 5HK0A 4R55A 3OYCA 3SB2A 3FB9A 3JCMf 5GMKm 3L2UA 3RL6A 4EMKA 4E7LA 5FU6B 4MDWA 1VQ6T 4QVZA 2L5QA 5CKEA 4XTZA 3X26B 3C4SA 4EMHA 2XICA 3DLLA 3TEHB 2LDMA 1X2GA 2K5FA 4WF2A 4AH6A 4RDXA 4BI3A 3FEOA 4ELZC 3OYMA 3OS1A 1VQLT 4YCVA 4CH4A 1YIJA 4LD6A 3RIRA 2QHVA 2QDYB 1WU7A 3I56T 1VQ5T 2LQKA 3CPFA 3NENA 1QVGA 3LWHA 1KC8U 1M1FA 1RL2A 2BUDA 2DQ3A 4J15A 5CIUA 1QE0A 5EG2A 4IUTA 5HK3A 4M7DC 2EL9A 4CH3A 4LDYA 3JAME 2HQEA 2AHJB 2Y90A 3VYGA 2ZPIB 3LC0A 2ZZDA 1NJ5A 5CO7A 1VQLA 3JCMg 4DPGA 3RGLA 3V7RA 1GGMA 3MQZA 2EJFA 5LJ3d 3I56A 1VQ5A 4WJ4A 2RO0A 2NLUA 1KQ1A 3M5AA 1LOJA 1SETA 1Q82U 1USYC 2CJBA 5GAOp 1J5WA 2JTFA 5L8RE 2M0OA 2DU5A 3DSQA 4HCZA 3X20B 3CCMA 3RMQA 4CS3A 3C94A 3M54A 3UGTA 2QXFA 4Q6GA 4XTYA 4C8QA 4JDSA 2K5IA 3VQVA 3A5ZB 5GMKe 4C92A 3CC4T 2EQUA 1PSFA 4EO4A 3LW5E 4LDUA 1H641 4M77E 2EWNA 5A2QE 4C8QD 2DVEA 4XTWA 2I4OA 1PSEA 4C92D 4PLLA 4M7AA 2RI3A 2VGNA 2E10A 2AMCA 3S3MA 4F7UF 5GAMd 5E3IA 2EJGA 3OS0A 1JRIA 2O4XB 1HC7A 4KR2A 1Z7MA 4JLGA 3CC2T 4M7AD 3CMQA 5CQYA 4L5GA 2HD0A 2P0KA 3ZEHA 4RQEA 1BIBA 2KDSA 2E1HA 3QO3A 3J80E 4NL3A 5DLQE 3X28B 3HSBA 1EOVA 1UEBA 4BDZA 3MEAA 1KQSA 3A8OB 1EVLA 2DZCA 4UP8A 3TREA 2X4XA 2XG8D 4PJOE 5I21A 1QP3A 3A8GB 3G6ET 4H2YA 4Y28E 2YLBA 2AKWB 3META 1P92A 3HXYA 1WPYA 2FHDA 1U8RA 2G3RA 3PCOB 4Z02A 2PUKB 4UP7A 5LJ3e 2J3LA 4P3OA 2LX9A 1UGRB 2XDPA 4N4GA 3PMIA 1VQKT 2ZT6A 2L3RA 4YRFA 3E1SA 3CCLA 2P0LA 1IL2A 3IKLA 5GAN4 1M1KC 4G85A 1VQNA 4JRIA 1AHJB 3C12A 1KD1U 2VV5A 2LNVA 2ZXFA 3VJPA 4ZGEB 3C95A 4M75C 1G5HA 3P8VA 3LGLA 4HT9A 4OB3B 1YITA 2ARSA 2M1HA 5KCOA 1E24A 2RH2A 2X4WA 5LJ5d 4JS5A 1VQKA 4DQ2A 1NPRA 4RMFA 1KQSS 3OYBA 5GANd 3KBGA 1KMNA 1UGPB 3OYGA 4QQDA 5KE3A 1WYDA 2ZPFB 1N9RA 3JB9J 1WNLA 2DDZA 3A32A 2E3CA 1X01A 1EIYA 2OTLT 2DU7A 3CMAA 2F69A 1L0WA 3GNGA 3RKYA 5K1XA 4J83A 1Q86C 3G1ZA 2E64A 4J7IA 1ZHIA 4KULA 4PJOG 1Y96B 4YTLA 3HXZA 1VQ8A 3VBBA 3IG2A 2CZ1B 3M56A 5IN1A 3M58A 3HFZB 2ZNIA 3HRIA 4YRGA 2E12A 4XEMA 3QNEA 4FT4A 2OTLA 1BBUA 1X2HA 2XKOC 1G51A 1K73U 3CBMA 4TVAB 4RCCA 11ASA 4ZN1A 4C92G 2AKWA 4MZPA 3SDZA 3RERA 1B70A 1NJIC 4YRSA 4P3NA 3PCOA 3X24B 4E7KA 2FVUA 4CS2A 4BY6B 1B7YB 2MF2A 3A8LB 2M16A 3RF1A 2JOYA 4H2SA 2LCLA 3E9FA 3OYYA 3L2RA 2PVGB 2LT4A 2QQAA 4CRIA 3UH0A 3R07A 3OMGA 2Q7EA 5A0LA 1QVPA 3WXMB 4B9XA 3L42A 1GXIE 4LVKA 2XGTA 1HTTA 4CH6A 2WACA 1OZ2A 5CKBA 4YRLA 2RHSB 5LJ5e 4M78C 3RESA 1IZ6A 4M77B 1C0AA 2ZPGB 3LX7A 3S3NA 2QQBA 2DQ0A 3CCET 4M7DE 4KT0E 1I4K1 4LVJA 1BI3A 4ELYC 2KSSA 4C8QC 2R58A 2CZ0B 2LCCA 4P5NA 3OYLA 1NJ1A 5D6XA 4ZTJA 2CYZB 3EFRA 4X34A 2O01E 4JS4A 4OF1A 2ZPHB 1FX7A 1Y96A 2ZT7A 1M8VA 3JCMb 3CCEA 4K88A 1YBYA 1JBMA 1YJNT 3LLRA 4YRIA 3NFCA 2YHTA 3FDRA 3A7UA 1I8FA 3RKWA 2Q7HA 2DAQA 2PVDB 1M1KU 4DOVA 3QO8A 1D3BA 5C52B 1LJOA 1Y71A 4HCCA 2ZZGA 4C92F 3OSSC 5GAN7 4NL2A 3M4QA 2R5AA 4TVAA 2E5AA 4C5EA 4RKUE 3CCUT 3MHXA 4M78B 2DXUA 5KCHA 1N6AA 3I7FA 1B7YA 3NETA 3QO5A 3DB3A 3ASKA 2I4LA 4O6JA 2RB6A 3INZA 4IUUA 5M9OA 3QG1A 1VIEA 5GAN3 4M7AF 3L2VA 2GFAA 3QJ6A 4UPAA 1YFSA 2MAMA 4KUDK 3OD1A 3PIPA 2L89A 3UDCA 2ARTA 3A8HB 2RHQA 5IAYA 3CCUA 2G4CA 2Y4XA 1YHQA 4BB7A 1SERA 4IUPA 2DK3A 3EFSA 2RA2A 4X5OA 2IVWA 3HRTA 3MP1A 1Q86U 4PKCC 4RG2A 3OBWA 3JB9I 3G7ZA 2OTJA 2QTXA 1BYMA 5KH6A 4QW2A 3WVEB 1YI2T 2K57A 1VQ7T 1NZ9A 3OBYA 2QQ9A 3S6WA 3G4SA 3JCMh 3HPWA 3VV0A 2WSCE 4DOWA 3PMTA 2MWPA 3CC7T 3UWNA 1BI2A 3PFSA 1Q7YU 1OZ3A 4YRMA 4LVIA 4P75C 4GY5A 4OMFB 2HBPA 3OYNA 1YJ9T 1VQ6A 3GIBA 1NJIU 1H3ZA 1Y07A 4HWRA 5GMKl 4XTUA 1VQ7A 2ZGWA 1BIAA 4OLFA 3M4YA 3MP6A 2DXBA 1XQHA 4IUQA 3FLGA 4PJOA 3LH0A 1YFTA 4TVRA 4Q5WA 3SWNB 5DM7R 4H2XA 3M4GA 2ZR3A 1G3TA 3GNFB 3QSUA 3LYIA 3JCMX 2PVOB 4PLIA 4KR3A 1JJCB 3UPUA 1O75A 3BDUA 4LDXA 1YJWT 3CEYA 1SESA 5I2SA 2RJCA 3T9NA 4PJOD 3CXCA 1YB3A 1U1TA 2XD0A 1ADYA 4ME7A 2ZT8A 1E1OA 5I2MA 3A31A 2Q7GA 4J7FA 4A4KA 5CCAA 3OYIA 1VQ4T 3OMCA 4E7JA 4H02A 3CCST 2OAUA 1QVGS 4LVLA 4YRJA 5LJ3g 5GAMf 1MGQA 4PHCA 5CKHA 3FRNA 2F5KA 1E22A 2QQRA 3HY0A 1NNHA 3M53A 2K2VA 1X56A 2DTOA 3V8LA 4M7DB 4RCBA 2EQKA 1H4TA 3CC4A 3BJUA 5GAMh 2RI2A 1VQ4A 1LYLA 4XU0A 3TEHA 4P74A 3MEVA 3JCMQ 3JCMe 3TCJA 5GAN5 2FB7A 1W66A 2YRVA 1VQPT 4TVYA 3GLXA 3KXTA 2ZR2A 2CJ9A 4RMOA 2QQSA 4OGEA 4A4EA 3CXCS 3NELA 2WSFE 4YRTA 4E51A 3NTHA 5C6SA 1ASYA 1N27A 3HRSA 4HA8A 5FU7C 4F7UB 3VKIA 1N8RU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJ3 f;  4M78 F;  3ICA A;  4M75 E;  3HFZ B;  2ZNI A;  3HRI A;  4YRG A;  3MF2 A;  4XEM A;  5GAO n;  5GAM g;  3A7R A;  5GAM j;  3QNE A;  4P73 A;  4JLI A;  2ODR C;  1BBU A;  4K87 A;  1X2H A;  3M4P A;  3JCM c;  1B8A A;  4HWP A;  4M75 A;  4PJO B;  12AS A;  3LSS A;  3WQZ A;  2DKG A;  2VC8 A;  1G51 A;  4YRE A;  4H2X B;  2DTI A;  4TVA B;  4RCC A;  11AS A;  4C92 G;  2AKW A;  3VQX A;  4XU3 A;  5LJ3 h;  3JCM W;  1ATI A;  3RER A;  4YPF A;  1B70 A;  4M78 E;  4C8Q F;  1NJ8 A;  2Q5I A;  1NJ2 A;  4N0A C;  4XEO A;  4YRS A;  4P72 C;  4P3N A;  1N9W A;  3PCO A;  4CS2 A;  3TUP A;  1B7Y B;  1E1T A;  3RKX A;  4H2V A;  3HFN A;  4M78 A;  3RF1 A;  1KMM A;  4M75 D;  3REX A;  4BWA A;  4H2S A;  4YP0 A;  4H2U A;  2ZCE A;  3JCM P;  2ZTG A;  4P73 C;  2HNI A;  4M77 G;  1EVK A;  4C8Q E;  3IAL A;  4C92 B;  4TWA A;  2ZIO A;  4JUV A;  3UH0 A;  4LNS A;  3R07 A;  4HWO A;  2Q5H A;  4YRR A;  2Q7E A;  4WI1 A;  1B34 B;  4ZIB A;  3PZC A;  5GAN f;  4A53 A;  2QHU A;  4M78 D;  3A5Z A;  3RUX A;  1X55 A;  2XGT A;  1HTT A;  3HTZ A;  2EJ9 A;  4CH6 A;  3A74 A;  4YRL A;  2RHS B;  4M7D F;  3SWN C;  5LJ5 e;  1H4S A;  1PYS B;  3VU3 C;  3E9H A;  1B76 A;  2I2L A;  4M78 C;  3RES A;  4NCX A;  2RM4 A;  2QHS A;  4XQ3 A;  4K86 A;  4M77 B;  1C0A A;  4TQD A;  3A5Y A;  3SB2 A;  3FB9 A;  3JCM f;  5GMK m;  3RL6 A;  4J6W A;  2J3M A;  3W3S A;  2DEQ A;  4EMK A;  2DQ0 A;  3TEG A;  3HFO A;  4M7D E;  2VXE A;  3JCM J;  1I4K 1;  2CIM A;  4XTZ A;  4EMH A;  3L4G B;  1EIY B;  4X9C A;  4C8Q C;  2VXF A;  4YYE A;  4G84 A;  3TEH B;  1X2G A;  4WF2 A;  4AH6 A;  4RDX A;  4CS4 A;  2C7I A;  1NJ1 A;  3JCM V;  4YCV A;  4CH4 A;  3EFR A;  3RIR A;  2QHV A;  1NYQ A;  5GAO m;  4M75 G;  1WU7 A;  3HXX A;  2FYK A;  5LJ5 g;  3HFV A;  4J6Y A;  5LJ5 j;  3NEN A;  4OP0 A;  5GAN g;  5GAN j;  2CJA A;  4EMK C;  2DQ3 A;  4J15 A;  1WQ7 A;  1Y96 A;  2ZT7 A;  3JB9 G;  3L1A A;  1QE0 A;  1M8V A;  3JCM b;  4K88 A;  3E9I A;  4TQF A;  5HGQ A;  1X54 A;  4YCU A;  1JBM A;  4M78 G;  3HY1 A;  4YRI A;  5KNN A;  2CGH A;  2YHT A;  4M7D C;  2EL9 A;  2IY5 B;  4CH3 A;  3A7U A;  1I8F A;  3RKW A;  4M75 B;  2Q7H A;  4HVC A;  3JB9 H;  2Y90 A;  3QO8 A;  3LC0 A;  1D3B A;  1QF6 A;  1NJ5 A;  5C52 B;  1LJO A;  3HXW A;  3JCM g;  1B70 B;  2ALY B;  4KQE A;  3SWN A;  4DPG A;  3RGL A;  3V7R A;  2ZZG A;  4C92 F;  1GGM A;  5GAN 7;  2EJF A;  4NL2 A;  5LJ3 d;  5GAN 2;  3M4Q A;  4TVW A;  1YFR A;  4TVA A;  2E5A A;  4WJ4 A;  1KQ1 A;  4M78 B;  1LOJ A;  2DXU A;  1SET A;  1JJC A;  1USY C;  2CJB A;  3P8Y A;  5GAO p;  1J5W A;  3I7F A;  1B7Y A;  2DJZ A;  3NET A;  3QO5 A;  2JN0 A;  2DU5 A;  3V8J A;  2I4L A;  3DSQ A;  5LJ5 f;  2RB6 A;  3INZ A;  5C53 B;  1LNX A;  5GAN 3;  1NJ6 A;  3UFG A;  4C92 E;  4CS3 A;  4ZTZ B;  4M7A F;  3UGT A;  4M77 F;  4Q6G A;  4XTY A;  3HXV A;  4C8Q A;  2EAY A;  1HK9 A;  1WLE A;  4UPA A;  3VQV A;  5GMK e;  4C92 A;  4EMG A;  1YFS A;  3OD1 A;  3QHS A;  4P71 C;  2YLC A;  4YRC A;  2ZIM A;  2ART A;  4EO4 A;  4JRK A;  3IKM B;  5LJ5 h;  2C8M A;  4NOY A;  4M7A E;  2RHQ A;  2G4C A;  1H64 1;  4M77 E;  2EWN A;  3VQY A;  5GAN h;  4C8Q D;  1SER A;  3EFS A;  2RA2 A;  2DVE A;  4PNO A;  1HXD A;  4X5O A;  4XTW A;  1YGB A;  1NYR A;  1H4V B;  2I4O A;  4C92 D;  1U1S A;  4M7A A;  1Z7N A;  4P75 A;  4EMK B;  1FYF A;  3JB9 I;  2ZZE A;  3PGG A;  2P5I A;  2E10 A;  2QTX A;  2AMC A;  4F7U F;  5GAM d;  4M7D A;  4XU1 A;  5GAM e;  4V2S A;  5E3I A;  4C92 C;  4H2W A;  2EJG A;  2K57 A;  1JRI A;  3BY7 A;  1VQZ A;  1HC7 A;  4KR2 A;  1Z7M A;  2E41 A;  5K1P A;  1SRY A;  3UGQ A;  3JCM h;  4M7A D;  4Y91 A;  5GMK j;  3CMQ A;  3HRK A;  4PJO F;  4TTV A;  4HWS A;  4F7U E;  4M7D D;  4M75 F;  3MF1 A;  4HT8 A;  4YRM A;  4RQE A;  4QVD A;  1BIB A;  1N9S A;  3NEM A;  4P75 C;  4M7A C;  4P3P A;  2E65 A;  4M77 C;  2E1H A;  5GAO q;  1USY A;  3ERR A;  3RAC A;  3QO3 A;  4NL3 A;  5F5W A;  4XU2 A;  3P8T A;  4Q15 A;  3GIB A;  4F7U A;  1G5I A;  3HSB A;  1EOV A;  3REU A;  4CH5 A;  1EVL A;  1H4Q A;  3JB9 F;  4HWR A;  2DZC A;  4BW9 A;  4UP8 A;  3FIF A;  4PJO E;  5GAO r;  3HFZ A;  2PMF A;  5I21 A;  5GMK l;  4XTU A;  4H2Y A;  3VQW A;  4YDQ A;  1TH7 A;  5ELO A;  2YLB A;  1I5L A;  2AKW B;  2ZGW A;  3V7C A;  1BIA A;  3HXY A;  4OLF A;  1D3B B;  1WPY A;  5CAI A;  2ZZF A;  4YRQ A;  3L2Z A;  4P74 C;  4PJO A;  1YFT A;  2IY5 A;  3PCO B;  3SWN B;  5LJ3 e;  4UP7 A;  4H2X A;  2J3L A;  4P71 A;  4C8Q G;  3M4G A;  4P3O A;  2ZR3 A;  3QSU A;  4HWT A;  4L87 A;  3JCM X;  3MEY A;  1KOG A;  2DTH A;  2ALY A;  2ARU A;  3QO7 A;  4KR3 A;  4EX5 A;  2RD1 A;  1KQ2 A;  1JJC B;  2ZT6 A;  4YRF A;  1ASZ A;  2XTI A;  3BDU A;  5GAO l;  5GMK i;  1SES A;  2P0L A;  1IL2 A;  3IKL A;  4PJO D;  5GAN 4;  4G85 A;  5C51 B;  3HXU A;  1YB3 A;  1U1T A;  4QVC A;  4YCW A;  4JRI A;  1ADY A;  2DXT A;  2ZT8 A;  5DY9 A;  1E1O A;  2I4N A;  1I81 A;  4C8Q B;  3A31 A;  4H2T A;  2Q7G A;  4M7A G;  3BW1 A;  2ZXF A;  4PJO C;  3JB9 D;  1B34 A;  4M75 C;  3V8K A;  1G5H A;  5GMK h;  3P8V A;  4H02 A;  4HT9 A;  4M7D G;  2ARS A;  4YRJ A;  4YRP A;  1E24 A;  4YRO A;  2RHS A;  1ADJ A;  5LJ3 g;  2RHQ B;  5LJ3 j;  1PYS A;  2ZNJ A;  5GAM f;  1M5Q 1;  4MML A;  2DZ9 A;  5LJ5 d;  2ZT5 A;  1MGQ A;  4DQ2 A;  4RMF A;  1EFW A;  4PHC A;  3QUI A;  4RQF A;  5GAN 6;  5ELN A;  5GAN d;  4M77 A;  3V7S A;  5GAN e;  1WQW A;  4M7A B;  1E22 A;  3HY0 A;  1KMN A;  4YRK A;  4J6X A;  1NNH A;  3LSQ A;  1X56 A;  2DTO A;  4XTX A;  1WYD A;  3V8L A;  1N9R A;  2I4M A;  4O2D A;  2AMC B;  3JB9 J;  4M7D B;  1WNL A;  2DDZ A;  4UP9 A;  3A32 A;  4RCB A;  1BBW A;  2E3C A;  1H4T A;  3BJU A;  1X01 A;  4F7U G;  5GAM h;  3L4G A;  1EIY A;  1LYL A;  4XU0 A;  2DU7 A;  4M77 D;  2ZIN A;  1L0W A;  4YRN A;  3TEH A;  4P74 A;  4MMK A;  4WJ3 M;  3RKY A;  3QTC A;  5K1X A;  3JCM Q;  1RIQ A;  3JCM d;  3KFU A;  4PG3 A;  3JCM e;  4X9D A;  5GAN 5;  2FB7 A;  1W66 A;  3A7A A;  4TVY A;  2ZR2 A;  3G1Z A;  2CJ9 A;  4J5Y A;  2E64 A;  4XTV A;  2PME A;  3AHU A;  4PJO G;  1Y96 B;  3FJP A;  3NEL A;  1YCY A;  4YRT A;  3HXZ A;  4N0A A;  4E51 A;  4P72 A;  2QHT A;  4ZTU B;  1ASY A;  1EQR A;  3BFM A;  4HA8 A;  4F7U B;  5GAN 8;  2ODR D;  3VBB A;  4A54 A;  3IG2 A; 
#chains in the Genus database with same CATH topology
 1VQO T;  2RHI A;  1WXB A;  4D8K A;  8AT1 B;  3L2Q A;  1TUD A;  3TU4 K;  5GAM g;  2FL7 A;  3OYD A;  4ZGJ B;  4P73 A;  2XI9 A;  4UC4 A;  2ODR C;  3VS7 A;  3CC2 A;  2EKO A;  2A36 A;  2IIM A;  1K0S A;  1WGS A;  1B8A A;  2VC8 A;  4HT4 A;  2DD5 A;  3MP8 A;  1W2B P;  3LWI A;  4XU3 A;  2EQI A;  1RI9 A;  2GNC A;  4M78 E;  2XK0 A;  1M1G A;  4N0A C;  4P72 C;  1N9W A;  2RI5 A;  3HP9 A;  2PUO B;  1WJR A;  3TUP A;  1OPL A;  2SEM A;  4E7H A;  3M0P A;  3HFN A;  2ZPE B;  4ZNX A;  1VQM T;  2K7A A;  4ZN3 A;  1VA7 A;  4BWA A;  1VQO A;  6AT1 B;  4YP0 A;  4C0D C;  1U5S A;  2YXY A;  1N8R U;  4FYW B;  3G6E A;  2DNU A;  2LQN A;  3CCV T;  1VIF A;  4M77 G;  4C8Q E;  4PL6 A;  4JUV A;  5D6W A;  3OYE A;  1KHC A;  3MCA B;  1X6G A;  1SSF A;  2GFU A;  4HWO A;  1Y7X A;  1C6V X;  1B34 B;  2P4T A;  3PZC A;  5GAN f;  4A53 A;  2GTJ A;  1M2O A;  4IUR A;  1M90 C;  1S72 T;  3A5Z A;  2DIQ A;  3CCR T;  2D1X A;  2EYZ A;  1FMK A;  3KFV A;  4OMO A;  1GCQ C;  1PYS B;  1N5Z A;  1AOJ A;  3E9H A;  3A8M B;  3OB9 A;  3CCE Q;  2L3S A;  3S3O A;  4N4I A;  1S1N A;  2BKD N;  3I9Q A;  1QMC A;  3MO8 A;  3D7S B;  2J3M A;  3FJ5 A;  3W3S A;  2DEQ A;  1M1K R;  1OUL A;  1K8A C;  2VXE A;  3OA6 A;  4LDV A;  4E7S A;  2DF6 A;  1UHC A;  3L4G B;  4X9C A;  4FCY A;  3AT1 B;  4YYE A;  3VRY A;  1D0Y A;  4LDW A;  3ZFJ A;  4HXJ A;  2O4X A;  1WHM A;  4E7Z A;  1WIE A;  3QWY A;  2MWO A;  2A3L A;  1JJ2 A;  4CS4 A;  2C7I A;  3JCM V;  4JRQ A;  1XTD A;  2AT1 B;  5J3B A;  1NYQ A;  5GAO m;  4KBM B;  3M55 A;  2KK4 A;  2V8J A;  5LJ5 g;  2JS0 A;  4J6Y A;  4A4F A;  4PJM A;  3CCJ T;  4OP0 A;  5IT9 E;  5GAN g;  2E3H A;  2DA9 A;  2VWF A;  1TOV A;  2CJA A;  3R6O A;  4EMK C;  5FLX E;  5KYN A;  4CC4 B;  1G5V A;  2D8J A;  4FL6 A;  5HGQ A;  4RTZ A;  2COW A;  4YCU A;  4M78 G;  3HY1 A;  5KNN A;  3WVD B;  3A1P A;  4A63 B;  4M75 B;  2RF0 A;  2GCX A;  3CCU Q;  4HVC A;  1KQS P;  3CPW A;  2MI6 A;  1YHQ Q;  1QF6 A;  3HXW A;  2EGE A;  3MKD A;  5FRO A;  2DPP B;  2ALY B;  2BZY A;  4KQE A;  2ED0 A;  4FSX A;  3A98 A;  2EIF A;  1Q86 R;  2D8H A;  1YFR A;  4FM4 B;  1VQ9 T;  2D0N A;  1BI1 A;  2RJE A;  4BD3 A;  3KUF A;  4LN2 A;  5I11 A;  2X4J A;  2J6O A;  3EG9 B;  2JN0 A;  4NS5 A;  4J9G A;  3G4S Q;  2CP5 A;  3V8J A;  3CD6 T;  2R57 A;  3DKM A;  1LNX A;  2FZK B;  4PJJ A;  2CUB A;  4M77 F;  1JJ2 S;  3HXV A;  1HK9 A;  2FO0 A;  1XNI A;  3O8V A;  2FZC B;  1Q7Y R;  1H92 A;  1WHH A;  2MOX A;  1WLP B;  3QHS A;  1SEM A;  1GFD A;  4JRK A;  5I22 A;  3IKM B;  1ZLM A;  2GF7 A;  5A0D A;  2C8M A;  4RUG A;  3M0R A;  4NOY A;  2LQW A;  4LXC A;  4PNO A;  2HSP A;  1YGB A;  1WI7 A;  1NYR A;  2K4Y A;  1H4V B;  1VQ7 Q;  3RR6 A;  9ATC B;  3CCQ T;  3MEW A;  4EMK B;  1FYF A;  2ROL A;  2ZZE A;  2AKK A;  2D9T A;  1E7O A;  4E7I A;  1QVF A;  2LTO A;  1QCO A;  4XU1 A;  1WXU A;  3L2W A;  4V2S A;  3CC7 Q;  4C92 C;  4OML A;  4L6V 5;  3CME T;  5K1P A;  3MPU B;  1SRY A;  3NHN A;  1V1C A;  1WHL A;  1VOM A;  2MK5 A;  1IXD A;  3HKS A;  1TU0 B;  4BI4 A;  1UJY A;  5GMK j;  1YJ9 Q;  2F2V A;  3HRK A;  4C0Z A;  2QAZ A;  4PJO F;  2EW3 A;  4TTV A;  1ZSG A;  4HWS A;  2CZ7 B;  4F7U E;  1NEB A;  4IKF A;  3MF1 A;  2KY9 A;  1R0B G;  1T0H A;  3NEM A;  4CC2 A;  1U3O A;  2QG9 B;  4M7A C;  1OV3 A;  5GAO q;  3ERR A;  2HCK A;  4QQG A;  4XU2 A;  3P8T A;  1E6G A;  3M9Q A;  4Q15 A;  2V1Q A;  1ARK A;  7AT1 B;  1WDX A;  4CH5 A;  2NWM A;  2VGM A;  2JMA A;  3SEM A;  3HFZ A;  2PMF A;  5FU6 C;  5FW9 A;  3VQW A;  1W4S A;  1G3Y A;  1TH7 A;  5ELO A;  2KRO A;  1I5L A;  2X4Y A;  3V7C A;  2RMO A;  3E19 A;  2QYZ A;  5CAI A;  2ZZF A;  4P74 C;  2DJQ A;  3SHW A;  4PFP A;  1JU5 C;  1YJW Q;  4P71 A;  4HWT A;  1PCX A;  4L87 A;  2YRD A;  3QKJ A;  4ZTF A;  2KAF A;  4O5V A;  1PD1 A;  5AYF A;  1BKB A;  2ALY A;  3QO7 A;  4EX5 A;  3OYF A;  2ZPB B;  2A37 A;  1M90 U;  1OQK A;  1ASZ A;  3CC4 Q;  4BDY A;  1QVF S;  5GMK i;  4BE2 A;  1YJN A;  1VQ4 Q;  3GP8 A;  3EG2 A;  5C51 B;  5KYX A;  4QVC A;  2PTK A;  4YCW A;  4RTV A;  2P0P A;  2DXT A;  5DY9 A;  4JJC A;  4C8Q B;  2VAS A;  4H2T A;  3EG9 A;  3HHT B;  2HAX A;  2V1R A;  1TSF A;  3JB9 D;  3V8K A;  4AG1 C;  2CP2 A;  5GMK h;  4M7D G;  4LUD A;  1K8A U;  4YRP A;  4L59 A;  3PIO A;  1O9S A;  2CS7 A;  2RHS A;  3PT9 A;  1N8R R;  1ADJ A;  2PU9 B;  1Q95 G;  1JEG A;  5LJ3 j;  2KMT A;  1M5Q 1;  2KYB A;  4HVU A;  3QZ9 B;  4J9I A;  2OAW A;  2NUT B;  1YIJ T;  1EFW A;  2IG0 A;  5GAN 6;  3ME9 A;  4M77 A;  3H0I A;  4M7A B;  5KYW B;  2DE0 X;  2CP7 A;  3J81 E;  3EG0 A;  4J6X A;  3HTR A;  3LSQ A;  2Z0W A;  5CVI A;  4FU6 A;  1WJQ A;  2AMC B;  2COZ A;  1SF9 A;  3QXE B;  1BBW A;  3JV3 A;  3EGD B;  1OI1 A;  4F7U G;  4CI0 C;  2O31 A;  2CH4 A;  2VVK A;  2JVV A;  2C0O A;  2ZIN A;  4M77 D;  4MMK A;  2QDL A;  1MV3 A;  4FIB A;  4WJ3 M;  1RIQ A;  3JCM d;  4PG3 A;  1D1A A;  1VQO Q;  4A4G A;  4HCB A;  4J5Y A;  4XTV A;  2PME A;  2LQ8 A;  1AWO A;  1M3A A;  3AHU A;  2M02 A;  2EFI A;  4ZTU B;  1UGS B;  1BK2 A;  5FRM A;  5GAN 8;  3BDL A;  2XTI A;  3RDV A;  1YP5 A;  2JZ2 A;  5LJ3 f;  4D8D A;  3QJY A;  4C5H A;  1YI2 A;  1ZA2 B;  2NUP A;  3OYA A;  4M75 E;  3P8H A;  1ZUY A;  2QGG A;  4LUE A;  4OB2 B;  2O9V A;  5GAM j;  3PNW C;  4JLI A;  2RJF A;  1R77 A;  2A8E A;  3CCM T;  1W2B A;  4K87 A;  1U06 A;  3JCM c;  2DBM A;  2O9S A;  3G71 T;  12AS A;  3WQZ A;  3LSS A;  3CC7 A;  2LVM A;  3G1J A;  3VQX A;  4BE0 A;  2EYQ A;  5LJ3 h;  3JCM W;  4JJN K;  1NJ8 A;  1T3S A;  1D1C A;  3UT1 A;  2JUF A;  1NJ2 A;  2F5T X;  4AFQ C;  1X2K A;  3CCV Q;  4HKE A;  4GLK A;  1YJ9 A;  3RKX A;  1MMA A;  5CR2 A;  4FYV B;  2JJ9 A;  1E1T A;  2EQM A;  2JNG A;  3P8B B;  2EPD A;  4M78 A;  3NTK A;  1KMM A;  2M51 A;  1PWT A;  2EQJ A;  4J9H A;  4H2U A;  5KE2 A;  4AFZ C;  1S72 Q;  2ZTG A;  4M4Z A;  2HQX A;  3CCR Q;  2KVQ G;  2XU8 A;  2HNI A;  4OGC A;  2X3W D;  1FMW A;  3IAL A;  1M9S A;  1K73 C;  3GOX A;  2ZIO A;  2DL3 A;  4LNS A;  2GQV A;  4YRR A;  2H3J A;  2J06 A;  4WI1 A;  4J9B A;  3G71 A;  2QHU A;  2L8D A;  4M78 D;  4DEY A;  1X55 A;  2DET A;  3J7A F;  5C0M A;  4OVA A;  4M7D F;  4VUB A;  1CKA A;  3QYG B;  5CKF A;  3P8D A;  1B76 A;  1YJW A;  1M2V A;  2NS6 A;  2FRW A;  4XQ3 A;  4K86 A;  4OB1 B;  2EYY A;  2MPX C;  3EAE A;  1LPL A;  3EH2 A;  4C5I A;  1NYG A;  4DBF A;  1MMN A;  4J6W A;  2LNH B;  2XHC A;  1M3C A;  4JRP A;  1W2B S;  4QQ6 A;  3TEG A;  2G6F X;  2VYT A;  2RHZ A;  1Y57 A;  3HFO A;  4MZM A;  3JCM J;  2BE7 D;  2B8A A;  5KYW A;  2CIM A;  3CBP A;  3H6Z A;  2BE9 B;  3DB4 A;  4C0G A;  1EIY B;  4XAX B;  1JQQ A;  3CCS A;  2BIV A;  2VXF A;  4EPC A;  2PNI A;  4G84 A;  3N5B B;  3OYK A;  3CCJ Q;  4BI8 B;  3EGD A;  4KGX B;  1MMD A;  3REB B;  3I55 T;  3OQ5 A;  2KT1 A;  3EH1 A;  1ZSZ A;  1JB0 E;  3EGX A;  4M75 G;  2Y4Y A;  3HXX A;  2FYK A;  3X25 B;  3VS3 A;  3HFV A;  5LJ5 j;  2RHY A;  3RMS A;  4J9F A;  2YUO A;  3GF5 A;  3M57 A;  4FW2 A;  5GAN j;  3I5R A;  1WQ7 A;  3JB9 G;  2D0Q B;  3L1A A;  2OI3 A;  2RHX A;  4QT7 A;  3E9I A;  4TQF A;  1MV0 B;  1QVG P;  3M0U A;  3CCL T;  1X54 A;  3E9G A;  1EX4 A;  3EFO A;  1B7T A;  1TUC A;  2QAS A;  2CGH A;  2F1L A;  2IY5 B;  1Z9Q A;  1PKS A;  1IO6 A;  1VQN T;  1M4Z A;  5D6Y A;  5KYU B;  1VQ9 Q;  2P0Q A;  3JB9 H;  1VQP A;  4FYY B;  3I55 A;  3TVT A;  2EGA A;  1B70 B;  1PM3 A;  3SWN A;  4LD9 K;  1B07 A;  5GAN 2;  2XDB A;  1UGQ B;  3CD6 Q;  4TVW A;  1NG2 A;  1YIT T;  5HY6 A;  1RLQ C;  3SD4 A;  4HVW A;  1QWF A;  2E70 A;  1JJC A;  1OU9 A;  4AG2 C;  3P8Y A;  2V8K A;  3R6N A;  4KH1 B;  4JZ3 A;  2DJZ A;  4EDU A;  2LRQ A;  5LJ5 f;  1MHN A;  5FWB A;  5C53 B;  1NJ6 A;  3UFG A;  4C92 E;  3OY9 A;  4ZTZ B;  4IUV A;  3I5S A;  1YWP A;  1SPK A;  2I0N A;  1GBQ A;  2DM1 A;  2X35 A;  4BUG A;  4C0F A;  2EAY A;  3URG A;  3HL8 A;  3QDR B;  1WLE A;  3CXC P;  4PJN A;  4EMG A;  1X6O A;  1K9M C;  4II1 A;  1FWZ A;  5KYY B;  4P71 C;  2YLC A;  4YRC A;  2ZIM A;  1NEG A;  3CMA T;  1SRL A;  2K6D A;  5FRN A;  2ED1 A;  2L3Q A;  1Z9Z A;  5LJ5 h;  1VQM A;  2HZY A;  4M7A E;  3VQY A;  5GAN h;  1KIK A;  1IHW A;  1UB4 A;  4BY6 C;  1HXD A;  5FU7 B;  4D6W A;  2QEX T;  3CCV A;  3CME Q;  1Q81 C;  2K3X A;  1U1S A;  1Z7N A;  1OYX A;  4P75 A;  1VQ8 T;  1K4U S;  3H8Z A;  2FZG B;  3U23 A;  1TS9 A;  3QYH B;  4FSS A;  4BE1 A;  3PGG A;  2P5I A;  2C06 A;  4RTU A;  1G3S A;  1IGQ A;  2CH4 W;  1M8M A;  4M7D A;  5GAM e;  1GL5 A;  1KG1 A;  1S72 A;  4H2W A;  3LGF A;  1KK7 A;  4MZT A;  3CCR A;  3BY7 A;  1VQZ A;  2LC4 A;  1D09 B;  2E41 A;  3NGP A;  4ZGD B;  2ZCF B;  3UGQ A;  3ER0 A;  2HEQ A;  1NPP A;  1M90 R;  4Y91 A;  4XK8 E;  2LT1 A;  1YJN Q;  4EIK A;  4FYX B;  3PTA A;  4M7D D;  4M75 F;  1NM7 A;  4KUI A;  4HT8 A;  4QVD A;  1N9S A;  4P3P A;  2E65 A;  4M77 C;  2QEX A;  1USY A;  1HYO A;  2QA4 T;  3RAC A;  2JXB A;  4C0D B;  5F5W A;  2RJD A;  2F2X A;  4F7U A;  1G5I A;  2CZ6 B;  4AFU C;  2MIO A;  2P84 A;  3REU A;  1H4Q A;  3JB9 F;  2DO3 A;  4BW9 A;  2KGT A;  3FIF A;  3ZBD A;  1BI0 A;  2D6F A;  1DJ7 B;  1K8A R;  5GAO r;  2J05 A;  4YDQ A;  2DIG A;  4FT2 A;  3TSW A;  3HRU A;  2WSE E;  1D3B B;  4F04 B;  4YRQ A;  3L2Z A;  2IY5 A;  4MDX A;  1Q7Y C;  5IH2 A;  1KC8 C;  2R5M A;  4C8Q G;  3OS5 A;  1LVK A;  3CCJ A;  1XOV A;  1NLP C;  4B9W A;  3OW2 A;  4PFO A;  2KRN A;  3GPL A;  1M3B A;  3F70 A;  3LH5 A;  4C5G A;  2XDD A;  3MEY A;  1KOG A;  2DTH A;  1AD5 A;  2KRS A;  2ARU A;  5HKC A;  2RD1 A;  1KQ2 A;  3M59 A;  2QA4 A;  5GAO l;  2RHU A;  3HXU A;  2JS2 A;  2V8I A;  1UUE A;  2RK1 A;  2YT6 A;  1UJ0 A;  2I4N A;  1I81 A;  2PQW A;  1F1B B;  2XID A;  3JSC A;  5EC7 A;  1ACM B;  4M7A G;  4E47 A;  3BW1 A;  1BBZ A;  3VUB A;  4PJO C;  1WJS A;  1AWJ A;  2QI2 A;  1YIJ Q;  1B34 A;  4DA4 A;  1Q82 C;  3NMZ C;  5J26 A;  1BCO A;  5CQX A;  1SHF A;  3H0H A;  1NJI R;  2M9U A;  1VQ9 A;  4YRO A;  1NE8 A;  2RHQ B;  2ZNJ A;  1PYS A;  1FXX A;  4MML A;  3REA B;  2DZ9 A;  1YI2 Q;  5KYY A;  2ZT5 A;  4OMM A;  3ULR B;  4ATO A;  3QUI A;  4RQF A;  5ELN A;  2P4R A;  1HSQ A;  3V7S A;  5GAN e;  3CD6 A;  1WQW A;  2E6N A;  4J8O A;  3GBQ A;  1KHI A;  4R0K A;  4YRK A;  1GFC A;  2LJ0 A;  3CPW S;  2EBP A;  4XTX A;  1ZQ1 A;  2JW4 A;  2ROT A;  2I4M A;  4O2D A;  4UP9 A;  3SFM A;  2K3Y A;  2HL5 C;  3PVL A;  3L4G A;  3QII A;  1QP2 A;  3OS2 A;  2VUB A;  3FC3 A;  2DXC A;  3OW2 S;  3QTC A;  4DBR A;  3KFU A;  3QBY A;  1V29 B;  5CK9 A;  1QW1 A;  1WA7 A;  4X9D A;  3A7A A;  5D7U A;  1VYU A;  2K79 A;  5CKD A;  2DL5 A;  2A08 A;  3FJP A;  2RK2 A;  2FPE A;  1YCY A;  3CCQ A;  3OSV A;  4N0A A;  4P72 A;  1JJ2 P;  2QHT A;  2NUZ A;  1EQR A;  2DER A;  3TEE A;  3BFM A;  3NTI A;  2O2O A;  3DLM A;  2ODR D;  3EG3 A;  4A54 A;  5DLO A;  4YRN A;  3G71 Q;  1OEB A;  1AT1 B;  4M78 F;  3ICA A;  1G3W A;  5AT1 B;  1K0X A;  3MEU A;  1OPK A;  1IGU A;  4BAC A;  3CME A;  3MF2 A;  1R8O B;  5GAO n;  3A7R A;  1OX9 A;  2A7Y A;  4RG8 A;  2B86 A;  3VUZ A;  1VUB A;  3M4P A;  1AEY A;  2CP3 A;  4HWP A;  4M75 A;  4PJO B;  2J6F A;  2DKG A;  3QZ5 B;  5J39 A;  4YRE A;  4H2X B;  2DTI A;  4LVM A;  2RQU A;  2K5L A;  1ATI A;  1D0X A;  4YPF A;  4C8Q F;  2Q5I A;  4XEO A;  1PRM C;  2JTM A;  1G8X A;  1IRE B;  1N8R C;  1X75 C;  5LL6 S;  1GCQ A;  1ZBX A;  3Q1J A;  2DD4 A;  4H2V A;  4R56 A;  1ZBJ A;  1K9M U;  1RAG B;  4M75 D;  3CCS Q;  2MMP A;  3REX A;  4KGZ B;  1YHQ T;  1X27 A;  1UE9 A;  3VYH B;  1RI0 A;  4A4H A;  2ZCE A;  3JCM P;  5A0G A;  2E5Q A;  1YFN A;  1V76 A;  1AWW A;  4P73 C;  2DIL A;  1WFW A;  1EVK A;  2ABL A;  1RAC B;  4N4H A;  4C92 B;  4TWA A;  3OYJ A;  2Q5H A;  2MCN A;  2OTJ T;  1EZZ B;  4ZIB A;  2BZX A;  2CKK A;  1Q81 U;  3JRZ A;  2W0Z A;  3RUX A;  3HTZ A;  2EJ9 A;  4OB0 B;  1EIF A;  1ZA1 B;  3A74 A;  3SWN C;  3CBO A;  2HKN A;  2HSE B;  3G4S T;  1H4S A;  1PHT A;  3VU3 C;  3QPH A;  1SKU B;  2LZ6 B;  2DL4 A;  2I2L A;  3OYH A;  4NCX A;  1NLO C;  2RM4 A;  1KD1 C;  4LE9 A;  2QHS A;  2E6Z A;  4TQD A;  2KQW A;  1A0N B;  2RQW A;  3A5Y A;  3E2U A;  2DRK A;  5HK0 A;  4R55 A;  3OYC A;  3SB2 A;  3FB9 A;  3JCM f;  5GMK m;  3L2U A;  3RL6 A;  2H8H A;  1VQP Q;  4EMK A;  3VS4 A;  1JXO A;  3I55 Q;  4E7L A;  4DBH A;  5FU6 B;  4MDW A;  1VQ6 T;  4QVZ A;  2L5Q A;  5CKE A;  4XTZ A;  3X26 B;  1B3Q A;  3C4S A;  1I0C A;  4EMH A;  2XIC A;  4LNP A;  1OX8 A;  3DLL A;  3TEH B;  2LDM A;  2NYS A;  4KRT A;  1X2G A;  2K5F A;  2AZV A;  4WF2 A;  4AH6 A;  1UDL A;  4RDX A;  4BI3 A;  3FEO A;  4ELZ C;  2CRE A;  3OYM A;  1QVF P;  2L3P A;  3OS1 A;  1VQL T;  4YCV A;  2KEA A;  4CH4 A;  1X69 A;  1YIJ A;  4LD6 A;  1QQJ A;  3RIR A;  2QHV A;  2JM8 A;  2QDY B;  1WU7 A;  1BCM A;  3I56 T;  2DLP A;  1VQ5 T;  2LQK A;  4RTY A;  1TUG B;  1TWB A;  3CPF A;  4IIM A;  3PVQ A;  3NEN A;  4X1V A;  1QVG A;  2CT4 A;  3LWH A;  1KC8 U;  1M1F A;  1RL2 A;  2BUD A;  1VQN Q;  2DQ3 A;  4J15 A;  3ZL7 C;  2HMA A;  5CIU A;  1QE0 A;  5EG2 A;  1PNJ A;  4IUT A;  2K2M A;  5HK3 A;  3BE3 A;  3MJX A;  2FG0 A;  2CSQ A;  4RTX A;  4M7D C;  2EL9 A;  4CH3 A;  1WHK A;  1G83 A;  4LDY A;  2YWW A;  3JAM E;  1VQM Q;  2HQE A;  2AHJ B;  2Y90 A;  4JJD A;  2ZPI B;  3VYG A;  5ECA A;  4WTO B;  3LC0 A;  2ZZD A;  1NJ5 A;  5CO7 A;  1VQL A;  4RTW A;  3JCM g;  2KI7 A;  4J9E A;  4DPG A;  3RGL A;  3V7R A;  1RUW A;  1GGM A;  3MQZ A;  4AFS C;  2EJF A;  5LJ3 d;  3I56 A;  1VQ5 A;  2E5K A;  3CQT A;  1ZX6 A;  4WJ4 A;  2RO0 A;  2NLU A;  1WHG A;  1KQ1 A;  3M5A A;  1LOJ A;  1SET A;  3O5Z A;  1Q82 U;  1ABO A;  1USY C;  4B6M A;  2CJB A;  5GAO p;  1J5W A;  2JTF A;  5L8R E;  2M0O A;  2DU5 A;  3DSQ A;  1IRX A;  4HCZ A;  1YCS B;  3X20 B;  4F14 A;  3CCM A;  3RMQ A;  4CS3 A;  3C94 A;  3M54 A;  3CMA Q;  1UTI A;  2QXF A;  4Q6G A;  3UGT A;  4XTY A;  4C8Q A;  2CT3 A;  1KSW A;  4JDS A;  1T3L A;  2K5I A;  2KR3 A;  3VQV A;  3A5Z B;  5GMK e;  4C92 A;  1GCP A;  3CC4 T;  2EQU A;  2L0A A;  1PSF A;  2QEX Q;  2KT8 A;  4EO4 A;  1VQ8 Q;  1X43 A;  1KJW A;  1CSK A;  3LW5 E;  4LDU A;  1H64 1;  4M77 E;  2EWN A;  5A2Q E;  4C8Q D;  2DVE A;  2NUT A;  4XTW A;  2I4O A;  1PSE A;  4C92 D;  1J3T A;  4PLL A;  2YUP A;  2RI3 A;  4M7A A;  2VGN A;  2A0F B;  2E10 A;  4FW1 A;  1ZUK A;  1BB9 A;  3S3M A;  2AMC A;  4F7U F;  5GAM d;  2FRY A;  5E3I A;  1T0J A;  2EJG A;  3OS0 A;  4IIO A;  1JRI A;  2O4X B;  1HC7 A;  4KR2 A;  1Z7M A;  3I35 A;  2KXD A;  4JLG A;  2HQH A;  2CP0 A;  2QA4 Q;  3CC2 T;  4M7A D;  2M0Y A;  1UG1 A;  2KBT A;  4CC7 A;  3CMQ A;  5CQY A;  2RQV A;  3VS1 A;  4L5G A;  2HD0 A;  1RAD B;  1SSH A;  1K76 A;  2P0K A;  3ZEH A;  4RQE A;  1BIB A;  2KDS A;  1PC0 A;  1KFZ A;  2E1H A;  3QO3 A;  3J80 E;  4NL3 A;  5DLQ E;  3X28 B;  3HSB A;  1EOV A;  1UEB A;  2X9H A;  4BDZ A;  3MEA A;  1KQS A;  3A8O B;  2RQR A;  1EVL A;  1FYN A;  2DZC A;  4UP8 A;  3TRE A;  2X4X A;  1VYV A;  2XG8 D;  4PJO E;  2HL3 A;  5I21 A;  1QP3 A;  3A8G B;  3G6E T;  4H2Y A;  4Y28 E;  1I1J A;  2YLB A;  2AKW B;  1K1Z A;  3MET A;  1P92 A;  3HXY A;  1WPY A;  2FHD A;  1U8R A;  2G3R A;  3PCO B;  4Z02 A;  2PUK B;  4UP7 A;  5LJ3 e;  2J3L A;  4ESR A;  4P3O A;  2LX9 A;  2ESW A;  1IHV A;  1WX6 A;  5IXB A;  1UGR B;  2XDP A;  4N4G A;  1RAF B;  3PMI A;  3RBB B;  1VQK T;  2ZT6 A;  2L3R A;  4YRF A;  3E1S A;  3CCL A;  1MMG A;  2P0L A;  1IL2 A;  3IKL A;  5IHK A;  5GAN 4;  1M1K C;  4G85 A;  1K9A A;  2GQI A;  1MUZ A;  1D1B A;  1VQN A;  4JRI A;  1AHJ B;  3C12 A;  2VB6 A;  1KD1 U;  3EGU A;  2VV5 A;  2DBK A;  1QCF A;  4OMN A;  2LNV A;  2ZXF A;  2W10 A;  2A28 A;  2YUQ A;  4HVV A;  3VJP A;  4ZGE B;  3C95 A;  4M75 C;  3CCQ Q;  1G5H A;  3P8V A;  3LGL A;  4HT9 A;  2JMC A;  4OB3 B;  1YIT A;  2ARS A;  2M1H A;  2KE9 A;  2QGF B;  5KCO A;  1E24 A;  2RH2 A;  1M27 C;  2X4W A;  5LJ5 d;  4JS5 A;  2KYM A;  1VQK A;  1JO8 A;  4DQ2 A;  1NPR A;  4RMF A;  1KQS S;  3OYB A;  5GAN d;  2DRM A;  3KBG A;  1KMN A;  1GRI A;  1UGP B;  3OYG A;  4OMQ A;  2DVJ A;  3VS5 A;  4QQD A;  5KE3 A;  2AZS A;  1WYD A;  2ZPF B;  1N9R A;  2HDA A;  2DFU A;  5IHI A;  3JB9 J;  1WNL A;  2DDZ A;  3A32 A;  3UA6 A;  2QTV A;  2E3C A;  1X01 A;  1QWE A;  1EIY A;  2OTL T;  2DU7 A;  3CMA A;  2F69 A;  2FPF A;  1L0W A;  1R0C B;  3GNG A;  3RKY A;  5K1X A;  3THK A;  1NBE B;  4J83 A;  1K9M R;  2LX7 A;  1Q86 C;  3G1Z A;  2E64 A;  4J7I A;  1ZHI A;  4KUL A;  4PJO G;  1Y96 B;  4YTL A;  2GBQ A;  3HXZ A;  1JXM A;  1VQ8 A;  1QLY A;  8ATC B;  1ZUU A;  3VBB A;  3IG2 A;  2CZ1 B;  3M56 A;  1Q81 R;  5IN1 A;  1IB8 A;  1W6X A;  4F17 A;  3M58 A;  2RPN A;  3HFZ B;  2EVR A;  2ZNI A;  3HRI A;  4YRG A;  2E12 A;  4XEM A;  2IPO B;  3QNE A;  1UGV A;  2X3X D;  4FT4 A;  2OTL A;  1BBU A;  1X2H A;  2KNB B;  2LJ3 A;  2XKO C;  1E6H A;  2ZAE A;  2SRC A;  5KYU A;  1GBR A;  1G51 A;  1K73 U;  3CBM A;  4TVA B;  4RCC A;  11AS A;  4ZN1 A;  3RNJ A;  4C92 G;  2AKW A;  4MZP A;  3SDZ A;  3RER A;  1B70 A;  1OOT A;  1NJI C;  4YRS A;  4P3N A;  3PCO A;  2CSI A;  2ENM A;  3X24 B;  4E7K A;  2FVU A;  4CS2 A;  4BY6 B;  1B7Y B;  2MF2 A;  3A8L B;  2M16 A;  3RF1 A;  1XJW B;  2OTJ Q;  2JOY A;  5KYX B;  4H2S A;  2LCL A;  3E9F A;  1OU8 A;  3OYY A;  2YDL A;  1TG0 A;  3L2R A;  2PVG B;  2LT4 A;  1UHF A;  2L2P A;  2QQA A;  4CRI A;  3UH0 A;  3R07 A;  3OMG A;  2Q7E A;  5A0L A;  2HKQ B;  1QVP A;  2F2W A;  3WXM B;  4B9X A;  3IQL A;  3L42 A;  1GXI E;  2V26 A;  4LVK A;  2XGT A;  1HTT A;  4CH6 A;  2WAC A;  1OZ2 A;  5CKB A;  4YRL A;  2RHS B;  1RLP C;  4K11 A;  1KC8 R;  5LJ5 e;  1NYF A;  4PFZ A;  2KRM A;  1D0Z A;  4M78 C;  3RES A;  1H8K A;  1IZ6 A;  1VQ6 Q;  4M77 B;  1C0A A;  1VYT A;  1SRM A;  2ZPG B;  3LX7 A;  3S3N A;  1AVZ C;  1HJD A;  2QQB A;  1LCK A;  3EHR A;  1PD0 A;  2DQ0 A;  3CCE T;  3M0Q A;  4M7D E;  5IXF A;  4KT0 E;  1VQL Q;  1I4K 1;  4LVJ A;  2LP5 A;  1BI3 A;  4ELY C;  2DYB A;  1W70 A;  2KSS A;  4C8Q C;  1RAE B;  2R58 A;  2CZ0 B;  3I56 Q;  1VQ5 Q;  3H41 A;  4DEX A;  2LCC A;  2H3E B;  1AZE A;  2YSQ A;  4P5N A;  3VS2 A;  3OYL A;  1NJ1 A;  5D6X A;  1Q82 R;  4ZTJ A;  4J9C A;  2CYZ B;  4E6R A;  3EFR A;  1UFF A;  4X34 A;  2COY A;  2DMO A;  2OX7 A;  3QWX X;  4JPB W;  3CCM Q;  2O01 E;  4CC3 A;  2EGC A;  5GJW B;  4JS4 A;  4OF1 A;  1SHG A;  2MYS A;  3EHQ A;  2ZPH B;  1WZO A;  2O88 A;  1FX7 A;  1Y96 A;  3QDF A;  2ZT7 A;  4ORZ A;  1X6B A;  2NUP B;  1M8V A;  1RAA B;  3JCM b;  3CCE A;  4K88 A;  1YBY A;  1JBM A;  2K3B A;  3UA7 A;  1YJN T;  2GTO A;  3H0F A;  2JM9 A;  3LLR A;  4YRI A;  3NFC A;  2YHT A;  1RAI B;  2CDT A;  3FDR A;  2GGR A;  2LCS A;  3A7U A;  1I8F A;  3RKW A;  2Q7H A;  2DAQ A;  2PVD B;  2X51 A;  1M1K U;  3VS6 A;  4DOV A;  3QO8 A;  1ZSZ C;  1D3B A;  5C52 B;  1LJO A;  1PRL C;  1Y71 A;  5IHN A;  2C0I A;  4HCC A;  2ZZG A;  4C92 F;  3OSS C;  3CPW P;  5GAN 7;  4NL2 A;  3M4Q A;  2R5A A;  4TVA A;  2E5A A;  4C5E A;  4RKU E;  3CCU T;  3MHX A;  4M78 B;  2DXU A;  2YUN A;  2FEI A;  5KCH A;  1N6A A;  3I7F A;  1B7Y A;  3NET A;  3OW2 P;  3QO5 A;  3DB3 A;  3ASK A;  2I4L A;  4O6J A;  2RB6 A;  3INZ A;  4IUU A;  4WCI A;  3QG1 A;  1HD3 A;  1VIE A;  5M9O A;  5GAN 3;  3C0C A;  4M7A F;  5FWC A;  1W1F A;  2RN8 A;  3L2V A;  2GFA A;  5HCK A;  3QJ6 A;  4AT1 B;  4E2F B;  4UPA A;  1BU1 A;  1YNZ A;  1FMV A;  1YFS A;  1WXT A;  1SG5 A;  2J6K A;  2MAM A;  4KUD K;  3PE0 A;  3PIP A;  3OD1 A;  2L89 A;  3UDC A;  2ART A;  1M2V B;  3A8H B;  2RHQ A;  2BTT A;  5IAY A;  3CCU A;  2G4C A;  2Y4X A;  1YHQ A;  4BB7 A;  1SER A;  4IUP A;  3TSZ A;  2DK3 A;  3EFS A;  1M30 A;  4RTT A;  2RA2 A;  1PKT A;  2EYW A;  4X5O A;  2IVW A;  2DX1 A;  3VS0 A;  2FPD A;  3M0T A;  4GBQ A;  3HRT A;  1C0M A;  3MP1 A;  1Q86 U;  2EYX A;  4PKC C;  4RG2 A;  3OBW A;  3JB9 I;  2J7I A;  3G7Z A;  4ANJ A;  2LMJ A;  2OJ2 A;  1H3H A;  3CC2 Q;  2OTJ A;  2QTX A;  3UAT A;  1BYM A;  5KH6 A;  4QW2 A;  2QK0 A;  3WVE B;  2BZ8 A;  1YI2 T;  2K57 A;  2VKN A;  2DEU A;  2YRC A;  1VQ7 T;  1NZ9 A;  3OBY A;  2QQ9 A;  3S6W A;  3G4S A;  3JCM h;  3HPW A;  2AIR B;  3VV0 A;  1ZSZ B;  3EGX B;  4KH0 B;  2WSC E;  3CCL Q;  2C0T A;  4DOW A;  2DL8 A;  2K9G A;  3PMT A;  2MWP A;  3CC7 T;  3UWN A;  2E3I A;  1BI2 A;  3PFS A;  1I5O B;  1Q7Y U;  1OZ3 A;  3M0S A;  4YRM A;  4LVI A;  4P75 C;  1KD1 R;  4GY5 A;  3G6E Q;  4OMF B;  2HBP A;  3OYN A;  1RAB B;  4GLM A;  1YJ9 T;  1VQ6 A;  3GIB A;  1NJI U;  1H3Z A;  1Y07 A;  4PK4 A;  4HWR A;  3EFO B;  1I07 A;  1YIT Q;  1TTH B;  3NPF A;  1UEC A;  1AWX A;  4XTU A;  5GMK l;  1WHJ A;  2RNA A;  1VQ7 A;  2ZGW A;  1BIA A;  4OLF A;  2LJ1 A;  3M4Y A;  3MP6 A;  1VQK Q;  4Y92 A;  2DXB A;  1XQH A;  4IUQ A;  3FLG A;  4PJO A;  3LH0 A;  1YFT A;  4TVR A;  4Q5W A;  3SWN B;  5DM7 R;  4H2X A;  4DBQ A;  2JT4 A;  3H9N A;  3M4G A;  2ZR3 A;  1G3T A;  3GNF B;  3QSU A;  3LYI A;  1QKW A;  1MNE A;  3JCM X;  2PVO B;  4PLI A;  1PG5 B;  4OMP A;  4JJB A;  4KR3 A;  3UF4 A;  2AK5 A;  1JJC B;  3UPU A;  1O75 A;  1YWO A;  4Z89 A;  3BDU A;  4LDX A;  1YJW T;  3CEY A;  1SES A;  5I2S A;  2RJC A;  3T9N A;  4PJO D;  1EFN A;  4HCK A;  3CXC A;  1YB3 A;  1U1T A;  2XD0 A;  5L23 A;  2JTE A;  1ADY A;  4ME7 A;  2ZT8 A;  1E1O A;  5I2M A;  2AKL A;  3EG1 A;  3A31 A;  2Q7G A;  2EKH A;  1QCN A;  4J7F A;  4A4K A;  5CCA A;  2E4H A;  3OYI A;  1VQ4 T;  2DL7 A;  2KXC A;  3OMC A;  4E7J A;  4H02 A;  3CCS T;  2OAU A;  4Z88 A;  1QVG S;  4LVL A;  2HBW A;  4YRJ A;  5LJ3 g;  5GAM f;  2DYI A;  1MGQ A;  3TQ7 P;  2RQT A;  4PHC A;  5CKH A;  3FRN A;  2F5K A;  2OTL Q;  2QQR A;  1E22 A;  3HY0 A;  1CKB A;  1NNH A;  3M53 A;  1TXQ A;  4AMC A;  2K2V A;  1YN8 A;  1X56 A;  4KGV B;  1QKX A;  1X2Q A;  2DTO A;  1AZG B;  3V8L A;  4J9D A;  1ABQ A;  1WYX A;  4QKU A;  1K73 R;  4M7D B;  2ATC B;  4JZ4 A;  4RCB A;  2EQK A;  1H4T A;  3CC4 A;  3BJU A;  5GAM h;  2CUD A;  2RI2 A;  1Y0M A;  1G2B A;  4Z8A A;  1VQ4 A;  1LYL A;  4XU0 A;  3VRZ A;  1RAH B;  4P74 A;  3MEV A;  3TEH A;  3JCM Q;  3JCM e;  3TCJ A;  1MND A;  4F16 A;  2XMF A;  2FB7 A;  5GAN 5;  2YRV A;  1VQP T;  1W66 A;  4TVY A;  3GLX A;  3KXT A;  2ZR2 A;  2CJ9 A;  5GJV B;  4RMO A;  1C1A A;  2QQS A;  4OGE A;  4A4E A;  2ECZ A;  3CXC S;  2CP6 A;  3NEL A;  2PZ1 A;  2WSF E;  4YRT A;  3NTH A;  4E51 A;  4PJL A;  5C6S A;  1ASY A;  1N27 A;  4HA8 A;  5FU7 C;  4F7U B;  3VKI A;  3HRS A; 
#chains in the Genus database with same CATH homology
 1VQO T;  2RHI A;  3L2Q A;  3TU4 K;  5GAM g;  2FL7 A;  3OYD A;  4ZGJ B;  4P73 A;  2XI9 A;  4UC4 A;  2ODR C;  3CC2 A;  2EKO A;  1WGS A;  1B8A A;  2VC8 A;  4HT4 A;  2DD5 A;  3MP8 A;  3LWI A;  4XU3 A;  4M78 E;  2XK0 A;  1M1G A;  4N0A C;  4P72 C;  1N9W A;  2RI5 A;  3HP9 A;  2PUO B;  1WJR A;  3TUP A;  4E7H A;  3HFN A;  2ZPE B;  1VQM T;  4ZN3 A;  4BWA A;  1VQO A;  4YP0 A;  4C0D C;  3G6E A;  3CCV T;  1VIF A;  4M77 G;  4C8Q E;  4PL6 A;  4JUV A;  5D6W A;  3OYE A;  1KHC A;  3MCA B;  2GFU A;  1SSF A;  4HWO A;  1Y7X A;  1B34 B;  2P4T A;  3PZC A;  5GAN f;  4A53 A;  4IUR A;  1M90 C;  1S72 T;  3A5Z A;  2DIQ A;  3CCR T;  1PYS B;  3E9H A;  3A8M B;  3OB9 A;  3S3O A;  4N4I A;  2BKD N;  3MO8 A;  2J3M A;  3W3S A;  2DEQ A;  1K8A C;  2VXE A;  3OA6 A;  4LDV A;  3L4G B;  4X9C A;  4YYE A;  4LDW A;  3ZFJ A;  2O4X A;  2MWO A;  2A3L A;  1JJ2 A;  4CS4 A;  2C7I A;  3JCM V;  4JRQ A;  1XTD A;  5J3B A;  1NYQ A;  5GAO m;  4KBM B;  3M55 A;  2KK4 A;  2V8J A;  5LJ5 g;  4J6Y A;  4A4F A;  3CCJ T;  4OP0 A;  5IT9 E;  5GAN g;  2CJA A;  3R6O A;  4EMK C;  5FLX E;  1G5V A;  4FL6 A;  5HGQ A;  4YCU A;  4M78 G;  3HY1 A;  5KNN A;  3WVD B;  4M75 B;  2GCX A;  4HVC A;  3CPW A;  2MI6 A;  1QF6 A;  3HXW A;  5FRO A;  2DPP B;  2ALY B;  4KQE A;  4FSX A;  2EIF A;  1YFR A;  4FM4 B;  1VQ9 T;  1BI1 A;  2RJE A;  4BD3 A;  3KUF A;  2X4J A;  2JN0 A;  4NS5 A;  3V8J A;  3CD6 T;  2R57 A;  3DKM A;  1LNX A;  4M77 F;  1JJ2 S;  3HXV A;  1HK9 A;  1XNI A;  3O8V A;  3QHS A;  4JRK A;  3IKM B;  2GF7 A;  5A0D A;  2C8M A;  4NOY A;  4PNO A;  1YGB A;  1NYR A;  2K4Y A;  1H4V B;  3CCQ T;  3MEW A;  4EMK B;  1FYF A;  2ZZE A;  2D9T A;  4E7I A;  1QVF A;  2LTO A;  4XU1 A;  3L2W A;  4V2S A;  4C92 C;  4L6V 5;  3CME T;  5K1P A;  1SRY A;  3HKS A;  4BI4 A;  5GMK j;  3HRK A;  4C0Z A;  4PJO F;  4TTV A;  4HWS A;  2CZ7 B;  4F7U E;  4IKF A;  3MF1 A;  2KY9 A;  3NEM A;  4M7A C;  5GAO q;  3ERR A;  4QQG A;  4XU2 A;  3P8T A;  3M9Q A;  4Q15 A;  4CH5 A;  2VGM A;  3HFZ A;  2PMF A;  5FU6 C;  3VQW A;  1W4S A;  1G3Y A;  1TH7 A;  5ELO A;  1I5L A;  2X4Y A;  3V7C A;  3E19 A;  5CAI A;  2ZZF A;  4P74 C;  4P71 A;  4HWT A;  4L87 A;  3QKJ A;  4ZTF A;  2KAF A;  4O5V A;  5AYF A;  1BKB A;  2ALY A;  3QO7 A;  4EX5 A;  3OYF A;  2ZPB B;  1M90 U;  1ASZ A;  4BDY A;  1QVF S;  5GMK i;  4BE2 A;  1YJN A;  3GP8 A;  5C51 B;  4QVC A;  4YCW A;  2P0P A;  2DXT A;  5DY9 A;  4C8Q B;  4H2T A;  3HHT B;  2HAX A;  3JB9 D;  3V8K A;  5GMK h;  4M7D G;  1K8A U;  4YRP A;  4L59 A;  3PIO A;  1O9S A;  2CS7 A;  2RHS A;  3PT9 A;  1ADJ A;  2PU9 B;  5LJ3 j;  2KMT A;  1M5Q 1;  3QZ9 B;  1YIJ T;  1EFW A;  2IG0 A;  5GAN 6;  3ME9 A;  4M77 A;  4M7A B;  3J81 E;  4J6X A;  3LSQ A;  5CVI A;  4FU6 A;  1WJQ A;  2AMC B;  3QXE B;  1BBW A;  1OI1 A;  4F7U G;  4CI0 C;  2JVV A;  2ZIN A;  4M77 D;  4MMK A;  4FIB A;  4WJ3 M;  1RIQ A;  3JCM d;  4PG3 A;  4A4G A;  4HCB A;  4J5Y A;  4XTV A;  2PME A;  2LQ8 A;  3AHU A;  2EFI A;  4ZTU B;  1UGS B;  5FRM A;  5GAN 8;  3BDL A;  2XTI A;  2JZ2 A;  5LJ3 f;  3QJY A;  4C5H A;  1YI2 A;  3OYA A;  4M75 E;  3P8H A;  4OB2 B;  5GAM j;  3PNW C;  4JLI A;  2RJF A;  2A8E A;  3CCM T;  1W2B A;  4K87 A;  3JCM c;  3G71 T;  12AS A;  3WQZ A;  3LSS A;  3CC7 A;  2LVM A;  3VQX A;  4BE0 A;  2EYQ A;  5LJ3 h;  3JCM W;  4JJN K;  1NJ8 A;  3UT1 A;  2JUF A;  1NJ2 A;  2F5T X;  4HKE A;  4GLK A;  1YJ9 A;  3RKX A;  5CR2 A;  1E1T A;  2EQM A;  2JNG A;  3P8B B;  4M78 A;  3NTK A;  1KMM A;  2EQJ A;  4H2U A;  5KE2 A;  2ZTG A;  2HQX A;  2KVQ G;  2XU8 A;  2HNI A;  4OGC A;  3IAL A;  1M9S A;  1K73 C;  3GOX A;  2ZIO A;  4LNS A;  2GQV A;  4YRR A;  2H3J A;  4WI1 A;  3G71 A;  2QHU A;  2L8D A;  4M78 D;  1X55 A;  3J7A F;  5C0M A;  4OVA A;  4M7D F;  4VUB A;  3QYG B;  5CKF A;  3P8D A;  1B76 A;  1YJW A;  2NS6 A;  4XQ3 A;  4K86 A;  4OB1 B;  3EAE A;  4C5I A;  4J6W A;  2XHC A;  4JRP A;  1W2B S;  4QQ6 A;  3TEG A;  2VYT A;  2RHZ A;  3HFO A;  4MZM A;  3JCM J;  2B8A A;  2CIM A;  3CBP A;  3H6Z A;  3DB4 A;  4C0G A;  1EIY B;  4XAX B;  3CCS A;  2BIV A;  2VXF A;  4EPC A;  4G84 A;  3N5B B;  3OYK A;  4BI8 B;  3I55 T;  3OQ5 A;  1JB0 E;  4M75 G;  2Y4Y A;  3HXX A;  2FYK A;  3X25 B;  3HFV A;  5LJ5 j;  2RHY A;  3RMS A;  3GF5 A;  3M57 A;  5GAN j;  1WQ7 A;  3JB9 G;  2D0Q B;  3L1A A;  2RHX A;  3E9I A;  4TQF A;  3CCL T;  1X54 A;  3E9G A;  2CGH A;  2IY5 B;  1VQN T;  1M4Z A;  5D6Y A;  2P0Q A;  3JB9 H;  1VQP A;  3I55 A;  1B70 B;  3SWN A;  4LD9 K;  5GAN 2;  2XDB A;  1UGQ B;  4TVW A;  1YIT T;  5HY6 A;  3SD4 A;  2E70 A;  1JJC A;  3P8Y A;  2V8K A;  2DJZ A;  4EDU A;  2LRQ A;  5LJ5 f;  1MHN A;  5C53 B;  1NJ6 A;  3UFG A;  4C92 E;  3OY9 A;  4ZTZ B;  4IUV A;  2X35 A;  4C0F A;  4BUG A;  2EAY A;  3URG A;  3HL8 A;  3QDR B;  1WLE A;  4EMG A;  1X6O A;  1K9M C;  4II1 A;  1FWZ A;  4P71 C;  2YLC A;  4YRC A;  2ZIM A;  3CMA T;  5FRN A;  5LJ5 h;  1VQM A;  4M7A E;  3VQY A;  5GAN h;  1UB4 A;  4BY6 C;  1HXD A;  5FU7 B;  4D6W A;  2QEX T;  3CCV A;  1Q81 C;  2K3X A;  1U1S A;  1Z7N A;  1OYX A;  4P75 A;  1VQ8 T;  3H8Z A;  3QYH B;  4BE1 A;  3PGG A;  2P5I A;  2C06 A;  1G3S A;  4M7D A;  5GAM e;  1KG1 A;  1S72 A;  4H2W A;  3LGF A;  4MZT A;  3CCR A;  3BY7 A;  1VQZ A;  2LC4 A;  2E41 A;  4ZGD B;  2ZCF B;  3UGQ A;  3ER0 A;  1NPP A;  4Y91 A;  4XK8 E;  2LT1 A;  3PTA A;  4M7D D;  4M75 F;  4KUI A;  4HT8 A;  4QVD A;  1N9S A;  4P3P A;  2E65 A;  4M77 C;  2QEX A;  1USY A;  2QA4 T;  3RAC A;  5F5W A;  4C0D B;  2RJD A;  4F7U A;  1G5I A;  2CZ6 B;  3REU A;  1H4Q A;  3JB9 F;  2DO3 A;  4BW9 A;  3FIF A;  3ZBD A;  1BI0 A;  2D6F A;  1DJ7 B;  5GAO r;  4YDQ A;  2DIG A;  4FT2 A;  3HRU A;  2WSE E;  1D3B B;  4YRQ A;  3L2Z A;  2IY5 A;  4MDX A;  1Q7Y C;  1KC8 C;  2R5M A;  4C8Q G;  3OS5 A;  3CCJ A;  1XOV A;  4B9W A;  3OW2 A;  3GPL A;  3F70 A;  4C5G A;  2XDD A;  3MEY A;  1KOG A;  2DTH A;  2ARU A;  5HKC A;  2RD1 A;  1KQ2 A;  3M59 A;  2QA4 A;  5GAO l;  2RHU A;  3HXU A;  2V8I A;  2RK1 A;  2I4N A;  1I81 A;  2PQW A;  2XID A;  3JSC A;  4M7A G;  4E47 A;  3BW1 A;  3VUB A;  4PJO C;  1WJS A;  2QI2 A;  1B34 A;  4DA4 A;  1Q82 C;  5J26 A;  5CQX A;  2M9U A;  1VQ9 A;  4YRO A;  1NE8 A;  2RHQ B;  2ZNJ A;  1PYS A;  1FXX A;  4MML A;  2DZ9 A;  2ZT5 A;  4ATO A;  3QUI A;  4RQF A;  5ELN A;  3V7S A;  3CD6 A;  5GAN e;  1WQW A;  2E6N A;  4J8O A;  1KHI A;  4YRK A;  3CPW S;  4XTX A;  1ZQ1 A;  2I4M A;  4O2D A;  4UP9 A;  3SFM A;  2K3Y A;  3L4G A;  3QII A;  1QP2 A;  3OS2 A;  2VUB A;  3FC3 A;  2DXC A;  3OW2 S;  3QTC A;  3KFU A;  3QBY A;  1V29 B;  5CK9 A;  1QW1 A;  4X9D A;  3A7A A;  5CKD A;  3FJP A;  2RK2 A;  1YCY A;  3CCQ A;  3OSV A;  4N0A A;  4P72 A;  2QHT A;  1EQR A;  3TEE A;  3BFM A;  3NTI A;  2ODR D;  3DLM A;  4A54 A;  5DLO A;  4YRN A;  4M78 F;  3ICA A;  1G3W A;  3MEU A;  4BAC A;  3CME A;  3MF2 A;  1R8O B;  5GAO n;  3A7R A;  2A7Y A;  4RG8 A;  3VUZ A;  1VUB A;  3M4P A;  4HWP A;  4M75 A;  4PJO B;  2DKG A;  3QZ5 B;  5J39 A;  4YRE A;  4H2X B;  2DTI A;  4LVM A;  2K5L A;  1ATI A;  4YPF A;  4C8Q F;  2Q5I A;  4XEO A;  2JTM A;  1IRE B;  1N8R C;  1X75 C;  5LL6 S;  1ZBX A;  3Q1J A;  2DD4 A;  4H2V A;  4R56 A;  1K9M U;  4M75 D;  3REX A;  2MMP A;  1YHQ T;  3VYH B;  1RI0 A;  4A4H A;  2ZCE A;  3JCM P;  5A0G A;  2E5Q A;  4P73 C;  1EVK A;  4N4H A;  4C92 B;  4TWA A;  3OYJ A;  2Q5H A;  2OTJ T;  4ZIB A;  2CKK A;  1Q81 U;  3JRZ A;  3RUX A;  3HTZ A;  2EJ9 A;  4OB0 B;  1EIF A;  3A74 A;  3SWN C;  3CBO A;  3G4S T;  1H4S A;  3VU3 C;  3QPH A;  2I2L A;  3OYH A;  4NCX A;  2RM4 A;  1KD1 C;  2QHS A;  2E6Z A;  4TQD A;  2KQW A;  3A5Y A;  5HK0 A;  4R55 A;  3OYC A;  3SB2 A;  3FB9 A;  3JCM f;  5GMK m;  3L2U A;  3RL6 A;  4EMK A;  4E7L A;  5FU6 B;  4MDW A;  1VQ6 T;  4QVZ A;  2L5Q A;  5CKE A;  4XTZ A;  3X26 B;  3C4S A;  4EMH A;  2XIC A;  3DLL A;  3TEH B;  2LDM A;  1X2G A;  2K5F A;  4WF2 A;  4AH6 A;  4RDX A;  4BI3 A;  3FEO A;  4ELZ C;  3OYM A;  3OS1 A;  1VQL T;  4YCV A;  4CH4 A;  1YIJ A;  4LD6 A;  3RIR A;  2QHV A;  2QDY B;  1WU7 A;  3I56 T;  1VQ5 T;  2LQK A;  3CPF A;  3NEN A;  1QVG A;  3LWH A;  1KC8 U;  1M1F A;  1RL2 A;  2BUD A;  2DQ3 A;  4J15 A;  5CIU A;  1QE0 A;  5EG2 A;  4IUT A;  5HK3 A;  4M7D C;  2EL9 A;  4CH3 A;  4LDY A;  3JAM E;  2HQE A;  2AHJ B;  2Y90 A;  3VYG A;  2ZPI B;  3LC0 A;  2ZZD A;  1NJ5 A;  5CO7 A;  1VQL A;  3JCM g;  4DPG A;  3RGL A;  3V7R A;  1GGM A;  3MQZ A;  2EJF A;  5LJ3 d;  3I56 A;  1VQ5 A;  4WJ4 A;  2RO0 A;  2NLU A;  1KQ1 A;  3M5A A;  1LOJ A;  1SET A;  1Q82 U;  1USY C;  2CJB A;  5GAO p;  1J5W A;  2JTF A;  5L8R E;  2M0O A;  2DU5 A;  3DSQ A;  4HCZ A;  3X20 B;  3CCM A;  3RMQ A;  4CS3 A;  3C94 A;  3M54 A;  3UGT A;  2QXF A;  4Q6G A;  4XTY A;  4C8Q A;  4JDS A;  2K5I A;  3VQV A;  3A5Z B;  5GMK e;  4C92 A;  3CC4 T;  2EQU A;  1PSF A;  4EO4 A;  3LW5 E;  4LDU A;  1H64 1;  4M77 E;  2EWN A;  5A2Q E;  4C8Q D;  2DVE A;  4XTW A;  2I4O A;  1PSE A;  4C92 D;  4PLL A;  4M7A A;  2RI3 A;  2VGN A;  2E10 A;  2AMC A;  3S3M A;  4F7U F;  5GAM d;  5E3I A;  2EJG A;  3OS0 A;  1JRI A;  2O4X B;  1HC7 A;  4KR2 A;  1Z7M A;  4JLG A;  3CC2 T;  4M7A D;  3CMQ A;  5CQY A;  4L5G A;  2HD0 A;  2P0K A;  3ZEH A;  4RQE A;  1BIB A;  2KDS A;  2E1H A;  3QO3 A;  3J80 E;  4NL3 A;  5DLQ E;  3X28 B;  3HSB A;  1EOV A;  1UEB A;  4BDZ A;  3MEA A;  1KQS A;  3A8O B;  1EVL A;  2DZC A;  4UP8 A;  3TRE A;  2X4X A;  2XG8 D;  4PJO E;  5I21 A;  1QP3 A;  3A8G B;  3G6E T;  4H2Y A;  4Y28 E;  2YLB A;  2AKW B;  3MET A;  1P92 A;  3HXY A;  1WPY A;  2FHD A;  1U8R A;  2G3R A;  3PCO B;  4Z02 A;  2PUK B;  4UP7 A;  5LJ3 e;  2J3L A;  4P3O A;  2LX9 A;  1UGR B;  2XDP A;  4N4G A;  3PMI A;  1VQK T;  2ZT6 A;  2L3R A;  4YRF A;  3E1S A;  3CCL A;  2P0L A;  1IL2 A;  3IKL A;  5GAN 4;  1M1K C;  4G85 A;  1VQN A;  4JRI A;  1AHJ B;  3C12 A;  1KD1 U;  2VV5 A;  2LNV A;  2ZXF A;  3VJP A;  4ZGE B;  3C95 A;  4M75 C;  1G5H A;  3P8V A;  3LGL A;  4HT9 A;  4OB3 B;  1YIT A;  2ARS A;  2M1H A;  5KCO A;  1E24 A;  2RH2 A;  2X4W A;  5LJ5 d;  4JS5 A;  1VQK A;  4DQ2 A;  1NPR A;  4RMF A;  1KQS S;  3OYB A;  5GAN d;  3KBG A;  1KMN A;  1UGP B;  3OYG A;  4QQD A;  5KE3 A;  1WYD A;  2ZPF B;  1N9R A;  3JB9 J;  1WNL A;  2DDZ A;  3A32 A;  2E3C A;  1X01 A;  1EIY A;  2OTL T;  2DU7 A;  3CMA A;  2F69 A;  1L0W A;  3GNG A;  3RKY A;  5K1X A;  4J83 A;  1Q86 C;  3G1Z A;  2E64 A;  4J7I A;  1ZHI A;  4KUL A;  4PJO G;  1Y96 B;  4YTL A;  3HXZ A;  1VQ8 A;  3VBB A;  3IG2 A;  2CZ1 B;  3M56 A;  5IN1 A;  3M58 A;  3HFZ B;  2ZNI A;  3HRI A;  4YRG A;  2E12 A;  4XEM A;  3QNE A;  4FT4 A;  2OTL A;  1BBU A;  1X2H A;  2XKO C;  1G51 A;  1K73 U;  3CBM A;  4TVA B;  4RCC A;  11AS A;  4ZN1 A;  4C92 G;  2AKW A;  4MZP A;  3SDZ A;  3RER A;  1B70 A;  1NJI C;  4YRS A;  4P3N A;  3PCO A;  3X24 B;  4E7K A;  2FVU A;  4CS2 A;  4BY6 B;  1B7Y B;  2MF2 A;  3A8L B;  2M16 A;  3RF1 A;  2JOY A;  4H2S A;  2LCL A;  3E9F A;  3OYY A;  3L2R A;  2PVG B;  2LT4 A;  2QQA A;  4CRI A;  3UH0 A;  3R07 A;  3OMG A;  2Q7E A;  5A0L A;  1QVP A;  3WXM B;  4B9X A;  3L42 A;  1GXI E;  4LVK A;  2XGT A;  1HTT A;  4CH6 A;  2WAC A;  1OZ2 A;  5CKB A;  4YRL A;  2RHS B;  5LJ5 e;  4M78 C;  3RES A;  1IZ6 A;  4M77 B;  1C0A A;  2ZPG B;  3LX7 A;  3S3N A;  2QQB A;  2DQ0 A;  3CCE T;  4M7D E;  4KT0 E;  1I4K 1;  4LVJ A;  1BI3 A;  4ELY C;  2KSS A;  4C8Q C;  2R58 A;  2CZ0 B;  2LCC A;  4P5N A;  3OYL A;  1NJ1 A;  5D6X A;  4ZTJ A;  2CYZ B;  3EFR A;  4X34 A;  2O01 E;  4JS4 A;  4OF1 A;  2ZPH B;  1FX7 A;  1Y96 A;  2ZT7 A;  1M8V A;  3JCM b;  3CCE A;  4K88 A;  1YBY A;  1JBM A;  1YJN T;  3LLR A;  4YRI A;  3NFC A;  2YHT A;  3FDR A;  3A7U A;  1I8F A;  3RKW A;  2Q7H A;  2DAQ A;  2PVD B;  1M1K U;  4DOV A;  3QO8 A;  1D3B A;  5C52 B;  1LJO A;  1Y71 A;  4HCC A;  2ZZG A;  4C92 F;  3OSS C;  5GAN 7;  4NL2 A;  3M4Q A;  2R5A A;  4TVA A;  2E5A A;  4C5E A;  4RKU E;  3CCU T;  3MHX A;  4M78 B;  2DXU A;  5KCH A;  1N6A A;  3I7F A;  1B7Y A;  3NET A;  3QO5 A;  3DB3 A;  3ASK A;  2I4L A;  4O6J A;  2RB6 A;  3INZ A;  4IUU A;  5M9O A;  3QG1 A;  1VIE A;  5GAN 3;  4M7A F;  3L2V A;  2GFA A;  3QJ6 A;  4UPA A;  1YFS A;  2MAM A;  4KUD K;  3OD1 A;  3PIP A;  2L89 A;  3UDC A;  2ART A;  3A8H B;  2RHQ A;  5IAY A;  3CCU A;  2G4C A;  2Y4X A;  1YHQ A;  4BB7 A;  1SER A;  4IUP A;  2DK3 A;  3EFS A;  2RA2 A;  4X5O A;  2IVW A;  3HRT A;  3MP1 A;  1Q86 U;  4PKC C;  4RG2 A;  3OBW A;  3JB9 I;  3G7Z A;  2OTJ A;  2QTX A;  1BYM A;  5KH6 A;  4QW2 A;  3WVE B;  1YI2 T;  2K57 A;  1VQ7 T;  1NZ9 A;  3OBY A;  2QQ9 A;  3S6W A;  3G4S A;  3JCM h;  3HPW A;  3VV0 A;  2WSC E;  4DOW A;  3PMT A;  2MWP A;  3CC7 T;  3UWN A;  1BI2 A;  3PFS A;  1Q7Y U;  1OZ3 A;  4YRM A;  4LVI A;  4P75 C;  4GY5 A;  4OMF B;  2HBP A;  3OYN A;  1YJ9 T;  1VQ6 A;  3GIB A;  1NJI U;  1H3Z A;  1Y07 A;  4HWR A;  5GMK l;  4XTU A;  1VQ7 A;  2ZGW A;  1BIA A;  4OLF A;  3M4Y A;  3MP6 A;  2DXB A;  1XQH A;  4IUQ A;  3FLG A;  4PJO A;  3LH0 A;  1YFT A;  4TVR A;  4Q5W A;  3SWN B;  5DM7 R;  4H2X A;  3M4G A;  2ZR3 A;  1G3T A;  3GNF B;  3QSU A;  3LYI A;  3JCM X;  2PVO B;  4PLI A;  4KR3 A;  1JJC B;  3UPU A;  1O75 A;  3BDU A;  4LDX A;  1YJW T;  3CEY A;  1SES A;  5I2S A;  2RJC A;  3T9N A;  4PJO D;  3CXC A;  1YB3 A;  1U1T A;  2XD0 A;  1ADY A;  4ME7 A;  2ZT8 A;  1E1O A;  5I2M A;  3A31 A;  2Q7G A;  4J7F A;  4A4K A;  5CCA A;  3OYI A;  1VQ4 T;  3OMC A;  4E7J A;  4H02 A;  3CCS T;  2OAU A;  1QVG S;  4LVL A;  4YRJ A;  5LJ3 g;  5GAM f;  1MGQ A;  4PHC A;  5CKH A;  3FRN A;  2F5K A;  1E22 A;  2QQR A;  3HY0 A;  1NNH A;  3M53 A;  2K2V A;  1X56 A;  2DTO A;  3V8L A;  4M7D B;  4RCB A;  2EQK A;  1H4T A;  3CC4 A;  3BJU A;  5GAM h;  2RI2 A;  1VQ4 A;  1LYL A;  4XU0 A;  3TEH A;  4P74 A;  3MEV A;  3JCM Q;  3JCM e;  3TCJ A;  5GAN 5;  2FB7 A;  1W66 A;  2YRV A;  1VQP T;  4TVY A;  3GLX A;  3KXT A;  2ZR2 A;  2CJ9 A;  4RMO A;  2QQS A;  4OGE A;  4A4E A;  3CXC S;  3NEL A;  2WSF E;  4YRT A;  4E51 A;  3NTH A;  5C6S A;  1ASY A;  1N27 A;  3HRS A;  4HA8 A;  5FU7 C;  4F7U B;  3VKI A;  1N8R U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...