2FYKA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with adp and biotin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--protein ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fykA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2fykA01
5GAMj 4J6YA 5DY9A 3VBBA 3E9HA 2CJAA 1BBWA 4JRIA 4M77G 5LJ3e 5GAN7 2C8MA 3BDUA 5LJ5j 4H2XA 3TEHA 4A53A 1TH7A 3L1AA 1NYRA 4QVDA 1E24A 3JCMb 4H02A 2XTIA 3TUPA 2AMCA 1I4K1 3QO7A 1SETA 4YRRA 3G1ZA 3NEMA 1HXDA 4YP0A 4XTZA 4P72A 1LYLA 3JB9H 1WU7A 3NELA 2EJFA 2EL9A 5C51B 4YRFA 1JRIA 4YPFA 1MGQA 2E64A 3M4PA 1G5HA 5GAOp 2DEQA 1E22A 2ZR2A 4M77D 3GIBA 2I4LA 1H4QA 5C52B 4M77A 1M5Q1 1LJOA 5GAMd 1USYC 4YROA 2RHQB 4H2UA 3QTCA 3A74A 3JCMh 2E41A 4ZIBA 1X2HA 4RMFA 4M7AC 2ZCEA 1M8VA 5LJ3f 1PYSA 4X9CA 1NJ5A 3RL6A 3V8KA 2ZR3A 1B7YB 4PG3A 3IG2A 3QO5A 3IKLA 2HNIA 4TVYA 3A7AA 3L4GB 2ZZEA 1U1SA 1I8FA 3VU3C 3P8TA 4HWSA 3SWNC 2P0LA 1KMMA 2PMEA 4P71A 3INZA 4J5YA 2QHVA 5LJ3j 4TVAB 4M78D 1IL2A 1KQ2A 1EIYA 4M7AE 4N0AA 4M7AB 2G4CA 3HXWA 2RHSB 4X9DA 3JCMQ 2EAYA 4H2WA 1U1TA 3M4QA 4J6XA 3JCMg 4M7AF 3PCOA 5LJ5e 2I4OA 5GAN3 3SWNB 3RGLA 5ELNA 3HXXA 4P74A 4Q15A 4YRLA 4XU2A 3V7CA 4C92E 4UP8A 3QSUA 4XTUA 4C92B 3UGTA 3FJPA 4MMKA 4YCWA 3BY7A 4OLFA 1D3BB 2YLCA 4J15A 1NJ8A 3ICAA 4NOYA 4YYEA 4C92F 4M75C 1WYDA 2Q7HA 5GAOl 5CAIA 5HGQA 4PNOA 1GGMA 1G5IA 2DQ3A 5GAN4 4L87A 3JB9J 1YCYA 2YLBA 3RKYA 1J5WA 4XTYA 2Q7GA 3FIFA 3ERRA 2PMFA 4M7AG 3A7UA 4K87A 2QHUA 3REXA 4M75E 2ALYB 2RHQA 2DTOA 4M75B 1KOGA 3REUA 2ZZGA 1WPYA 3RKWA 1B7YA 3P8YA 3L4GA 1G51A 4DQ2A 5GMKl 2EJGA 5GAMg 1WLEA 2E5AA 2ZINA 4CS4A 4NL3A 4WJ4A 4V2SA 5GMKj 1HC7A 4TTVA 4EX5A 4TWAA 4C92G 1USYA 5GAN6 4TVAA 3L2ZA 2DXUA 3LSQA 4XEMA 5GANf 3RUXA 4M7AD 1YFSA 4NCXA 1Z7NA 4M7AA 4PJOC 3JCMX 2RHSA 2I2LA 4YDQA 4C8QC 1WNLA 1FYFA 4H2YA 4HWTA 1LOJA 4ZTZB 2RM4A 3V7SA 4YCUA 1BIAA 3SWNA 5GANj 3A32A 4F7UE 2AKWB 1LNXA 3QNEA 2DU5A 4F7UB 1H4TA 1EQRA 3BFMA 5GAN5 1X55A 3HXUA 4C92D 2ZNIA 1Z7MA 3QO3A 4C8QE 4C92A 5LJ5d 4YRKA 4M75G 4BW9A 4F7UF 4C8QB 1D3BA 4G84A 1H641 4G85A 2ODRD 2ARUA 3OD1A 1H4SA 3VQXA 3SB2A 2CJBA 4C8QF 2QHSA 2VC8A 4LNSA 1X2GA 2VXFA 5GAN8 4CH3A 3RESA 1WQ7A 2ZT5A 1X56A 2J3MA 4P72C 3FB9A 4P3OA 1SESA 2Q5HA 3RERA 4TVWA 12ASA 2DXTA 5KNNA 5LJ3g 1X54A 3JCMf 1EVKA 4H2VA 2ZIMA 4YRGA 3KFUA 2DZ9A 4PHCA 1SERA 4YRCA 2ALYA 4M75D 4XU0A 1B70B 4M75A 4EMHA 1YB3A 1ADYA 3QHSA 2IY5B 5GMKe 2DDZA 1NJ2A 4A54A 4H2SA 3UGQA 3CMQA 3HSBA 5GAOr 4F7UG 2Q7EA 2DTIA 3A5YA 2YHTA 4KR2A 4WJ3M 3NENA 3EFSA 4J6WA 3P8VA 1C0AA 3JCMW 3UFGA 4P75A 4C8QG 3HY0A 2Q5IA 2ZGWA 5LJ3d 4YRPA 5GAMh 3A5ZA 4XQ3A 2RB6A 3A7RA 3BW1A 4EMKC 5GANe 3JB9F 2FB7A 3V7RA 4O2DA 1E1TA 4M78C 4K86A 5LJ5h 4HA8A 1NJ1A 1YFRA 3HTZA 4Q6GA 1X01A 4CS2A 2AKWA 4HWRA 4F7UA 2K57A 3EFRA 4HWOA 2ZIOA 4HT8A 3RACA 3HFVA 4WF2A 4QVCA 3HXZA 3IKMB 5GAOn 1B34B 4EMKB 3HFZB 3R07A 4YRQA 1ASZA 2XGTA 4C8QD 4BWAA 3JCMc 4M78E 4C8QA 4K88A 3A31A 5GAMf 4P3NA 4M78B 4YRIA 2DZCA 4M75F 3V8JA 3HXYA 3JB9I 4H2TA 4XU1A 1YGBA 4EO4A 4ZTUB 3QUIA 3HFNA 1NJ6A 4KQEA 1ADJA 1HTTA 1Y96B 4YRJA 4DPGA 4OP0A 1W66A 4JRKA 4UP9A 1SRYA 3VQYA 4CH6A 5LJ5g 4RCBA 2RA2A 3NETA 4CH5A 1JJCB 3JB9G 1RIQA 1VQZA 3HRIA 1N9RA 4XTVA 4RCCA 2EWNA 3UH0A 4JLIA 2ARSA 4P73C 3I7FA 3JCMe 1B70A 1L0WA 2I4NA 4CH4A 1B8AA 5C53B 4M7DC 3LSSA 2IY5A 4JUVA 2ZZFA 4HWPA 5LJ3h 2E1HA 3MF1A 1EVLA 3VQWA 4PJOE 4XTWA 2E65A 1NYQA 2CJ9A 5GANg 4E51A 4PJOB 3JB9D 4KR3A 1NNHA 4EMGA 2C7IA 3LC0A 4YRSA 5K1XA 4M78G 2DJZA 4PJOF 3JCMP 4M7DE 1B76A 1N9WA 3E9IA 3RF1A 11ASA 4AH6A 2E3CA 3MF2A 4M7DB 4NL2A 1KMNA 5GAOm 2E10A 1YFTA 2FYKA 3WQZA 4HVCA 3MEYA 4M7DF 3TEGA 5GAN2 2QTXA 4YCVA 4XEOA 1JBMA 4XTXA 2EJ9A 5GANd 4WI1A 4X5OA 4RQFA 2P5IA 3DSQA 4H2XB 1ASYA 3TEHB 2CIMA 1BBUA 3HFOA 3HFZA 1B34A 4EMKA 1QE0A 4M77C 2DVEA 2AMCB 3IALA 2DU7A 1H4VB 4M78A 4CS3A 4XU3A 3V8LA 2RD1A 3VQVA 4C92C 5GAMe 2Y90A 3JCMV 1Y96A 5GMKm 3PGGA 4PJOG 1E1OA 2JN0A 2J3LA 3W3SA 1I5LA 2ODRC 4M77E 5I21A 1JJCA 4HT9A 4P3PA 2DTHA 3JCMJ 4P71C 4M77B 3M4GA 4RQEA 2DKGA 4UPAA 2CGHA 5GAOq 2DQ0A 1HK9A 4M7DG 3HRKA 3RIRA 2ZT8A 1I81A 4N0AC 4M77F 3BJUA 1PYSB 2ZNJA 5GMKh 5GMKi 3HXVA 3AHUA 4YRMA 5E3IA 2QHTA 1EFWA 4YREA 1WQWA 3QO8A 4PJOD 5ELOA 4YRNA 3JCMd 1BIBA 4PJOA 3RKXA 4RDXA 3PZCA 4P74C 4UP7A 5F5WA 1EIYB 1KQ1A 1EOVA 4P73A 2I4MA 2ZTGA 5K1PA 4M7DD 2ZT6A 2ARTA 4Y91A 5GANh 4TQFA 4TQDA 2ZXFA 4M7DA 2ZT7A 5LJ5f 3HY1A 4M78F 4MMLA 4P75C 1QF6A 1ATIA 4YRTA 3PCOB 2VXEA 1N9SA
chains in the Genus database with same CATH superfamily
5J39A 3M5AA 2K4YA 2EYYA 1UEBA 3VBBA 4PFPA 1PCXA 1ZLMA 1VQNT 3CCQQ 3TEHA 4A53A 3G71T 4BI8B 4MDWA 2RJCA 1KK7A 3A1PA 1ZUUA 1E24A 2OI3A 2VYTA 2AMCA 3QO7A 2MI6A 3MPUB 2M0YA 4K11A 1AWJA 2WACA 3CD6Q 1WU7A 1WA7A 3PNWC 4D8KA 3CCRT 1W6XA 4J7FA 4E7LA 1HSQA 2NUTB 1MGQA 2E64A 1G5HA 4IUTA 1FMVA 1E22A 1N27A 2XDBA 1K8AR 3GIBA 1H4QA 5GAMd 1LJOA 2KI7A 2DM1A 3MEVA 1YWPA 1OPKA 1VQ5A 3MKDA 2P4RA 4O6JA 2QEXT 1X2HA 4IURA 2ZAEA 3OYBA 1M8VA 1NJ5A 4JDSA 1KSWA 2ZPBB 2ZR3A 3TEEA 1SHGA 3IG2A 4O5VA 2HNIA 4TVYA 1V76A 4OMPA 1RI0A 3L4GB 4RTWA 3RMSA 4FL6A 1G3WA 1D09B 2O4XA 3QYHB 3INZA 2QHVA 1E6HA 3GOXA 4ORZA 2DETA 3EH2A 5FLXE 4N0AA 1QVGA 4J9CA 2EKHA 3CMET 4X9DA 3JCMQ 2EAYA 3HRSA 3M4QA 4J6XA 3JCMg 3NGPA 1PNJA 2YUPA 5LJ5e 2EGCA 2RQRA 2ENMA 3C0CA 1WHHA 3ZEHA 3PVQA 3CCET 4XTUA 4C92B 3OYEA 3FLGA 4AG1C 4Z8AA 4YCWA 1D3BB 1GL5A 3MO8A 1PG5B 4J9EA 4NOYA 8ATCB 3OYLA 1YJNT 2QK0A 5IHIA 2RI2A 4PNOA 1VQOA 1GGMA 1G5IA 2DQ3A 4RTZA 1WIEA 5GAN4 2HL3A 3JB9J 2PQWA 3G1JA 2QA4Q 2YLBA 5CIUA 4XTYA 1GBRA 1TTHB 2QGFB 1EZZB 2CKKA 2ROTA 4OB0B 3ERRA 3OYJA 3VUZA 4LXCA 4K87A 1Q81U 4C0ZA 4HVWA 2ZPIB 4LDWA 2DTOA 2DERA 2GQIA 4M75B 4EPCA 5M9OA 4C0DC 3REUA 1AOJA 4NS5A 1QCNA 4RMOA 1JXMA 1B7YA 2CT4A 2OAWA 2DXCA 4C0FA 4HVUA 4DQ2A 5GMKl 4E7SA 2ZINA 2J05A 4NL3A 5KYUB 2CS7A 3X20B 1OZ2A 2HQHA 2A36A 2LP5A 5FRNA 4CRIA 1T0JA 2HKNA 2O01E 5I22A 1SG5A 2C0OA 3HRUA 1G3TA 4XEMA 3RUXA 4M7AD 2DX1A 1M1FA 3MJXA 1SSFA 3M0QA 4M7AA 3JCMX 2RHSA 1JO8A 5FU7C 1S72A 2RHIA 4J8OA 4HWTA 1LOJA 2AK5A 2FVUA 3X24B 1ZSZB 5KCOA 1ZHIA 2VB6A 3A32A 3CBMA 1XQHA 1IRXA 4F7UB 1OX9A 2SEMA 3BFMA 4IIMA 3QG1A 3EH1A 1B07A 5EC7A 4YRKA 3D7SB 2ZPFB 4PKCC 2DRMA 5IHNA 2C0IA 2Z0WA 2DLPA 2LQWA 3OD1A 1GBQA 1H4SA 4LUDA 2YRVA 2D6FA 3NFCA 3M57A 1SRMA 2VC8A 2DF6A 3EGDB 4CH3A 4P72C 1VQ7Q 1M90U 5CK9A 2J7IA 1J3TA 4PFOA 5KNNA 2FPFA 1LVKA 4ZTFA 5FU6C 3JCMf 1TUGB 2DZ9A 4PHCA 1SERA 4QQGA 4YRCA 1VQ8T 1X6BA 2PTKA 1VYVA 1YB3A 1GFCA 3IQLA 1ADYA 1U5SA 3ER0A 2DDZA 1ABQA 4H2SA 2AKKA 1UG1A 2A0FB 3M54A 2Q7EA 4FIBA 2O9VA 1K73R 3NENA 2DL5A 1WHMA 2HD0A 1MHNA 1UHFA 3JCMW 4P75A 1UGRB 3CCLQ 4E2FB 1YHQA 1BI0A 5GAMh 4XQ3A 4EMKC 2F5TX 2DIQA 4AFSC 2DAQA 5GANe 3L2UA 3QZ9B 4O2DA 4M78C 2VWFA 2DL4A 4K86A 2L2PA 1WDXA 2HEQA 1X01A 4FYVB 1K73U 1RAIB 2QAZA 2A37A 2FPEA 1ZQ1A 2LTOA 4HT8A 3RACA 4WF2A 5C6SA 4DOVA 3IKMB 2XGTA 4C8QD 2DPPB 1M1KR 4M78E 2QI2A 4C8QA 4K88A 2CUBA 1QQJA 4P3NA 2X4WA 2DZCA 4M75F 3V8JA 3JB9I 5DLOA 4KQEA 2DYIA 2E70A 1HTTA 1UGQB 9ATCB 2H3EB 4BE0A 3OBWA 3G71A 4UP9A 3CCST 4DBHA 5LJ5g 2X51A 1RAGB 4FU6A 3CCUQ 2RN8A 2K79A 2OTJA 4XTVA 2LX7A 4RCCA 1WX6A 1M1KU 1K73C 2V1RA 1AZGB 1Q86U 2J6OA 1VIFA 4ZN3A 2K5LA 4J7IA 3HTRA 4CC7A 1N8RR 1VQKA 4QKUA 2X4YA 1PC0A 2IY5A 4EDUA 5LJ3h 2E1HA 4BD3A 5CR2A 3VQWA 2J6KA 2CJ9A 4LUEA 1NYQA 3A8HB 4PJOB 1X6OA 3TSZA 3QDRB 2QEXA 2R57A 1PRMC 2C7IA 3VS4A 4M78G 4N4IA 3JCMP 1N9WA 3E9IA 1SEMA 1I5OB 1VQ5T 2K3BA 3S3MA 2HKQB 1M1KC 1RADB 2X3XD 1KQSP 4HVCA 4MZTA 2D9TA 3TEGA 4AT1B 1JBMA 1WHKA 5CKHA 1QVGS 4XTXA 3X25B 2EJ9A 4RQFA 3ULRB 2P5IA 3DSQA 4H2XB 2RHXA 1X69A 2M9UA 1VQPQ 3HFOA 1BBUA 3HFZA 3EG2A 3IALA 2DBKA 3VQVA 4JPBW 5GAMe 2Y90A 3G4SQ 1PD0A 1N8RC 5CKBA 1KD1R 2P4TA 1B7TA 3CC2Q 3LWHA 2J3LA 2JVVA 3OYYA 2YUQA 1C1AA 1I5LA 2ODRC 1IREB 1R0BG 1VYUA 1JJCA 2DTHA 2JJ9A 1C0MA 1ABOA 2XD0A 3F70A 2WSEE 1MUZA 4UPAA 1W4SA 1YJNA 2E5QA 2JM8A 2YDLA 4LVMA 1KJWA 4N0AC 1ZUKA 3CBOA 1PSEA 5GMKi 3HXVA 1KD1U 2WSFE 1ZUYA 3OYHA 1FMKA 3QYGB 1VQOT 3OS0A 2P0KA 3GP8A 3VYGA 1KHIA 4C5EA 1I0CA 1K1ZA 1VIEA 2A28A 2PU9B 4UP7A 4RTVA 1EIYB 3CCJA 4P73A 2I4MA 2JOYA 2ZTGA 2FPDA 4ELZC 5A0DA 2P0PA 2JTEA 4TQDA 2ZXFA 1WXUA 1Q7YU 1B3QA 5LJ5f 1K76A 1YWOA 2OJ2A 2KT8A 1QF6A 3PE0A 3HRTA 4KGVB 5DM7R 1N9SA 5I2SA 4PJMA 2RPNA 2BE7D 4J6YA 4XK8E 3GNFB 2FZKB 2CJAA 2C8MA 2VASA 5LJ3e 1KD1C 2ZZDA 2QQSA 5LJ5j 3E9FA 1G5VA 5A0LA 4X34A 3H0HA 2E6ZA 2RH2A 3CC7A 4QVDA 3JCMb 5FRMA 2CZ1B 1SETA 4YRRA 3NEMA 2GQVA 3JAME 3UATA 1HXDA 1S72T 3PMTA 4P72A 1BB9A 1LYLA 3JB9H 4KUDK 2EL9A 3CC4T 3SEMA 5IXBA 3NTKA 1Y0MA 3M4PA 2DEQA 1QVFP 4QVZA 4AFUC 4M77D 5C52B 4OB1B 4M77A 1M5Q1 4LDXA 2RHQB 4H2UA 2QQAA 2JZ2A 1PSFA 4RMFA 4M7AC 2ESWA 1EFNA 4PG3A 3IKLA 1NYFA 1QLYA 5AYFA 2MIOA 4MZPA 3P8HA 3M0RA 5A0GA 3P8TA 4HWSA 1ZA2B 3EGXA 5FW9A 1IB8A 1G2BA 1VQ8A 4J5YA 4M78D 1IL2A 1KQ2A 2OTLQ 4M7AE 2MOXA 3OMGA 2KMTA 3MP8A 2G4CA 1U1TA 3DB3A 4M7AF 3PCOA 2EQKA 2I4OA 3SD4A 3RGLA 2EYQA 5ELNA 3HP9A 2LCCA 3E9GA 4Q15A 2EQMA 1WHJA 4YRLA 3CPWP 4IKFA 3M0PA 4FSXA 4BI3A 4UP8A 2CZ0B 1ZBJA 1QCFA 3UGTA 4RTYA 2KROA 3FJPA 4MMKA 1YHQT 4J9IA 4PLLA 3NPFA 3I5RA 1H3ZA 4OMLA 4J15A 1NJ8A 1RACB 3J7AF 1WYDA 2Q7HA 2MPXC 5GAOl 4RKUE 1NJIR 1WXBA 5CAIA 3A8MB 2KSSA 4LVJA 3EHQA 4L87A 3RKYA 5IHKA 1X6GA 1T0HA 2P0QA 2XI9A 3OYFA 3OYNA 2KBTA 2CUDA 2PMFA 1NBEB 4M7AG 3A7UA 2QHUA 3REXA 4RTUA 2ALYB 1VOMA 3M9QA 1YJWT 4HVVA 4QQDA 6AT1B 1KOGA 2V8IA 1ACMB 1YNZA 4Z02A 4RUGA 3CCSA 2PVDB 2XU8A 2ZPHB 1E7OA 1PKTA 2GGRA 2EQUA 1X75C 1VQ4Q 2AT1B 2RMOA 3CXCA 1WLEA 5GAMg 2E5AA 3GBQA 4LVLA 4V2SA 1RLPC 1HC7A 1O75A 2DIGA 4TTVA 4LVKA 1AHJB 1YIJQ 2RHYA 1USYA 2OTJT 4TVAA 3L2ZA 2DXUA 1VQ6Q 3LWIA 5GANf 4C0DB 1YFSA 4NCXA 2IIMA 1Z7NA 7AT1B 1WHGA 2KQWA 2Y4YA 4C8QC 4CC4B 2K9GA 3I56Q 1VQKT 3VRYA 2BZYA 3OY9A 3S3NA 4H2YA 2DL3A 4ZTZB 1KQSA 2O9SA 3OYIA 4YCUA 3QDFA 4QW2A 3SWNA 4AFQC 5GANj 1NJIC 3QNEA 4F17A 2KY9A 2XICA 2CSIA 2KT1A 1UECA 3CBPA 1EQRA 2X9HA 4E7KA 2ATCB 4J9FA 4LDYA 5CO7A 3QXEB 4C5IA 4C8QE 5FU7B 4BW9A 5IXFA 1Q82R 4G85A 2ODRD 1GCQC 3M58A 1EX4A 1VQLQ 3SB2A 2NWMA 4HCZA 4C8QF 1KHCA 5AT1B 1K8AU 4LNSA 2FRYA 2K3YA 1QP2A 2L3QA 5GAN8 1M3BA 5HK3A 3QBYA 4II1A 1WQ7A 2QA4A 2ZT5A 1MMGA 1Z9QA 3FB9A 1JJ2P 1QWFA 3RERA 4TVWA 2J6FA 5CVIA 5GJVB 5LJ3g 4RTXA 1X54A 1EVKA 3CPFA 1K0SA 5I11A 3KFUA 5HCKA 4KH0B 1AWWA 2E12A 1B70B 4EMHA 2RI5A 2O31A 2EYZA 3QHSA 1JB0E 5GMKe 4HCCA 1TU0B 1NJ2A 1M27C 4B9WA 2K5FA 2DTIA 1W70A 2LC4A 2DXBA 2YHTA 1WJQA 1X27A 4ZNXA 1K8AC 5FU6B 3P8VA 2BE9B 1BI3A 3NTIA 2XG8D 4C8QG 1OQKA 3SDZA 2ZGWA 5LJ3d 2RJEA 1UHCA 3A5ZA 4DEYA 1EIFA 3MEAA 2FB7A 2W0ZA 1Q82C 3NMZC 3EFOB 1S1NA 1NJ1A 3L42A 1OX8A 3HTZA 2AKWA 4BUGA 4J9GA 1IHVA 3OYKA 1ZBXA 3VS3A 2YUNA 2VVKA 4IIOA 2K2MA 3EFRA 1MMNA 3LYIA 2XDPA 3HFVA 4QVCA 4EMKB 3CCJT 2NLUA 1W2BA 5CKDA 1NLPC 3A31A 5GAMf 4M78B 4YRIA 2DO3A 3AT1B 1BCMA 2DILA 2QTVA 4EO4A 1MNDA 2HZYA 2KRNA 3OYAA 3BDLA 4KUIA 4ZGEB 1YJ9Q 3LH0A 1MMAA 3H41A 1W66A 2PVGB 1BCOA 1DJ7B 1M8MA 3OS5A 4FW1A 4KRTA 1VQ7A 3DB4A 1VQZA 1QVFA 1N9RA 2RK1A 3LGFA 2CP7A 2RQUA 2PVOB 4F14A 3CC7T 2EWNA 3CCMQ 3CC4A 4P73C 2DL8A 5KYWA 3FEOA 1L0WA 2JTFA 5FWCA 1X2QA 1B8AA 1D1AA 3LSSA 2RQVA 4DEXA 2D8HA 2DYBA 2JM9A 5D6YA 3CCVQ 3MF1A 3VJPA 2RF0A 4GLMA 1FWZA 4XTWA 4E51A 1SKUB 1QKXA 3JSCA 4ZN1A 2MK5A 1M2VA 1Q95G 2W10A 5KYXA 2KR3A 2PUOB 4C0GA 3FDRA 2LCSA 3H6ZA 4EMGA 5GJWB 3LC0A 4YRSA 2F2XA 5K1XA 1SRLA 3OB9A 3GPLA 3M55A 4AH6A 3R6NA 2E10A 4OGEA 3P8DA 2DFUA 2I0NA 3G6EQ 1AD5A 2PNIA 2FHDA 2KAFA 3TCJA 1M9SA 2DL7A 3TEHB 2EBPA 2CH4W 8AT1B 3O5ZA 1B34A 1TG0A 1QE0A 3REAB 4M77C 3ZL7C 2BTTA 2DVEA 4M4ZA 5HKCA 2AMCB 5CKEA 1OPLA 4CS3A 2BKDN 4XU3A 2K5IA 2VGMA 3V8LA 4C92C 2FEIA 2EPDA 2BIVA 1Y96A 1Z9ZA 1HYOA 1M1GA 2YWWA 1E1OA 1GCPA 4A4KA 4M77E 5I21A 1QP3A 4JJNK 3CCQT 1KFZA 5GAOq 1N6AA 3M4YA 4RTTA 3A98A 1VQMQ 1U8RA 2LQKA 4OMOA 3RIRA 1I81A 5L8RE 4M77F 3QPHA 4ZTJA 3HKSA 4D6WA 3URGA 3I35A 4YRMA 5E3IA 2X4XA 4HXJA 4AFZC 1WQWA 2O4XB 3QIIA 3S6WA 3VS5A 1UGSB 1YJWA 2L3RA 3M56A 5F5WA 1KQ1A 3H9NA 1EOVA 1WJSA 4M7DD 3CXCS 3R6OA 4M7DA 3PTAA 3HY1A 4M78F 4X1VA 4MMLA 1JEGA 3WXMB 1ATIA 1M3CA 4P5NA 2NUPA 1UDLA 2JS2A 4IUVA 3E2UA 5DY9A 3E9HA 1WHLA 2C06A 1R77A 4M77G 2DBMA 2EGAA 3H8ZA 2GCXA 3BDUA 1HD3A 2YSQA 3HL8A 1D1CA 3DLLA 1GCQA 2EYWA 1TH7A 1VQPA 2CT3A 2YXYA 3L1AA 1KQSS 1NYRA 4H02A 4TVRA 2XTIA 2FO0A 1I4K1 3NTHA 1YHQQ 1RAEB 1PWTA 3A5ZB 4XTZA 3FRNA 3KBGA 3Q1JA 3G4SA 1UGPB 1YITA 3M59A 3CC2A 1LPLA 4R0KA 5GAOp 1JU5C 2LCLA 4A4HA 1JJ2A 1N8RU 2MYSA 1VUBA 1USYC 3CMAA 4YROA 4A63B 4C5HA 2E3IA 3A74A 3JCMh 4ZIBA 3RL6A 3PFSA 4GLKA 1PYSA 4X9CA 4LN2A 1NE8A 1B7YB 3QO5A 2GTJA 2J06A 2DA9A 3FJ5A 3A7AA 5KYYA 1N5ZA 3VU3C 2RNAA 3SWNC 2P0LA 4C5GA 2QA4T 1YFNA 1KMMA 4GY5A 2PMEA 1SF9A 2COWA 1VQNQ 2LQ8A 5ECAA 3T9NA 3G71Q 2A08A 4MZMA 3M53A 2M16A 4M7AB 2FL7A 2RHSB 3HXWA 4H2WA 3CEYA 4BDZA 5I2MA 1TXQA 3CCRQ 2JT4A 4MDXA 5GAN3 3OSSC 1YI2A 2HQEA 2CZ6B 2LJ1A 2EW3A 3HXXA 3UF4A 5HY6A 2HCKA 1IZ6A 2DRKA 4XU2A 3QSUA 2DE0X 4OB2B 2OX7A 2YLCA 2QEXQ 3I55A 3ICAA 1QVGP 1UE9A 4JLGA 2O2OA 1G3YA 1K0XA 1XJWB 1YCYA 2NUTA 1IXDA 1W2BS 2Q7GA 3FIFA 4E47A 2DMOA 3CMEQ 2DK3A 4BY6C 2F1LA 3WVDB 2ZZGA 1WPYA 3C12A 3RKWA 2EIFA 1QVFS 2NS6A 3L4GA 1G51A 2VGNA 2KRSA 4F16A 2EJGA 3LH5A 3META 4WJ4A 1TOVA 2EVRA 1VQ9A 5GMKj 3CCEQ 1JQQA 2F5KA 5CCAA 1NG2A 4EX5A 2M1HA 3L2WA 1VQ7T 5J26A 5GAN6 4BACA 2P84A 2OTLA 2KXCA 3OBYA 3LSQA 5D6XA 3MCAB 2MMPA 4RG2A 2QASA 4PJOC 2I2LA 1FYFA 2QG9B 1YJNQ 3E1SA 1GRIA 2RHZA 2RM4A 3S3OA 4FYYB 2AHJB 2DU5A 1LNXA 1YN8A 2KYBA 2VV5A 4FM4B 5GAN5 3UT1A 2DD5A 1OOTA 4C92D 2ZNIA 3HHTB 4AG2C 3QO3A 4C92A 3RMQA 1KG1A 2LJ0A 4C8QB 2XIDA 1D3BA 4G84A 1H641 2KRMA 2RJDA 4E7JA 3CCJQ 1IHWA 2GNCA 3M0SA 2XMFA 5C0MA 1IGUA 2F69A 2ZPEB 3RBBB 2JXBA 4BE2A 2CJBA 5KYNA 2HSEB 1X2GA 4PFZA 3RESA 4ME7A 2J3MA 2CP6A 3PVLA 4GBQA 3X28B 4P3OA 1SESA 2GFUA 2IPOB 3GNGA 2QDYB 4JS4A 2HL5C 2LMJA 4KBMB 2DXTA 2QDLA 4YRGA 4IUPA 2QQRA 1IO6A 3QWYA 4M75D 2LT4A 4XU0A 2K7AA 4D8DA 2QQ9A 2KK4A 4M75A 2IY5B 4A54A 4Y92A 3UGQA 4IUUA 1VQ4A 3HSBA 2BZ8A 3CCQA 4LDVA 5KYUA 1MV0B 4WJ3M 2KYMA 1KC8R 4J6WA 2AKLA 1C0AA 3CCUT 4WCIA 1VQ6A 3HY0A 2E6NA 3FC3A 2F2VA 3BW1A 3CD6A 2B8AA 3OYGA 3I56A 4YTLA 5IT9E 1E1TA 2MWPA 5LJ5h 1V1CA 1ZSZA 3MEUA 5KH6A 4Q6GA 5LL6S 2D0NA 1NM7A 4RG8A 4HWRA 1QCOA 1ZSGA 4F7UA 1Y57A 2K57A 1KC8U 1QMCA 2ZIOA 3O8VA 4CC2A 1AEYA 3R07A 5GAOn 1D0YA 3N5BB 3HFZB 4J9BA 1NJIU 1VQ8Q 3E19A 2XK0A 1KIKA 2CH4A 3RNJA 3HXYA 1BU1A 4XU1A 1YGBA 4H2TA 3LW5E 3QUIA 3HFNA 4ZTUB 1ADJA 3VS7A 1BKBA 4YRJA 3RDVA 4DPGA 3VS0A 4QT7A 1CSKA 4OP0A 4FCYA 1TS9A 2K2VA 3ZFJA 3EGDA 4CH6A 3QJ6A 2RA2A 3NETA 1JJCB 4HCKA 1RIQA 3HRIA 1HJDA 1T3LA 2YT6A 3OW2P 4ZGDB 2EYXA 1MMDA 1VQPT 1CKBA 2EQJA 1KC8C 1FX7A 2MF2A 1K4US 4DBRA 3I7FA 3VS1A 1A0NB 5C53B 4M7DC 4JUVA 4HWPA 1JJ2S 3TSWA 1UJ0A 3G4ST 1AVZC 2K6DA 1YITT 1EVLA 3CC2T 2E65A 2SRCA 3UPUA 4DOWA 2JMCA 1FMWA 1V29B 2X3WD 3OA6A 3JB9D 2MCNA 2L8DA 1NNHA 4QQ6A 2VUBA 3CMAT 3RF1A 1YP5A 4M7DE 11ASA 4PJJA 2E3CA 3MF2A 4NL2A 1KMNA 1BI1A 2YUOA 1TWBA 4LNPA 4FYXB 2AZSA 1JXOA 2DVJA 4HT4A 2RJFA 3MEYA 4M7DF 3CCSQ 2H3JA 5GAN2 4JZ4A 4LD6A 4XEOA 5KE3A 1R0CB 1Q82U 4WI1A 2G3RA 3MQZA 4X5OA 1OYXA 4PL6A 2CIMA 1NZ9A 1SHFA 2EFIA 2FZGB 2XKOC 2DU7A 1H4VB 1D1BA 2GTOA 4PLIA 3H0IA 3LLRA 1YJ9A 3QZ5B 5GMKm 2L3SA 4OMQA 1X43A 4BDYA 3MEWA 1YI2T 4UC4A 1OULA 4HT9A 3JCMJ 4M77B 2OAUA 3M4GA 3PMIA 1BI2A 4RQEA 3DKMA 2DKGA 1Y07A 4ATOA 1TSFA 1HK9A 4JJDA 3OSVA 3JRZA 2X4JA 4M7DG 1NPPA 3CCMA 5FROA 1VQ5Q 2ZPGB 3BJUA 2ZT8A 1AWOA 2L89A 3I55T 2ZNJA 4FT2A 1Q81R 2QHTA 3CCVA 4FSSA 4JRQA 2LX9A 1EFWA 4YREA 3TU4K 3QO8A 3EGXB 4A4GA 4PJOD 1C6VX 4KGZB 3ME9A 3JCMd 4PJOA 4RDXA 1ARKA 3NHNA 2X35A 2CZ7B 1UUEA 2ZT6A 4TQFA 1U06A 5GANh 2R5MA 2CSQA 2ZT7A 2D8JA 3BE3A 1G83A 3G6EA 4YRTA 4EIKA 2VXEA 3PCOB 3EG9A 2LZ6B 1FYNA 5GAMj 1UJYA 1NPRA 4OMNA 1BBWA 4LVIA 4JRIA 5GAN7 4L5GA 1VQ9T 3J80E 4H2XA 3PT9A 2QGGA 2LVMA 3VS6A 2OTLT 3ASKA 4Y28E 1SPKA 3TUPA 3A8OB 3G1ZA 4YP0A 2KDSA 3NELA 2EJFA 1VQOQ 1FXXA 5CKFA 5C51B 4PK4A 3J81E 4YRFA 4HKEA 5KE2A 1JRIA 4YPFA 2R5AA 1Q81C 4HCBA 3CCLA 3EG1A 3HPWA 2ZR2A 4BE1A 1X2KA 2I4LA 2KVQG 1WZOA 2ZCFB 1D0XA 2JS0A 3VS2A 1P92A 1VQMA 3QTCA 2E41A 1M90R 3U23A 5DLQE 1RAHB 2ZCEA 5LJ3f 1WJRA 2ECZA 3V8KA 2E3HA 3VUBA 3EG0A 4XAXB 2CYZB 3OS2A 2M51A 2ZZEA 4FT4A 1U1SA 1I8FA 2EGEA 3RR6A 2D0QB 3CPWA 4KT0E 3UA7A 1M3AA 4P71A 5LJ3j 1UTIA 4TVAB 2KGTA 1EIYA 1IGQA 2Y4XA 3H0FA 1S72Q 2G6FX 2NUZA 3CC4Q 5D6WA 2D1XA 3SWNB 3CCUA 1VQ4T 2K3XA 2HDAA 4P74A 1G3SA 1RUWA 2XDDA 1R8OB 2QQBA 3V7CA 4C92E 1YIJT 3LX7A 4OMMA 2A7YA 1VQ6T 2ED0A 1D0ZA 3OQ5A 3MP1A 3BY7A 4OLFA 1K9AA 2L3PA 3KUFA 3CD6T 2R58A 2RK2A 1I07A 4VUBA 4YYEA 4C92F 4M75C 2ABLA 3I56T 1M90C 5HGQA 3PIOA 1PD1A 1MNEA 4OF1A 1NEGA 1PHTA 1J5WA 1O9SA 3A8GB 4OB3B 3OW2A 2CP0A 2HAXA 2A8EA 4M75E 2MWOA 3GLXA 2RHQA 1WLPB 1AWXA 3GF5A 4FYWB 2E4HA 4L59A 1G8XA 4JZ3A 2JNGA 4CI0C 1NLOC 1WGSA 1BK2A 2M02A 1VQLT 3P8YA 4PJLA 2HSPA 1Q86R 2ED1A 4A4EA 4CS4A 1ZSZC 1H3HA 3VKIA 1ZA1B 3L2QA 4TWAA 4C92G 1VQNA 4BY6B 2JUFA 1OZ3A 3C4SA 3QJYA 4YDQA 1WNLA 3LGLA 3CCRA 1YCSB 5IN1A 4B6MA 3V7SA 3I9QA 1BIAA 1VYTA 4F7UE 1BYMA 1OV3A 2AKWB 1E6GA 3P8BB 4BI4A 3CXCP 1H4TA 1U3OA 5HK0A 1X55A 3HXUA 1Z7MA 3UDCA 1WXTA 2IVWA 5LJ5d 4M75G 4F7UF 1YJWQ 3EAEA 2JTMA 4J9HA 2CP2A 2AZVA 1M2OA 3CQTA 3SHWA 3PIPA 2ARUA 1F1BB 3EHRA 3VV0A 3VQXA 2V8JA 4J83A 2QHSA 2RHUA 1SSHA 3WVEB 2VXFA 2COZA 1XNIA 2CREA 1GFDA 2QXFA 4R55A 1X56A 3EG9B 1Q86C 4FW2A 2Q5HA 4IUQA 2OTJQ 1UB4A 2JMAA 2HMAA 1XOVA 12ASA 4ELYC 4H2VA 4Z89A 1M30A 2ZIMA 3CMEA 2ALYA 1Y71A 5KYWB 2GFAA 3OS1A 1VQKQ 2A3LA 1RABB 2RQTA 2CP3A 2DD4A 1QKWA 4E7IA 1YJ9T 2RI3A 3CMQA 4R56A 2LQNA 4F7UG 5GAOr 3OMCA 4E6RA 3A5YA 2L0AA 3CCEA 4OMFB 1YITQ 4KR2A 5A2QE 2F2WA 1M2VB 2B86A 3EFSA 5KYXB 2E5KA 4OVAA 4AMCA 4ESRA 3UFGA 2V26A 2KE9A 2DEUA 1UFFA 2Q5IA 4YRPA 2HBWA 1TUCA 2RB6A 3A7RA 3CCMT 4JS5A 2WSCE 3KXTA 3JB9F 3CMAQ 2LDMA 3V7RA 4OGCA 5L23A 1VA7A 1H8KA 4Z88A 1AZEA 2MAMA 4HA8A 1ZX6A 4LD9K 3CCVT 1YFRA 4CS2A 1Q7YR 1RL2A 1RAAB 3C95A 2H8HA 1CKAA 4HWOA 1RI9A 3DLMA 1QWEA 1AT1B 3HXZA 3VRZA 1B34B 4E7ZA 4YRQA 1ASZA 4BWAA 3JCMc 4LE9A 1WI7A 4ANJA 2RO0A 2GBQA 1PKSA 1NJ6A 2O88A 2LRQA 1Y96B 3M0TA 3G6ET 4JRKA 3TVTA 3ZBDA 3L2RA 4WTOB 4N4HA 2YRDA 4ZGJB 1SRYA 3VQYA 4E7HA 4RCBA 3OYMA 4CH5A 3JB9G 3OYCA 1YI2Q 3L2VA 3UA6A 3UH0A 2LJ3A 4JLIA 2ARSA 3JCMe 1B70A 2YRCA 2ROLA 1W2BP 2I4NA 4CH4A 2BUDA 4KULA 5FWBA 4LDUA 2ZZFA 1WFWA 1UGVA 3I55Q 3A8LB 5CQXA 4PJOE 4N4GA 1M4ZA 3EGUA 3KFVA 3QKJA 5GANg 2XHCA 3CCLT 2CDTA 1Q7YC 4A4FA 2FZCB 3EG3A 1OI1A 1WYXA 4KR3A 1OU8A 3TREA 4PJOF 2DJZA 1B76A 1K9MR 2DJQA 2V1QA 5IAYA 1VQMT 4M7DB 3X26B 1MV3A 3CPWS 5GAOm 2V8KA 1YFTA 2FYKA 3WQZA 1T3SA 2PUKB 3EFOA 1TUDA 2NUPB 4JRPA 3REBB 2QTXA 4YCVA 1PM3A 1QVPA 2RQWA 3UWNA 5GANd 1ASYA 4B9XA 2BZXA 4J9DA 3JV3A 2EQIA 1RLQC 2GF7A 1VQ9Q 3CC7Q 4EMKA 4DA4A 2M0OA 1K9MU 2COYA 1RAFB 1I1JA 5D7UA 3OYDA 4M78A 2NYSA 2RD1A 4L6V5 1PRLC 2C0TA 5CQYA 3JCMV 1H92A 3PGGA 4PJNA 1NYGA 1YIJA 4PJOG 2JN0A 3W3SA 3G7ZA 5IH2A 2EKOA 1W1FA 2DNUA 2HBPA 4P3PA 2VKNA 4P71C 4Q5WA 2FRWA 4JJBA 4CC3A 4KGXB 2CGHA 4BB7A 2DQ0A 2JW4A 4DBQA 4KH1B 2CP5A 1BBZA 2AIRB 2L5QA 3HRKA 2PZ1A 1OEBA 1PYSB 3M0UA 5GMKh 2LNVA 1K9MC 3MP6A 3AHUA 1XTDA 2QYZA 5KYYB 4JJCA 5EG2A 5J3BA 4DBFA 5KCHA 1GXIE 4F04B 3OW2S 5ELOA 4YRNA 3I5SA 3TQ7P 3MHXA 1BIBA 1NEBA 3RKXA 2KNBB 3PZCA 4P74C 2LNHB 3QWXX 2KXDA 1YBYA 1VQLA 2KEAA 5K1PA 1LCKA 4Y91A 2ARTA 2FG0A 3VYHB 1Y7XA 2HQXA 4P75C 3C94A 3SFMA 3THKA 1OU9A 2LT1A 2IG0A 1QW1A
chains in the Genus database with same CATH topology
5J39A 3M5AA 2K4YA 1UEBA 3VBBA 1VQNT 3TEHA 4A53A 3G71T 4BI8B 4MDWA 2RJCA 1E24A 2VYTA 2AMCA 3QO7A 2MI6A 2WACA 1WU7A 3PNWC 3CCRT 4J7FA 4E7LA 1MGQA 2E64A 1G5HA 4IUTA 1E22A 1N27A 2XDBA 3GIBA 1H4QA 5GAMd 1LJOA 3MEVA 1VQ5A 4O6JA 2QEXT 1X2HA 4IURA 3OYBA 1M8VA 1NJ5A 4JDSA 2ZPBB 2ZR3A 3TEEA 3IG2A 4O5VA 2HNIA 4TVYA 3L4GB 1RI0A 3RMSA 4FL6A 1G3WA 2O4XA 3QYHB 3INZA 2QHVA 3GOXA 5FLXE 4N0AA 1QVGA 3CMET 4X9DA 3JCMQ 2EAYA 3HRSA 3M4QA 4J6XA 3JCMg 5LJ5e 3ZEHA 3CCET 4XTUA 4C92B 3OYEA 3FLGA 4YCWA 1D3BB 3MO8A 4NOYA 3OYLA 1YJNT 2RI2A 4PNOA 1VQOA 1GGMA 1G5IA 2DQ3A 5GAN4 3JB9J 2PQWA 2YLBA 5CIUA 4XTYA 2CKKA 3ERRA 4OB0B 3OYJA 3VUZA 4K87A 1Q81U 4C0ZA 2ZPIB 4LDWA 2DTOA 4M75B 4EPCA 5M9OA 4C0DC 3REUA 4NS5A 4RMOA 1B7YA 2DXCA 4C0FA 4DQ2A 5GMKl 2ZINA 4NL3A 2CS7A 3X20B 1OZ2A 5FRNA 4CRIA 2O01E 3HRUA 1G3TA 4XEMA 3RUXA 4M7AD 1M1FA 1SSFA 4M7AA 3JCMX 2RHSA 5FU7C 1S72A 2RHIA 4J8OA 4HWTA 1LOJA 2FVUA 3X24B 5KCOA 1ZHIA 3A32A 3CBMA 1XQHA 4F7UB 3BFMA 3QG1A 4YRKA 2ZPFB 4PKCC 3OD1A 1H4SA 2YRVA 2D6FA 3NFCA 3M57A 2VC8A 4CH3A 4P72C 1M90U 5CK9A 5KNNA 4ZTFA 5FU6C 3JCMf 2DZ9A 4PHCA 1SERA 4QQGA 4YRCA 1VQ8T 1YB3A 1ADYA 3ER0A 2DDZA 4H2SA 3M54A 2Q7EA 4FIBA 3NENA 2HD0A 1MHNA 3JCMW 4P75A 1UGRB 1YHQA 1BI0A 5GAMh 4XQ3A 4EMKC 2F5TX 2DIQA 2DAQA 5GANe 3L2UA 3QZ9B 4O2DA 4M78C 4K86A 1X01A 1K73U 1ZQ1A 2LTOA 4HT8A 3RACA 4WF2A 5C6SA 4DOVA 3IKMB 2XGTA 4C8QD 2DPPB 4M78E 2QI2A 4C8QA 4K88A 4P3NA 2X4WA 2DZCA 4M75F 3V8JA 3JB9I 5DLOA 4KQEA 2E70A 1HTTA 1UGQB 4BE0A 3OBWA 3G71A 4UP9A 3CCST 5LJ5g 4FU6A 2OTJA 4XTVA 4RCCA 1M1KU 1K73C 1Q86U 1VIFA 4ZN3A 2K5LA 4J7IA 1VQKA 2X4YA 2IY5A 4EDUA 5LJ3h 2E1HA 4BD3A 5CR2A 3VQWA 2CJ9A 1NYQA 3A8HB 4PJOB 1X6OA 3QDRB 2QEXA 2R57A 2C7IA 1N9WA 4M78G 4N4IA 3JCMP 3E9IA 1VQ5T 3S3MA 1M1KC 4HVCA 4MZTA 2D9TA 3TEGA 1JBMA 5CKHA 1QVGS 4XTXA 3X25B 2EJ9A 4RQFA 2P5IA 3DSQA 4H2XB 2RHXA 2M9UA 1BBUA 3HFOA 3HFZA 3IALA 3VQVA 5GAMe 2Y90A 1N8RC 5CKBA 2P4TA 3LWHA 2J3LA 2JVVA 3OYYA 1I5LA 2ODRC 1IREB 1JJCA 2DTHA 2XD0A 3F70A 2WSEE 4UPAA 1YJNA 1W4SA 2E5QA 4LVMA 4N0AC 3CBOA 1PSEA 5GMKi 3HXVA 1KD1U 2WSFE 3OYHA 3QYGB 1VQOT 3OS0A 2P0KA 3GP8A 3VYGA 1KHIA 4C5EA 1VIEA 2PU9B 4UP7A 1EIYB 3CCJA 4P73A 2I4MA 2JOYA 2ZTGA 4ELZC 5A0DA 2P0PA 4TQDA 2ZXFA 1Q7YU 5LJ5f 1QF6A 3HRTA 5DM7R 1N9SA 5I2SA 4J6YA 4XK8E 3GNFB 2CJAA 2C8MA 5LJ3e 1KD1C 2ZZDA 2QQSA 5LJ5j 3E9FA 1G5VA 5A0LA 4X34A 2E6ZA 2RH2A 3CC7A 4QVDA 3JCMb 5FRMA 2CZ1B 1SETA 4YRRA 3NEMA 2GQVA 3JAME 1HXDA 1S72T 3PMTA 4P72A 1LYLA 3JB9H 4KUDK 2EL9A 3CC4T 3NTKA 3M4PA 2DEQA 4QVZA 4M77D 5C52B 4OB1B 4M77A 1M5Q1 4LDXA 2RHQB 4H2UA 2QQAA 2JZ2A 1PSFA 4RMFA 4M7AC 4PG3A 3IKLA 5AYFA 4MZPA 3P8HA 5A0GA 3P8TA 4HWSA 1VQ8A 4J5YA 4M78D 1IL2A 1KQ2A 4M7AE 3OMGA 2KMTA 3MP8A 2G4CA 1U1TA 3DB3A 4M7AF 3PCOA 2EQKA 2I4OA 3SD4A 3RGLA 2EYQA 5ELNA 3HP9A 2LCCA 3E9GA 4Q15A 2EQMA 4YRLA 4IKFA 4FSXA 4BI3A 4UP8A 2CZ0B 3UGTA 3FJPA 4MMKA 1YHQT 4PLLA 1H3ZA 4J15A 1NJ8A 3J7AF 1WYDA 2Q7HA 5GAOl 4RKUE 5CAIA 3A8MB 2KSSA 4LVJA 4L87A 3RKYA 2XI9A 2P0QA 3OYFA 3OYNA 2PMFA 4M7AG 3A7UA 2QHUA 3REXA 2ALYB 3M9QA 1YJWT 4QQDA 1KOGA 2V8IA 4Z02A 3CCSA 2PVDB 2XU8A 2ZPHB 2EQUA 1X75C 3CXCA 1WLEA 5GAMg 2E5AA 4LVLA 4V2SA 1HC7A 1O75A 2DIGA 4TTVA 4LVKA 1AHJB 2RHYA 1USYA 2OTJT 4TVAA 3L2ZA 2DXUA 3LWIA 5GANf 4C0DB 1YFSA 4NCXA 1Z7NA 2KQWA 2Y4YA 4C8QC 1VQKT 3OY9A 3S3NA 4H2YA 4ZTZB 1KQSA 3OYIA 4YCUA 4QW2A 3SWNA 5GANj 3QNEA 1NJIC 2KY9A 2XICA 3CBPA 1EQRA 4E7KA 4LDYA 5CO7A 3QXEB 4C5IA 4C8QE 5FU7B 4BW9A 4G85A 2ODRD 3M58A 3SB2A 4HCZA 4C8QF 1KHCA 1K8AU 4LNSA 2K3YA 1QP2A 5GAN8 5HK3A 3QBYA 4II1A 1WQ7A 2QA4A 2ZT5A 3FB9A 3RERA 4TVWA 5CVIA 5LJ3g 1X54A 1EVKA 3CPFA 3KFUA 2E12A 1B70B 4EMHA 2RI5A 3QHSA 1JB0E 5GMKe 4HCCA 1NJ2A 4B9WA 2K5FA 2DTIA 2LC4A 2DXBA 2YHTA 1WJQA 1K8AC 5FU6B 3P8VA 1BI3A 3NTIA 2XG8D 4C8QG 3SDZA 2ZGWA 5LJ3d 2RJEA 3A5ZA 1EIFA 3MEAA 2FB7A 1Q82C 1NJ1A 3L42A 3HTZA 2AKWA 4BUGA 3OYKA 1ZBXA 3EFRA 3LYIA 2XDPA 3HFVA 4QVCA 4EMKB 3CCJT 2NLUA 1W2BA 5CKDA 3A31A 5GAMf 4M78B 4YRIA 2DO3A 4EO4A 3OYAA 3BDLA 4KUIA 4ZGEB 3LH0A 1W66A 2PVGB 1DJ7B 3OS5A 1VQ7A 3DB4A 1VQZA 1QVFA 1N9RA 2RK1A 3LGFA 2PVOB 3CC7T 2EWNA 3CC4A 4P73C 3FEOA 1L0WA 2JTFA 1B8AA 3LSSA 5D6YA 3MF1A 3VJPA 1FWZA 4XTWA 4E51A 3JSCA 4ZN1A 2PUOB 4C0GA 3FDRA 3H6ZA 4EMGA 3LC0A 4YRSA 5K1XA 3OB9A 3GPLA 3M55A 4AH6A 2E10A 4OGEA 3P8DA 2FHDA 2KAFA 3TCJA 1M9SA 3TEHB 1B34A 1QE0A 4M77C 2DVEA 5HKCA 2AMCB 5CKEA 4CS3A 2BKDN 4XU3A 2K5IA 2VGMA 3V8LA 4C92C 2BIVA 1Y96A 1M1GA 1E1OA 4A4KA 4M77E 5I21A 1QP3A 4JJNK 3CCQT 5GAOq 1N6AA 3M4YA 1U8RA 2LQKA 3RIRA 4ZTJA 1I81A 5L8RE 4M77F 3QPHA 3HKSA 4D6WA 3URGA 4YRMA 5E3IA 2X4XA 1WQWA 2O4XB 3QIIA 3S6WA 1UGSB 1YJWA 2L3RA 3M56A 5F5WA 1KQ1A 1EOVA 1WJSA 4M7DD 3CXCS 3R6OA 4M7DA 3PTAA 3HY1A 4M78F 4MMLA 3WXMB 1ATIA 4P5NA 4IUVA 5DY9A 3E9HA 2C06A 4M77G 3H8ZA 2GCXA 3BDUA 3HL8A 3DLLA 1TH7A 1VQPA 1KQSS 3L1AA 1NYRA 4H02A 4TVRA 2XTIA 1I4K1 3NTHA 4XTZA 3A5ZB 3FRNA 3KBGA 3Q1JA 3G4SA 1UGPB 1YITA 3M59A 3CC2A 5GAOp 2LCLA 4A4HA 1JJ2A 1N8RU 1VUBA 1USYC 3CMAA 4YROA 4C5HA 3A74A 3JCMh 4ZIBA 3RL6A 3PFSA 4GLKA 1PYSA 4X9CA 1NE8A 1B7YB 3QO5A 3A7AA 3VU3C 3SWNC 2P0LA 4C5GA 2QA4T 1KMMA 2PMEA 4GY5A 2LQ8A 3T9NA 4MZMA 3M53A 2M16A 4M7AB 2FL7A 2RHSB 3HXWA 4H2WA 3CEYA 4BDZA 5I2MA 4MDXA 5GAN3 3OSSC 1YI2A 2HQEA 2CZ6B 3HXXA 5HY6A 1IZ6A 4XU2A 3QSUA 4OB2B 2YLCA 3I55A 3ICAA 4JLGA 1G3YA 1YCYA 1W2BS 2Q7GA 3FIFA 4E47A 2DK3A 4BY6C 3WVDB 2ZZGA 1WPYA 3C12A 3RKWA 2EIFA 1QVFS 2NS6A 3L4GA 1G51A 2VGNA 2EJGA 3META 4WJ4A 1VQ9A 5GMKj 2F5KA 5CCAA 4EX5A 2M1HA 3L2WA 1VQ7T 5J26A 5GAN6 4BACA 2OTLA 3OBYA 3LSQA 5D6XA 3MCAB 2MMPA 4RG2A 4PJOC 2I2LA 1FYFA 3E1SA 2RHZA 2RM4A 3S3OA 2AHJB 2DU5A 1LNXA 2VV5A 4FM4B 5GAN5 3UT1A 2DD5A 4C92D 2ZNIA 3HHTB 3QO3A 4C92A 3RMQA 1KG1A 4C8QB 2XIDA 1D3BA 4G84A 1H641 4E7JA 2RJDA 5C0MA 2F69A 2ZPEB 2CJBA 4BE2A 1X2GA 3RESA 4ME7A 2J3MA 3X28B 4P3OA 1SESA 2GFUA 3GNGA 2QDYB 4JS4A 4KBMB 2DXTA 4YRGA 4IUPA 2QQRA 4M75D 2LT4A 4XU0A 2QQ9A 2KK4A 4M75A 2IY5B 4A54A 3UGQA 4IUUA 1VQ4A 3HSBA 3CCQA 4LDVA 4WJ3M 4J6WA 1C0AA 3CCUT 1VQ6A 3HY0A 2E6NA 3FC3A 3BW1A 3CD6A 2B8AA 3OYGA 3I56A 4YTLA 5IT9E 1E1TA 2MWPA 5LJ5h 3MEUA 5KH6A 4Q6GA 5LL6S 4RG8A 4HWRA 1KC8U 4F7UA 2K57A 2ZIOA 3O8VA 3R07A 5GAOn 3HFZB 3N5BB 1NJIU 3E19A 2XK0A 3HXYA 4H2TA 4XU1A 1YGBA 3LW5E 3QUIA 3HFNA 4ZTUB 1ADJA 1BKBA 4YRJA 4DPGA 4OP0A 2K2VA 3ZFJA 4CH6A 3QJ6A 2RA2A 3NETA 1JJCB 1RIQA 3HRIA 4ZGDB 1VQPT 2EQJA 1KC8C 1FX7A 2MF2A 3I7FA 5C53B 4M7DC 4JUVA 4HWPA 1JJ2S 3G4ST 1YITT 1EVLA 3CC2T 2E65A 3UPUA 4DOWA 1V29B 3OA6A 3JB9D 2L8DA 1NNHA 4QQ6A 2VUBA 3CMAT 3RF1A 4M7DE 11ASA 2E3CA 3MF2A 4NL2A 1KMNA 1BI1A 4HT4A 2RJFA 3MEYA 4M7DF 2H3JA 5GAN2 4LD6A 4XEOA 5KE3A 1Q82U 4WI1A 2G3RA 3MQZA 4X5OA 1OYXA 4PL6A 2CIMA 1NZ9A 2EFIA 2XKOC 2DU7A 1H4VB 4PLIA 3LLRA 1YJ9A 3QZ5B 5GMKm 4BDYA 3MEWA 1YI2T 4UC4A 4HT9A 3JCMJ 4M77B 2OAUA 3M4GA 3PMIA 1BI2A 4RQEA 3DKMA 2DKGA 1Y07A 4ATOA 1HK9A 2X4JA 3OSVA 3JRZA 4M7DG 1NPPA 3CCMA 5FROA 2ZPGB 3BJUA 2ZT8A 2ZNJA 2L89A 3I55T 4FT2A 2QHTA 3CCVA 1EFWA 4JRQA 2LX9A 4YREA 3TU4K 3QO8A 4A4GA 4PJOD 3ME9A 3JCMd 4PJOA 4RDXA 2X35A 2CZ7B 2ZT6A 4TQFA 5GANh 2R5MA 2ZT7A 3G6EA 4YRTA 3PCOB 2VXEA 5GAMj 1NPRA 1BBWA 4LVIA 4JRIA 5GAN7 4L5GA 1VQ9T 3J80E 4H2XA 3PT9A 2LVMA 2OTLT 3ASKA 4Y28E 3TUPA 3A8OB 3G1ZA 4YP0A 2KDSA 3NELA 2EJFA 1FXXA 5CKFA 5C51B 3J81E 4YRFA 4HKEA 5KE2A 1JRIA 4YPFA 2R5AA 1Q81C 4HCBA 3CCLA 3HPWA 2ZR2A 4BE1A 2I4LA 2KVQG 2ZCFB 1P92A 1VQMA 3QTCA 2E41A 5DLQE 2ZCEA 5LJ3f 1WJRA 3V8KA 3VUBA 4XAXB 2CYZB 3OS2A 2ZZEA 4FT4A 1U1SA 1I8FA 2D0QB 3CPWA 4KT0E 4P71A 5LJ3j 4TVAB 1EIYA 2Y4XA 5D6WA 3SWNB 3CCUA 1VQ4T 2K3XA 4P74A 1G3SA 2XDDA 1R8OB 2QQBA 3V7CA 4C92E 1YIJT 3LX7A 2A7YA 1VQ6T 3OQ5A 3MP1A 3BY7A 4OLFA 3KUFA 3CD6T 2R58A 2RK2A 4VUBA 4YYEA 4C92F 4M75C 3I56T 1M90C 5HGQA 3PIOA 4OF1A 1J5WA 1O9SA 3A8GB 4OB3B 3OW2A 2HAXA 2A8EA 4M75E 2MWOA 3GLXA 2RHQA 3GF5A 4L59A 4CI0C 2JNGA 1WGSA 1VQLT 3P8YA 4A4EA 4CS4A 3VKIA 3L2QA 4TWAA 4C92G 1VQNA 4BY6B 2JUFA 1OZ3A 3C4SA 3QJYA 4YDQA 1WNLA 3LGLA 3CCRA 5IN1A 3V7SA 1BIAA 4F7UE 1BYMA 2AKWB 3P8BB 4BI4A 1H4TA 5HK0A 1X55A 3HXUA 1Z7MA 3UDCA 2IVWA 5LJ5d 4M75G 4F7UF 3EAEA 2JTMA 3PIPA 2ARUA 3VV0A 3VQXA 2V8JA 4J83A 2QHSA 2RHUA 3WVEB 2VXFA 1XNIA 2QXFA 4R55A 1X56A 1Q86C 2Q5HA 4IUQA 1UB4A 12ASA 1XOVA 4ELYC 4H2VA 2ZIMA 3CMEA 2ALYA 1Y71A 2GFAA 3OS1A 2A3LA 2DD4A 4E7IA 1YJ9T 2RI3A 3CMQA 4R56A 5GAOr 4F7UG 3OMCA 3A5YA 3CCEA 4OMFB 4KR2A 5A2QE 3EFSA 4OVAA 3UFGA 2Q5IA 4YRPA 2RB6A 3A7RA 3CCMT 4JS5A 2WSCE 3KXTA 3JB9F 2LDMA 3V7RA 4OGCA 2MAMA 4HA8A 1YFRA 4LD9K 3CCVT 4CS2A 1RL2A 3C95A 4HWOA 3DLMA 3HXZA 1B34B 4YRQA 1ASZA 4BWAA 3JCMc 2RO0A 1NJ6A 2LRQA 1Y96B 3G6ET 4JRKA 3ZBDA 3L2RA 4N4HA 4ZGJB 1SRYA 3VQYA 4E7HA 4RCBA 3OYMA 4CH5A 3JB9G 3OYCA 3L2VA 3UH0A 4JLIA 2ARSA 3JCMe 1B70A 2I4NA 4CH4A 2BUDA 4KULA 4LDUA 2ZZFA 3A8LB 5CQXA 4PJOE 4N4GA 1M4ZA 3QKJA 5GANg 2XHCA 3CCLT 1Q7YC 4A4FA 1OI1A 4KR3A 3TREA 4PJOF 2DJZA 1B76A 5IAYA 1VQMT 4M7DB 3X26B 3CPWS 5GAOm 2V8KA 1YFTA 2FYKA 3WQZA 2PUKB 4JRPA 2QTXA 4YCVA 1QVPA 3UWNA 5GANd 1ASYA 4B9XA 2GF7A 4EMKA 4DA4A 2M0OA 1K9MU 3OYDA 4M78A 2RD1A 4L6V5 5CQYA 3JCMV 3PGGA 1YIJA 4PJOG 2JN0A 3W3SA 3G7ZA 2EKOA 2HBPA 4P3PA 4P71C 4Q5WA 2CGHA 4BB7A 2DQ0A 3HRKA 2L5QA 1PYSB 5GMKh 2LNVA 1K9MC 3MP6A 3AHUA 1XTDA 5EG2A 5J3BA 5KCHA 1GXIE 3OW2S 5ELOA 4YRNA 3MHXA 1BIBA 3RKXA 3PZCA 4P74C 1YBYA 1VQLA 5K1PA 2ARTA 4Y91A 3VYHB 1Y7XA 2HQXA 4P75C 3C94A 3SFMA 2LT1A 2IG0A 1QW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAM j;  4J6Y A;  5DY9 A;  3VBB A;  3E9H A;  2CJA A;  1BBW A;  4JRI A;  4M77 G;  5LJ3 e;  5GAN 7;  2C8M A;  3BDU A;  5LJ5 j;  4H2X A;  3TEH A;  4A53 A;  1TH7 A;  3L1A A;  1NYR A;  4QVD A;  1E24 A;  3JCM b;  4H02 A;  2XTI A;  3TUP A;  2AMC A;  1I4K 1;  3QO7 A;  1SET A;  4YRR A;  3G1Z A;  3NEM A;  1HXD A;  4YP0 A;  4XTZ A;  4P72 A;  1LYL A;  3JB9 H;  1WU7 A;  3NEL A;  2EJF A;  2EL9 A;  5C51 B;  4YRF A;  1JRI A;  4YPF A;  1MGQ A;  2E64 A;  3M4P A;  1G5H A;  5GAO p;  2DEQ A;  1E22 A;  2ZR2 A;  4M77 D;  3GIB A;  2I4L A;  1H4Q A;  5C52 B;  4M77 A;  1M5Q 1;  1LJO A;  5GAM d;  1USY C;  4YRO A;  2RHQ B;  4H2U A;  3QTC A;  3A74 A;  3JCM h;  2E41 A;  4ZIB A;  1X2H A;  4RMF A;  4M7A C;  2ZCE A;  1M8V A;  5LJ3 f;  1PYS A;  4X9C A;  1NJ5 A;  3RL6 A;  3V8K A;  2ZR3 A;  1B7Y B;  4PG3 A;  3IG2 A;  3QO5 A;  3IKL A;  2HNI A;  4TVY A;  3A7A A;  3L4G B;  2ZZE A;  1U1S A;  1I8F A;  3VU3 C;  3P8T A;  4HWS A;  3SWN C;  2P0L A;  1KMM A;  2PME A;  4P71 A;  3INZ A;  4J5Y A;  2QHV A;  5LJ3 j;  4TVA B;  4M78 D;  1IL2 A;  1KQ2 A;  1EIY A;  4M7A E;  4N0A A;  4M7A B;  2G4C A;  3HXW A;  2RHS B;  4X9D A;  3JCM Q;  2EAY A;  4H2W A;  1U1T A;  3M4Q A;  4J6X A;  3JCM g;  4M7A F;  3PCO A;  5LJ5 e;  2I4O A;  5GAN 3;  3SWN B;  3RGL A;  5ELN A;  3HXX A;  4P74 A;  4Q15 A;  4YRL A;  4XU2 A;  3V7C A;  4C92 E;  4UP8 A;  3QSU A;  4XTU A;  4C92 B;  3UGT A;  3FJP A;  4MMK A;  4YCW A;  3BY7 A;  4OLF A;  1D3B B;  2YLC A;  4J15 A;  1NJ8 A;  3ICA A;  4NOY A;  4YYE A;  4C92 F;  4M75 C;  1WYD A;  2Q7H A;  5GAO l;  5CAI A;  5HGQ A;  4PNO A;  1GGM A;  1G5I A;  2DQ3 A;  5GAN 4;  4L87 A;  3JB9 J;  1YCY A;  2YLB A;  3RKY A;  1J5W A;  4XTY A;  2Q7G A;  3FIF A;  3ERR A;  2PMF A;  4M7A G;  3A7U A;  4K87 A;  2QHU A;  3REX A;  4M75 E;  2ALY B;  2RHQ A;  2DTO A;  4M75 B;  1KOG A;  3REU A;  2ZZG A;  1WPY A;  3RKW A;  1B7Y A;  3P8Y A;  3L4G A;  1G51 A;  4DQ2 A;  5GMK l;  2EJG A;  5GAM g;  1WLE A;  2E5A A;  2ZIN A;  4CS4 A;  4NL3 A;  4WJ4 A;  4V2S A;  5GMK j;  1HC7 A;  4TTV A;  4EX5 A;  4TWA A;  4C92 G;  1USY A;  5GAN 6;  4TVA A;  3L2Z A;  2DXU A;  3LSQ A;  4XEM A;  5GAN f;  3RUX A;  4M7A D;  1YFS A;  4NCX A;  1Z7N A;  4M7A A;  4PJO C;  3JCM X;  2RHS A;  2I2L A;  4YDQ A;  4C8Q C;  1WNL A;  1FYF A;  4H2Y A;  4HWT A;  1LOJ A;  4ZTZ B;  2RM4 A;  3V7S A;  4YCU A;  1BIA A;  3SWN A;  5GAN j;  3A32 A;  4F7U E;  2AKW B;  1LNX A;  3QNE A;  2DU5 A;  4F7U B;  1H4T A;  1EQR A;  3BFM A;  5GAN 5;  1X55 A;  3HXU A;  4C92 D;  2ZNI A;  1Z7M A;  3QO3 A;  4C8Q E;  4C92 A;  5LJ5 d;  4YRK A;  4M75 G;  4BW9 A;  4F7U F;  4C8Q B;  1D3B A;  4G84 A;  1H64 1;  4G85 A;  2ODR D;  2ARU A;  3OD1 A;  1H4S A;  3VQX A;  3SB2 A;  2CJB A;  4C8Q F;  2QHS A;  2VC8 A;  4LNS A;  1X2G A;  2VXF A;  5GAN 8;  4CH3 A;  3RES A;  1WQ7 A;  2ZT5 A;  1X56 A;  2J3M A;  4P72 C;  3FB9 A;  4P3O A;  1SES A;  2Q5H A;  3RER A;  4TVW A;  12AS A;  2DXT A;  5KNN A;  5LJ3 g;  1X54 A;  3JCM f;  1EVK A;  4H2V A;  2ZIM A;  4YRG A;  3KFU A;  2DZ9 A;  4PHC A;  1SER A;  4YRC A;  2ALY A;  4M75 D;  4XU0 A;  1B70 B;  4M75 A;  4EMH A;  1YB3 A;  1ADY A;  3QHS A;  2IY5 B;  5GMK e;  2DDZ A;  1NJ2 A;  4A54 A;  4H2S A;  3UGQ A;  3CMQ A;  3HSB A;  5GAO r;  4F7U G;  2Q7E A;  2DTI A;  3A5Y A;  2YHT A;  4KR2 A;  4WJ3 M;  3NEN A;  3EFS A;  4J6W A;  3P8V A;  1C0A A;  3JCM W;  3UFG A;  4P75 A;  4C8Q G;  3HY0 A;  2Q5I A;  2ZGW A;  5LJ3 d;  4YRP A;  5GAM h;  3A5Z A;  4XQ3 A;  2RB6 A;  3A7R A;  3BW1 A;  4EMK C;  5GAN e;  3JB9 F;  2FB7 A;  3V7R A;  4O2D A;  1E1T A;  4M78 C;  4K86 A;  5LJ5 h;  4HA8 A;  1NJ1 A;  1YFR A;  3HTZ A;  4Q6G A;  1X01 A;  4CS2 A;  2AKW A;  4HWR A;  4F7U A;  2K57 A;  3EFR A;  4HWO A;  2ZIO A;  4HT8 A;  3RAC A;  3HFV A;  4WF2 A;  4QVC A;  3HXZ A;  3IKM B;  5GAO n;  1B34 B;  4EMK B;  3HFZ B;  3R07 A;  4YRQ A;  1ASZ A;  2XGT A;  4C8Q D;  4BWA A;  3JCM c;  4M78 E;  4C8Q A;  4K88 A;  3A31 A;  5GAM f;  4P3N A;  4M78 B;  4YRI A;  2DZC A;  4M75 F;  3V8J A;  3HXY A;  3JB9 I;  4H2T A;  4XU1 A;  1YGB A;  4EO4 A;  4ZTU B;  3QUI A;  3HFN A;  1NJ6 A;  4KQE A;  1ADJ A;  1HTT A;  1Y96 B;  4YRJ A;  4DPG A;  4OP0 A;  1W66 A;  4JRK A;  4UP9 A;  1SRY A;  3VQY A;  4CH6 A;  5LJ5 g;  4RCB A;  2RA2 A;  3NET A;  4CH5 A;  1JJC B;  3JB9 G;  1RIQ A;  1VQZ A;  3HRI A;  1N9R A;  4XTV A;  4RCC A;  2EWN A;  3UH0 A;  4JLI A;  2ARS A;  4P73 C;  3I7F A;  3JCM e;  1B70 A;  1L0W A;  2I4N A;  4CH4 A;  1B8A A;  5C53 B;  4M7D C;  3LSS A;  2IY5 A;  4JUV A;  2ZZF A;  4HWP A;  5LJ3 h;  2E1H A;  3MF1 A;  1EVL A;  3VQW A;  4PJO E;  4XTW A;  2E65 A;  1NYQ A;  2CJ9 A;  5GAN g;  4E51 A;  4PJO B;  3JB9 D;  4KR3 A;  1NNH A;  4EMG A;  2C7I A;  3LC0 A;  4YRS A;  5K1X A;  4M78 G;  2DJZ A;  4PJO F;  3JCM P;  4M7D E;  1B76 A;  1N9W A;  3E9I A;  3RF1 A;  11AS A;  4AH6 A;  2E3C A;  3MF2 A;  4M7D B;  4NL2 A;  1KMN A;  5GAO m;  2E10 A;  1YFT A;  2FYK A;  3WQZ A;  4HVC A;  3MEY A;  4M7D F;  3TEG A;  5GAN 2;  2QTX A;  4YCV A;  4XEO A;  1JBM A;  4XTX A;  2EJ9 A;  5GAN d;  4WI1 A;  4X5O A;  4RQF A;  2P5I A;  3DSQ A;  4H2X B;  1ASY A;  3TEH B;  2CIM A;  1BBU A;  3HFO A;  3HFZ A;  1B34 A;  4EMK A;  1QE0 A;  4M77 C;  2DVE A;  2AMC B;  3IAL A;  2DU7 A;  1H4V B;  4M78 A;  4CS3 A;  4XU3 A;  3V8L A;  2RD1 A;  3VQV A;  4C92 C;  5GAM e;  2Y90 A;  3JCM V;  1Y96 A;  5GMK m;  3PGG A;  4PJO G;  1E1O A;  2JN0 A;  2J3L A;  3W3S A;  1I5L A;  2ODR C;  4M77 E;  5I21 A;  1JJC A;  4HT9 A;  4P3P A;  2DTH A;  3JCM J;  4P71 C;  4M77 B;  3M4G A;  4RQE A;  2DKG A;  4UPA A;  2CGH A;  5GAO q;  2DQ0 A;  1HK9 A;  4M7D G;  3HRK A;  3RIR A;  2ZT8 A;  1I81 A;  4N0A C;  4M77 F;  3BJU A;  1PYS B;  2ZNJ A;  5GMK h;  5GMK i;  3HXV A;  3AHU A;  4YRM A;  5E3I A;  2QHT A;  1EFW A;  4YRE A;  1WQW A;  3QO8 A;  4PJO D;  5ELO A;  4YRN A;  3JCM d;  1BIB A;  4PJO A;  3RKX A;  4RDX A;  3PZC A;  4P74 C;  4UP7 A;  5F5W A;  1EIY B;  1KQ1 A;  1EOV A;  4P73 A;  2I4M A;  2ZTG A;  5K1P A;  4M7D D;  2ZT6 A;  2ART A;  4Y91 A;  5GAN h;  4TQF A;  4TQD A;  2ZXF A;  4M7D A;  2ZT7 A;  5LJ5 f;  3HY1 A;  4M78 F;  4MML A;  4P75 C;  1QF6 A;  1ATI A;  4YRT A;  3PCO B;  2VXE A;  1N9S A; 
#chains in the Genus database with same CATH topology
 5J39 A;  3M5A A;  2K4Y A;  2EYY A;  1UEB A;  3VBB A;  4PFP A;  1PCX A;  1ZLM A;  1VQN T;  3CCQ Q;  3TEH A;  4A53 A;  3G71 T;  4BI8 B;  4MDW A;  2RJC A;  1KK7 A;  3A1P A;  1ZUU A;  1E24 A;  2OI3 A;  2VYT A;  2AMC A;  3QO7 A;  2MI6 A;  3MPU B;  2M0Y A;  4K11 A;  1AWJ A;  2WAC A;  3CD6 Q;  1WU7 A;  1WA7 A;  3PNW C;  4D8K A;  3CCR T;  1W6X A;  4J7F A;  4E7L A;  1HSQ A;  2NUT B;  1MGQ A;  2E64 A;  1G5H A;  4IUT A;  1FMV A;  1E22 A;  1N27 A;  2XDB A;  1K8A R;  3GIB A;  1H4Q A;  5GAM d;  1LJO A;  2KI7 A;  2DM1 A;  3MEV A;  1YWP A;  1OPK A;  1VQ5 A;  3MKD A;  2P4R A;  4O6J A;  2QEX T;  1X2H A;  4IUR A;  2ZAE A;  3OYB A;  1M8V A;  1NJ5 A;  4JDS A;  1KSW A;  2ZPB B;  2ZR3 A;  3TEE A;  1SHG A;  3IG2 A;  4O5V A;  2HNI A;  4TVY A;  1V76 A;  4OMP A;  1RI0 A;  3L4G B;  4RTW A;  3RMS A;  4FL6 A;  1G3W A;  1D09 B;  2O4X A;  3QYH B;  3INZ A;  2QHV A;  1E6H A;  3GOX A;  4ORZ A;  2DET A;  3EH2 A;  5FLX E;  4N0A A;  1QVG A;  4J9C A;  2EKH A;  3CME T;  4X9D A;  3JCM Q;  2EAY A;  3HRS A;  3M4Q A;  4J6X A;  3JCM g;  3NGP A;  1PNJ A;  2YUP A;  5LJ5 e;  2EGC A;  2RQR A;  2ENM A;  3C0C A;  1WHH A;  3ZEH A;  3PVQ A;  3CCE T;  4XTU A;  4C92 B;  3OYE A;  3FLG A;  4AG1 C;  4Z8A A;  4YCW A;  1D3B B;  1GL5 A;  3MO8 A;  1PG5 B;  4J9E A;  4NOY A;  8ATC B;  3OYL A;  1YJN T;  2QK0 A;  5IHI A;  2RI2 A;  4PNO A;  1VQO A;  1GGM A;  1G5I A;  2DQ3 A;  4RTZ A;  1WIE A;  5GAN 4;  2HL3 A;  3JB9 J;  2PQW A;  3G1J A;  2QA4 Q;  2YLB A;  5CIU A;  4XTY A;  1GBR A;  1TTH B;  2QGF B;  1EZZ B;  2CKK A;  2ROT A;  4OB0 B;  3ERR A;  3OYJ A;  3VUZ A;  4LXC A;  4K87 A;  1Q81 U;  4C0Z A;  4HVW A;  2ZPI B;  4LDW A;  2DTO A;  2DER A;  2GQI A;  4M75 B;  4EPC A;  5M9O A;  4C0D C;  3REU A;  1AOJ A;  4NS5 A;  1QCN A;  4RMO A;  1JXM A;  1B7Y A;  2CT4 A;  2OAW A;  2DXC A;  4C0F A;  4HVU A;  4DQ2 A;  5GMK l;  4E7S A;  2ZIN A;  2J05 A;  4NL3 A;  5KYU B;  2CS7 A;  3X20 B;  1OZ2 A;  2HQH A;  2A36 A;  2LP5 A;  5FRN A;  4CRI A;  1T0J A;  2HKN A;  2O01 E;  5I22 A;  1SG5 A;  2C0O A;  3HRU A;  1G3T A;  4XEM A;  3RUX A;  4M7A D;  2DX1 A;  1M1F A;  3MJX A;  1SSF A;  3M0Q A;  4M7A A;  3JCM X;  2RHS A;  1JO8 A;  5FU7 C;  1S72 A;  2RHI A;  4J8O A;  4HWT A;  1LOJ A;  2AK5 A;  2FVU A;  3X24 B;  1ZSZ B;  5KCO A;  1ZHI A;  2VB6 A;  3A32 A;  3CBM A;  1XQH A;  1IRX A;  4F7U B;  1OX9 A;  2SEM A;  3BFM A;  4IIM A;  3QG1 A;  3EH1 A;  1B07 A;  5EC7 A;  4YRK A;  3D7S B;  2ZPF B;  4PKC C;  2DRM A;  5IHN A;  2C0I A;  2Z0W A;  2DLP A;  2LQW A;  3OD1 A;  1GBQ A;  1H4S A;  4LUD A;  2YRV A;  2D6F A;  3NFC A;  3M57 A;  1SRM A;  2VC8 A;  2DF6 A;  3EGD B;  4CH3 A;  4P72 C;  1VQ7 Q;  1M90 U;  5CK9 A;  2J7I A;  1J3T A;  4PFO A;  5KNN A;  2FPF A;  1LVK A;  4ZTF A;  5FU6 C;  3JCM f;  1TUG B;  2DZ9 A;  4PHC A;  1SER A;  4QQG A;  4YRC A;  1VQ8 T;  1X6B A;  2PTK A;  1VYV A;  1YB3 A;  1GFC A;  3IQL A;  1ADY A;  1U5S A;  3ER0 A;  2DDZ A;  1ABQ A;  4H2S A;  2AKK A;  1UG1 A;  2A0F B;  3M54 A;  2Q7E A;  4FIB A;  2O9V A;  1K73 R;  3NEN A;  2DL5 A;  1WHM A;  2HD0 A;  1MHN A;  1UHF A;  3JCM W;  4P75 A;  1UGR B;  3CCL Q;  4E2F B;  1YHQ A;  1BI0 A;  5GAM h;  4XQ3 A;  4EMK C;  2F5T X;  2DIQ A;  4AFS C;  2DAQ A;  5GAN e;  3L2U A;  3QZ9 B;  4O2D A;  4M78 C;  2VWF A;  2DL4 A;  4K86 A;  2L2P A;  1WDX A;  2HEQ A;  1X01 A;  4FYV B;  1K73 U;  1RAI B;  2QAZ A;  2A37 A;  2FPE A;  1ZQ1 A;  2LTO A;  4HT8 A;  3RAC A;  4WF2 A;  5C6S A;  4DOV A;  3IKM B;  2XGT A;  4C8Q D;  2DPP B;  1M1K R;  4M78 E;  2QI2 A;  4C8Q A;  4K88 A;  2CUB A;  1QQJ A;  4P3N A;  2X4W A;  2DZC A;  4M75 F;  3V8J A;  3JB9 I;  5DLO A;  4KQE A;  2DYI A;  2E70 A;  1HTT A;  1UGQ B;  9ATC B;  2H3E B;  4BE0 A;  3OBW A;  3G71 A;  4UP9 A;  3CCS T;  4DBH A;  5LJ5 g;  2X51 A;  1RAG B;  4FU6 A;  3CCU Q;  2RN8 A;  2K79 A;  2OTJ A;  4XTV A;  2LX7 A;  4RCC A;  1WX6 A;  1M1K U;  1K73 C;  2V1R A;  1AZG B;  1Q86 U;  2J6O A;  1VIF A;  4ZN3 A;  2K5L A;  4J7I A;  3HTR A;  4CC7 A;  1N8R R;  1VQK A;  4QKU A;  2X4Y A;  1PC0 A;  2IY5 A;  4EDU A;  5LJ3 h;  2E1H A;  4BD3 A;  5CR2 A;  3VQW A;  2J6K A;  2CJ9 A;  4LUE A;  1NYQ A;  3A8H B;  4PJO B;  1X6O A;  3TSZ A;  3QDR B;  2QEX A;  2R57 A;  1PRM C;  2C7I A;  3VS4 A;  4M78 G;  4N4I A;  3JCM P;  1N9W A;  3E9I A;  1SEM A;  1I5O B;  1VQ5 T;  2K3B A;  3S3M A;  2HKQ B;  1M1K C;  1RAD B;  2X3X D;  1KQS P;  4HVC A;  4MZT A;  2D9T A;  3TEG A;  4AT1 B;  1JBM A;  1WHK A;  5CKH A;  1QVG S;  4XTX A;  3X25 B;  2EJ9 A;  4RQF A;  3ULR B;  2P5I A;  3DSQ A;  4H2X B;  2RHX A;  1X69 A;  2M9U A;  1VQP Q;  3HFO A;  1BBU A;  3HFZ A;  3EG2 A;  3IAL A;  2DBK A;  3VQV A;  4JPB W;  5GAM e;  2Y90 A;  3G4S Q;  1PD0 A;  1N8R C;  5CKB A;  1KD1 R;  2P4T A;  1B7T A;  3CC2 Q;  3LWH A;  2J3L A;  2JVV A;  3OYY A;  2YUQ A;  1C1A A;  1I5L A;  2ODR C;  1IRE B;  1R0B G;  1VYU A;  1JJC A;  2DTH A;  2JJ9 A;  1C0M A;  1ABO A;  2XD0 A;  3F70 A;  2WSE E;  1MUZ A;  4UPA A;  1W4S A;  1YJN A;  2E5Q A;  2JM8 A;  2YDL A;  4LVM A;  1KJW A;  4N0A C;  1ZUK A;  3CBO A;  1PSE A;  5GMK i;  3HXV A;  1KD1 U;  2WSF E;  1ZUY A;  3OYH A;  1FMK A;  3QYG B;  1VQO T;  3OS0 A;  2P0K A;  3GP8 A;  3VYG A;  1KHI A;  4C5E A;  1I0C A;  1K1Z A;  1VIE A;  2A28 A;  2PU9 B;  4UP7 A;  4RTV A;  1EIY B;  3CCJ A;  4P73 A;  2I4M A;  2JOY A;  2ZTG A;  2FPD A;  4ELZ C;  5A0D A;  2P0P A;  2JTE A;  4TQD A;  2ZXF A;  1WXU A;  1Q7Y U;  1B3Q A;  5LJ5 f;  1K76 A;  1YWO A;  2OJ2 A;  2KT8 A;  1QF6 A;  3PE0 A;  3HRT A;  4KGV B;  5DM7 R;  1N9S A;  5I2S A;  4PJM A;  2RPN A;  2BE7 D;  4J6Y A;  4XK8 E;  3GNF B;  2FZK B;  2CJA A;  2C8M A;  2VAS A;  5LJ3 e;  1KD1 C;  2ZZD A;  2QQS A;  5LJ5 j;  3E9F A;  1G5V A;  5A0L A;  4X34 A;  3H0H A;  2E6Z A;  2RH2 A;  3CC7 A;  4QVD A;  3JCM b;  5FRM A;  2CZ1 B;  1SET A;  4YRR A;  3NEM A;  2GQV A;  3JAM E;  3UAT A;  1HXD A;  1S72 T;  3PMT A;  4P72 A;  1BB9 A;  1LYL A;  3JB9 H;  4KUD K;  2EL9 A;  3CC4 T;  3SEM A;  5IXB A;  3NTK A;  1Y0M A;  3M4P A;  2DEQ A;  1QVF P;  4QVZ A;  4AFU C;  4M77 D;  5C52 B;  4OB1 B;  4M77 A;  1M5Q 1;  4LDX A;  2RHQ B;  4H2U A;  2QQA A;  2JZ2 A;  1PSF A;  4RMF A;  4M7A C;  2ESW A;  1EFN A;  4PG3 A;  3IKL A;  1NYF A;  1QLY A;  5AYF A;  2MIO A;  4MZP A;  3P8H A;  3M0R A;  5A0G A;  3P8T A;  4HWS A;  1ZA2 B;  3EGX A;  5FW9 A;  1IB8 A;  1G2B A;  1VQ8 A;  4J5Y A;  4M78 D;  1IL2 A;  1KQ2 A;  2OTL Q;  4M7A E;  2MOX A;  3OMG A;  2KMT A;  3MP8 A;  2G4C A;  1U1T A;  3DB3 A;  4M7A F;  3PCO A;  2EQK A;  2I4O A;  3SD4 A;  3RGL A;  2EYQ A;  5ELN A;  3HP9 A;  2LCC A;  3E9G A;  4Q15 A;  2EQM A;  1WHJ A;  4YRL A;  3CPW P;  4IKF A;  3M0P A;  4FSX A;  4BI3 A;  4UP8 A;  2CZ0 B;  1ZBJ A;  1QCF A;  3UGT A;  4RTY A;  2KRO A;  3FJP A;  4MMK A;  1YHQ T;  4J9I A;  4PLL A;  3NPF A;  3I5R A;  1H3Z A;  4OML A;  4J15 A;  1NJ8 A;  1RAC B;  3J7A F;  1WYD A;  2Q7H A;  2MPX C;  5GAO l;  4RKU E;  1NJI R;  1WXB A;  5CAI A;  3A8M B;  2KSS A;  4LVJ A;  3EHQ A;  4L87 A;  3RKY A;  5IHK A;  1X6G A;  1T0H A;  2P0Q A;  2XI9 A;  3OYF A;  3OYN A;  2KBT A;  2CUD A;  2PMF A;  1NBE B;  4M7A G;  3A7U A;  2QHU A;  3REX A;  4RTU A;  2ALY B;  1VOM A;  3M9Q A;  1YJW T;  4HVV A;  4QQD A;  6AT1 B;  1KOG A;  2V8I A;  1ACM B;  1YNZ A;  4Z02 A;  4RUG A;  3CCS A;  2PVD B;  2XU8 A;  2ZPH B;  1E7O A;  1PKT A;  2GGR A;  2EQU A;  1X75 C;  1VQ4 Q;  2AT1 B;  2RMO A;  3CXC A;  1WLE A;  5GAM g;  2E5A A;  3GBQ A;  4LVL A;  4V2S A;  1RLP C;  1HC7 A;  1O75 A;  2DIG A;  4TTV A;  4LVK A;  1AHJ B;  1YIJ Q;  2RHY A;  1USY A;  2OTJ T;  4TVA A;  3L2Z A;  2DXU A;  1VQ6 Q;  3LWI A;  5GAN f;  4C0D B;  1YFS A;  4NCX A;  2IIM A;  1Z7N A;  7AT1 B;  1WHG A;  2KQW A;  2Y4Y A;  4C8Q C;  4CC4 B;  2K9G A;  3I56 Q;  1VQK T;  3VRY A;  2BZY A;  3OY9 A;  3S3N A;  4H2Y A;  2DL3 A;  4ZTZ B;  1KQS A;  2O9S A;  3OYI A;  4YCU A;  3QDF A;  4QW2 A;  3SWN A;  4AFQ C;  5GAN j;  1NJI C;  3QNE A;  4F17 A;  2KY9 A;  2XIC A;  2CSI A;  2KT1 A;  1UEC A;  3CBP A;  1EQR A;  2X9H A;  4E7K A;  2ATC B;  4J9F A;  4LDY A;  5CO7 A;  3QXE B;  4C5I A;  4C8Q E;  5FU7 B;  4BW9 A;  5IXF A;  1Q82 R;  4G85 A;  2ODR D;  1GCQ C;  3M58 A;  1EX4 A;  1VQL Q;  3SB2 A;  2NWM A;  4HCZ A;  4C8Q F;  1KHC A;  5AT1 B;  1K8A U;  4LNS A;  2FRY A;  2K3Y A;  1QP2 A;  2L3Q A;  5GAN 8;  1M3B A;  5HK3 A;  3QBY A;  4II1 A;  1WQ7 A;  2QA4 A;  2ZT5 A;  1MMG A;  1Z9Q A;  3FB9 A;  1JJ2 P;  1QWF A;  3RER A;  4TVW A;  2J6F A;  5CVI A;  5GJV B;  5LJ3 g;  4RTX A;  1X54 A;  1EVK A;  3CPF A;  1K0S A;  5I11 A;  3KFU A;  5HCK A;  4KH0 B;  1AWW A;  2E12 A;  1B70 B;  4EMH A;  2RI5 A;  2O31 A;  2EYZ A;  3QHS A;  1JB0 E;  5GMK e;  4HCC A;  1TU0 B;  1NJ2 A;  1M27 C;  4B9W A;  2K5F A;  2DTI A;  1W70 A;  2LC4 A;  2DXB A;  2YHT A;  1WJQ A;  1X27 A;  4ZNX A;  1K8A C;  5FU6 B;  3P8V A;  2BE9 B;  1BI3 A;  3NTI A;  2XG8 D;  4C8Q G;  1OQK A;  3SDZ A;  2ZGW A;  5LJ3 d;  2RJE A;  1UHC A;  3A5Z A;  4DEY A;  1EIF A;  3MEA A;  2FB7 A;  2W0Z A;  1Q82 C;  3NMZ C;  3EFO B;  1S1N A;  1NJ1 A;  3L42 A;  1OX8 A;  3HTZ A;  2AKW A;  4BUG A;  4J9G A;  1IHV A;  3OYK A;  1ZBX A;  3VS3 A;  2YUN A;  2VVK A;  4IIO A;  2K2M A;  3EFR A;  1MMN A;  3LYI A;  2XDP A;  3HFV A;  4QVC A;  4EMK B;  3CCJ T;  2NLU A;  1W2B A;  5CKD A;  1NLP C;  3A31 A;  5GAM f;  4M78 B;  4YRI A;  2DO3 A;  3AT1 B;  1BCM A;  2DIL A;  2QTV A;  4EO4 A;  1MND A;  2HZY A;  2KRN A;  3OYA A;  3BDL A;  4KUI A;  4ZGE B;  1YJ9 Q;  3LH0 A;  1MMA A;  3H41 A;  1W66 A;  2PVG B;  1BCO A;  1DJ7 B;  1M8M A;  3OS5 A;  4FW1 A;  4KRT A;  1VQ7 A;  3DB4 A;  1VQZ A;  1QVF A;  1N9R A;  2RK1 A;  3LGF A;  2CP7 A;  2RQU A;  2PVO B;  4F14 A;  3CC7 T;  2EWN A;  3CCM Q;  3CC4 A;  4P73 C;  2DL8 A;  5KYW A;  3FEO A;  1L0W A;  2JTF A;  5FWC A;  1X2Q A;  1B8A A;  1D1A A;  3LSS A;  2RQV A;  4DEX A;  2D8H A;  2DYB A;  2JM9 A;  5D6Y A;  3CCV Q;  3MF1 A;  3VJP A;  2RF0 A;  4GLM A;  1FWZ A;  4XTW A;  4E51 A;  1SKU B;  1QKX A;  3JSC A;  4ZN1 A;  2MK5 A;  1M2V A;  1Q95 G;  2W10 A;  5KYX A;  2KR3 A;  2PUO B;  4C0G A;  3FDR A;  2LCS A;  3H6Z A;  4EMG A;  5GJW B;  3LC0 A;  4YRS A;  2F2X A;  5K1X A;  1SRL A;  3OB9 A;  3GPL A;  3M55 A;  4AH6 A;  3R6N A;  2E10 A;  4OGE A;  3P8D A;  2DFU A;  2I0N A;  3G6E Q;  1AD5 A;  2PNI A;  2FHD A;  2KAF A;  3TCJ A;  1M9S A;  2DL7 A;  3TEH B;  2EBP A;  2CH4 W;  8AT1 B;  3O5Z A;  1B34 A;  1TG0 A;  1QE0 A;  3REA B;  4M77 C;  3ZL7 C;  2BTT A;  2DVE A;  4M4Z A;  5HKC A;  2AMC B;  5CKE A;  1OPL A;  4CS3 A;  2BKD N;  4XU3 A;  2K5I A;  2VGM A;  3V8L A;  4C92 C;  2FEI A;  2EPD A;  2BIV A;  1Y96 A;  1Z9Z A;  1HYO A;  1M1G A;  2YWW A;  1E1O A;  1GCP A;  4A4K A;  4M77 E;  5I21 A;  1QP3 A;  4JJN K;  3CCQ T;  1KFZ A;  5GAO q;  1N6A A;  3M4Y A;  4RTT A;  3A98 A;  1VQM Q;  1U8R A;  2LQK A;  4OMO A;  3RIR A;  1I81 A;  5L8R E;  4M77 F;  3QPH A;  4ZTJ A;  3HKS A;  4D6W A;  3URG A;  3I35 A;  4YRM A;  5E3I A;  2X4X A;  4HXJ A;  4AFZ C;  1WQW A;  2O4X B;  3QII A;  3S6W A;  3VS5 A;  1UGS B;  1YJW A;  2L3R A;  3M56 A;  5F5W A;  1KQ1 A;  3H9N A;  1EOV A;  1WJS A;  4M7D D;  3CXC S;  3R6O A;  4M7D A;  3PTA A;  3HY1 A;  4M78 F;  4X1V A;  4MML A;  1JEG A;  3WXM B;  1ATI A;  1M3C A;  4P5N A;  2NUP A;  1UDL A;  2JS2 A;  4IUV A;  3E2U A;  5DY9 A;  3E9H A;  1WHL A;  2C06 A;  1R77 A;  4M77 G;  2DBM A;  2EGA A;  3H8Z A;  2GCX A;  3BDU A;  1HD3 A;  2YSQ A;  3HL8 A;  1D1C A;  3DLL A;  1GCQ A;  2EYW A;  1TH7 A;  1VQP A;  2CT3 A;  2YXY A;  3L1A A;  1KQS S;  1NYR A;  4H02 A;  4TVR A;  2XTI A;  2FO0 A;  1I4K 1;  3NTH A;  1YHQ Q;  1RAE B;  1PWT A;  3A5Z B;  4XTZ A;  3FRN A;  3KBG A;  3Q1J A;  3G4S A;  1UGP B;  1YIT A;  3M59 A;  3CC2 A;  1LPL A;  4R0K A;  5GAO p;  1JU5 C;  2LCL A;  4A4H A;  1JJ2 A;  1N8R U;  2MYS A;  1VUB A;  1USY C;  3CMA A;  4YRO A;  4A63 B;  4C5H A;  2E3I A;  3A74 A;  3JCM h;  4ZIB A;  3RL6 A;  3PFS A;  4GLK A;  1PYS A;  4X9C A;  4LN2 A;  1NE8 A;  1B7Y B;  3QO5 A;  2GTJ A;  2J06 A;  2DA9 A;  3FJ5 A;  3A7A A;  5KYY A;  1N5Z A;  3VU3 C;  2RNA A;  3SWN C;  2P0L A;  4C5G A;  2QA4 T;  1YFN A;  1KMM A;  4GY5 A;  2PME A;  1SF9 A;  2COW A;  1VQN Q;  2LQ8 A;  5ECA A;  3T9N A;  3G71 Q;  2A08 A;  4MZM A;  3M53 A;  2M16 A;  4M7A B;  2FL7 A;  2RHS B;  3HXW A;  4H2W A;  3CEY A;  4BDZ A;  5I2M A;  1TXQ A;  3CCR Q;  2JT4 A;  4MDX A;  5GAN 3;  3OSS C;  1YI2 A;  2HQE A;  2CZ6 B;  2LJ1 A;  2EW3 A;  3HXX A;  3UF4 A;  5HY6 A;  2HCK A;  1IZ6 A;  2DRK A;  4XU2 A;  3QSU A;  2DE0 X;  4OB2 B;  2OX7 A;  2YLC A;  2QEX Q;  3I55 A;  3ICA A;  1QVG P;  1UE9 A;  4JLG A;  2O2O A;  1G3Y A;  1K0X A;  1XJW B;  1YCY A;  2NUT A;  1IXD A;  1W2B S;  2Q7G A;  3FIF A;  4E47 A;  2DMO A;  3CME Q;  2DK3 A;  4BY6 C;  2F1L A;  3WVD B;  2ZZG A;  1WPY A;  3C12 A;  3RKW A;  2EIF A;  1QVF S;  2NS6 A;  3L4G A;  1G51 A;  2VGN A;  2KRS A;  4F16 A;  2EJG A;  3LH5 A;  3MET A;  4WJ4 A;  1TOV A;  2EVR A;  1VQ9 A;  5GMK j;  3CCE Q;  1JQQ A;  2F5K A;  5CCA A;  1NG2 A;  4EX5 A;  2M1H A;  3L2W A;  1VQ7 T;  5J26 A;  5GAN 6;  4BAC A;  2P84 A;  2OTL A;  2KXC A;  3OBY A;  3LSQ A;  5D6X A;  3MCA B;  2MMP A;  4RG2 A;  2QAS A;  4PJO C;  2I2L A;  1FYF A;  2QG9 B;  1YJN Q;  3E1S A;  1GRI A;  2RHZ A;  2RM4 A;  3S3O A;  4FYY B;  2AHJ B;  2DU5 A;  1LNX A;  1YN8 A;  2KYB A;  2VV5 A;  4FM4 B;  5GAN 5;  3UT1 A;  2DD5 A;  1OOT A;  4C92 D;  2ZNI A;  3HHT B;  4AG2 C;  3QO3 A;  4C92 A;  3RMQ A;  1KG1 A;  2LJ0 A;  4C8Q B;  2XID A;  1D3B A;  4G84 A;  1H64 1;  2KRM A;  2RJD A;  4E7J A;  3CCJ Q;  1IHW A;  2GNC A;  3M0S A;  2XMF A;  5C0M A;  1IGU A;  2F69 A;  2ZPE B;  3RBB B;  2JXB A;  4BE2 A;  2CJB A;  5KYN A;  2HSE B;  1X2G A;  4PFZ A;  3RES A;  4ME7 A;  2J3M A;  2CP6 A;  3PVL A;  4GBQ A;  3X28 B;  4P3O A;  1SES A;  2GFU A;  2IPO B;  3GNG A;  2QDY B;  4JS4 A;  2HL5 C;  2LMJ A;  4KBM B;  2DXT A;  2QDL A;  4YRG A;  4IUP A;  2QQR A;  1IO6 A;  3QWY A;  4M75 D;  2LT4 A;  4XU0 A;  2K7A A;  4D8D A;  2QQ9 A;  2KK4 A;  4M75 A;  2IY5 B;  4A54 A;  4Y92 A;  3UGQ A;  4IUU A;  1VQ4 A;  3HSB A;  2BZ8 A;  3CCQ A;  4LDV A;  5KYU A;  1MV0 B;  4WJ3 M;  2KYM A;  1KC8 R;  4J6W A;  2AKL A;  1C0A A;  3CCU T;  4WCI A;  1VQ6 A;  3HY0 A;  2E6N A;  3FC3 A;  2F2V A;  3BW1 A;  3CD6 A;  2B8A A;  3OYG A;  3I56 A;  4YTL A;  5IT9 E;  1E1T A;  2MWP A;  5LJ5 h;  1V1C A;  1ZSZ A;  3MEU A;  5KH6 A;  4Q6G A;  5LL6 S;  2D0N A;  1NM7 A;  4RG8 A;  4HWR A;  1QCO A;  1ZSG A;  4F7U A;  1Y57 A;  2K57 A;  1KC8 U;  1QMC A;  2ZIO A;  3O8V A;  4CC2 A;  1AEY A;  3R07 A;  5GAO n;  1D0Y A;  3N5B B;  3HFZ B;  4J9B A;  1NJI U;  1VQ8 Q;  3E19 A;  2XK0 A;  1KIK A;  2CH4 A;  3RNJ A;  3HXY A;  1BU1 A;  4XU1 A;  1YGB A;  4H2T A;  3LW5 E;  3QUI A;  3HFN A;  4ZTU B;  1ADJ A;  3VS7 A;  1BKB A;  4YRJ A;  3RDV A;  4DPG A;  3VS0 A;  4QT7 A;  1CSK A;  4OP0 A;  4FCY A;  1TS9 A;  2K2V A;  3ZFJ A;  3EGD A;  4CH6 A;  3QJ6 A;  2RA2 A;  3NET A;  1JJC B;  4HCK A;  1RIQ A;  3HRI A;  1HJD A;  1T3L A;  2YT6 A;  3OW2 P;  4ZGD B;  2EYX A;  1MMD A;  1VQP T;  1CKB A;  2EQJ A;  1KC8 C;  1FX7 A;  2MF2 A;  1K4U S;  4DBR A;  3I7F A;  3VS1 A;  1A0N B;  5C53 B;  4M7D C;  4JUV A;  4HWP A;  1JJ2 S;  3TSW A;  1UJ0 A;  3G4S T;  1AVZ C;  2K6D A;  1YIT T;  1EVL A;  3CC2 T;  2E65 A;  2SRC A;  3UPU A;  4DOW A;  2JMC A;  1FMW A;  1V29 B;  2X3W D;  3OA6 A;  3JB9 D;  2MCN A;  2L8D A;  1NNH A;  4QQ6 A;  2VUB A;  3CMA T;  3RF1 A;  1YP5 A;  4M7D E;  11AS A;  4PJJ A;  2E3C A;  3MF2 A;  4NL2 A;  1KMN A;  1BI1 A;  2YUO A;  1TWB A;  4LNP A;  4FYX B;  2AZS A;  1JXO A;  2DVJ A;  4HT4 A;  2RJF A;  3MEY A;  4M7D F;  3CCS Q;  2H3J A;  5GAN 2;  4JZ4 A;  4LD6 A;  4XEO A;  5KE3 A;  1R0C B;  1Q82 U;  4WI1 A;  2G3R A;  3MQZ A;  4X5O A;  1OYX A;  4PL6 A;  2CIM A;  1NZ9 A;  1SHF A;  2EFI A;  2FZG B;  2XKO C;  2DU7 A;  1H4V B;  1D1B A;  2GTO A;  4PLI A;  3H0I A;  3LLR A;  1YJ9 A;  3QZ5 B;  5GMK m;  2L3S A;  4OMQ A;  1X43 A;  4BDY A;  3MEW A;  1YI2 T;  4UC4 A;  1OUL A;  4HT9 A;  3JCM J;  4M77 B;  2OAU A;  3M4G A;  3PMI A;  1BI2 A;  4RQE A;  3DKM A;  2DKG A;  1Y07 A;  4ATO A;  1TSF A;  1HK9 A;  4JJD A;  3OSV A;  3JRZ A;  2X4J A;  4M7D G;  1NPP A;  3CCM A;  5FRO A;  1VQ5 Q;  2ZPG B;  3BJU A;  2ZT8 A;  1AWO A;  2L89 A;  3I55 T;  2ZNJ A;  4FT2 A;  1Q81 R;  2QHT A;  3CCV A;  4FSS A;  4JRQ A;  2LX9 A;  1EFW A;  4YRE A;  3TU4 K;  3QO8 A;  3EGX B;  4A4G A;  4PJO D;  1C6V X;  4KGZ B;  3ME9 A;  3JCM d;  4PJO A;  4RDX A;  1ARK A;  3NHN A;  2X35 A;  2CZ7 B;  1UUE A;  2ZT6 A;  4TQF A;  1U06 A;  5GAN h;  2R5M A;  2CSQ A;  2ZT7 A;  2D8J A;  3BE3 A;  1G83 A;  3G6E A;  4YRT A;  4EIK A;  2VXE A;  3PCO B;  3EG9 A;  2LZ6 B;  1FYN A;  5GAM j;  1UJY A;  1NPR A;  4OMN A;  1BBW A;  4LVI A;  4JRI A;  5GAN 7;  4L5G A;  1VQ9 T;  3J80 E;  4H2X A;  3PT9 A;  2QGG A;  2LVM A;  3VS6 A;  2OTL T;  3ASK A;  4Y28 E;  1SPK A;  3TUP A;  3A8O B;  3G1Z A;  4YP0 A;  2KDS A;  3NEL A;  2EJF A;  1VQO Q;  1FXX A;  5CKF A;  5C51 B;  4PK4 A;  3J81 E;  4YRF A;  4HKE A;  5KE2 A;  1JRI A;  4YPF A;  2R5A A;  1Q81 C;  4HCB A;  3CCL A;  3EG1 A;  3HPW A;  2ZR2 A;  4BE1 A;  1X2K A;  2I4L A;  2KVQ G;  1WZO A;  2ZCF B;  1D0X A;  2JS0 A;  3VS2 A;  1P92 A;  1VQM A;  3QTC A;  2E41 A;  1M90 R;  3U23 A;  5DLQ E;  1RAH B;  2ZCE A;  5LJ3 f;  1WJR A;  2ECZ A;  3V8K A;  2E3H A;  3VUB A;  3EG0 A;  4XAX B;  2CYZ B;  3OS2 A;  2M51 A;  2ZZE A;  4FT4 A;  1U1S A;  1I8F A;  2EGE A;  3RR6 A;  2D0Q B;  3CPW A;  4KT0 E;  3UA7 A;  1M3A A;  4P71 A;  5LJ3 j;  1UTI A;  4TVA B;  2KGT A;  1EIY A;  1IGQ A;  2Y4X A;  3H0F A;  1S72 Q;  2G6F X;  2NUZ A;  3CC4 Q;  5D6W A;  2D1X A;  3SWN B;  3CCU A;  1VQ4 T;  2K3X A;  2HDA A;  4P74 A;  1G3S A;  1RUW A;  2XDD A;  1R8O B;  2QQB A;  3V7C A;  4C92 E;  1YIJ T;  3LX7 A;  4OMM A;  2A7Y A;  1VQ6 T;  2ED0 A;  1D0Z A;  3OQ5 A;  3MP1 A;  3BY7 A;  4OLF A;  1K9A A;  2L3P A;  3KUF A;  3CD6 T;  2R58 A;  2RK2 A;  1I07 A;  4VUB A;  4YYE A;  4C92 F;  4M75 C;  2ABL A;  3I56 T;  1M90 C;  5HGQ A;  3PIO A;  1PD1 A;  1MNE A;  4OF1 A;  1NEG A;  1PHT A;  1J5W A;  1O9S A;  3A8G B;  4OB3 B;  3OW2 A;  2CP0 A;  2HAX A;  2A8E A;  4M75 E;  2MWO A;  3GLX A;  2RHQ A;  1WLP B;  1AWX A;  3GF5 A;  4FYW B;  2E4H A;  4L59 A;  1G8X A;  4JZ3 A;  2JNG A;  4CI0 C;  1NLO C;  1WGS A;  1BK2 A;  2M02 A;  1VQL T;  3P8Y A;  4PJL A;  2HSP A;  1Q86 R;  2ED1 A;  4A4E A;  4CS4 A;  1ZSZ C;  1H3H A;  3VKI A;  1ZA1 B;  3L2Q A;  4TWA A;  4C92 G;  1VQN A;  4BY6 B;  2JUF A;  1OZ3 A;  3C4S A;  3QJY A;  4YDQ A;  1WNL A;  3LGL A;  3CCR A;  1YCS B;  5IN1 A;  4B6M A;  3V7S A;  3I9Q A;  1BIA A;  1VYT A;  4F7U E;  1BYM A;  1OV3 A;  2AKW B;  1E6G A;  3P8B B;  4BI4 A;  3CXC P;  1H4T A;  1U3O A;  5HK0 A;  1X55 A;  3HXU A;  1Z7M A;  3UDC A;  1WXT A;  2IVW A;  5LJ5 d;  4M75 G;  4F7U F;  1YJW Q;  3EAE A;  2JTM A;  4J9H A;  2CP2 A;  2AZV A;  1M2O A;  3CQT A;  3SHW A;  3PIP A;  2ARU A;  1F1B B;  3EHR A;  3VV0 A;  3VQX A;  2V8J A;  4J83 A;  2QHS A;  2RHU A;  1SSH A;  3WVE B;  2VXF A;  2COZ A;  1XNI A;  2CRE A;  1GFD A;  2QXF A;  4R55 A;  1X56 A;  3EG9 B;  1Q86 C;  4FW2 A;  2Q5H A;  4IUQ A;  2OTJ Q;  1UB4 A;  2JMA A;  2HMA A;  1XOV A;  12AS A;  4ELY C;  4H2V A;  4Z89 A;  1M30 A;  2ZIM A;  3CME A;  2ALY A;  1Y71 A;  5KYW B;  2GFA A;  3OS1 A;  1VQK Q;  2A3L A;  1RAB B;  2RQT A;  2CP3 A;  2DD4 A;  1QKW A;  4E7I A;  1YJ9 T;  2RI3 A;  3CMQ A;  4R56 A;  2LQN A;  4F7U G;  5GAO r;  3OMC A;  4E6R A;  3A5Y A;  2L0A A;  3CCE A;  4OMF B;  1YIT Q;  4KR2 A;  5A2Q E;  2F2W A;  1M2V B;  2B86 A;  3EFS A;  5KYX B;  2E5K A;  4OVA A;  4AMC A;  4ESR A;  3UFG A;  2V26 A;  2KE9 A;  2DEU A;  1UFF A;  2Q5I A;  4YRP A;  2HBW A;  1TUC A;  2RB6 A;  3A7R A;  3CCM T;  4JS5 A;  2WSC E;  3KXT A;  3JB9 F;  3CMA Q;  2LDM A;  3V7R A;  4OGC A;  5L23 A;  1VA7 A;  1H8K A;  4Z88 A;  1AZE A;  2MAM A;  4HA8 A;  1ZX6 A;  4LD9 K;  3CCV T;  1YFR A;  4CS2 A;  1Q7Y R;  1RL2 A;  1RAA B;  3C95 A;  2H8H A;  1CKA A;  4HWO A;  1RI9 A;  3DLM A;  1QWE A;  1AT1 B;  3HXZ A;  3VRZ A;  1B34 B;  4E7Z A;  4YRQ A;  1ASZ A;  4BWA A;  3JCM c;  4LE9 A;  1WI7 A;  4ANJ A;  2RO0 A;  2GBQ A;  1PKS A;  1NJ6 A;  2O88 A;  2LRQ A;  1Y96 B;  3M0T A;  3G6E T;  4JRK A;  3TVT A;  3ZBD A;  3L2R A;  4WTO B;  4N4H A;  2YRD A;  4ZGJ B;  1SRY A;  3VQY A;  4E7H A;  4RCB A;  3OYM A;  4CH5 A;  3JB9 G;  3OYC A;  1YI2 Q;  3L2V A;  3UA6 A;  3UH0 A;  2LJ3 A;  4JLI A;  2ARS A;  3JCM e;  1B70 A;  2YRC A;  2ROL A;  1W2B P;  2I4N A;  4CH4 A;  2BUD A;  4KUL A;  5FWB A;  4LDU A;  2ZZF A;  1WFW A;  1UGV A;  3I55 Q;  3A8L B;  5CQX A;  4PJO E;  4N4G A;  1M4Z A;  3EGU A;  3KFV A;  3QKJ A;  5GAN g;  2XHC A;  3CCL T;  2CDT A;  1Q7Y C;  4A4F A;  2FZC B;  3EG3 A;  1OI1 A;  1WYX A;  4KR3 A;  1OU8 A;  3TRE A;  4PJO F;  2DJZ A;  1B76 A;  1K9M R;  2DJQ A;  2V1Q A;  5IAY A;  1VQM T;  4M7D B;  3X26 B;  1MV3 A;  3CPW S;  5GAO m;  2V8K A;  1YFT A;  2FYK A;  3WQZ A;  1T3S A;  2PUK B;  3EFO A;  1TUD A;  2NUP B;  4JRP A;  3REB B;  2QTX A;  4YCV A;  1PM3 A;  1QVP A;  2RQW A;  3UWN A;  5GAN d;  1ASY A;  4B9X A;  2BZX A;  4J9D A;  3JV3 A;  2EQI A;  1RLQ C;  2GF7 A;  1VQ9 Q;  3CC7 Q;  4EMK A;  4DA4 A;  2M0O A;  1K9M U;  2COY A;  1RAF B;  1I1J A;  5D7U A;  3OYD A;  4M78 A;  2NYS A;  2RD1 A;  4L6V 5;  1PRL C;  2C0T A;  5CQY A;  3JCM V;  1H92 A;  3PGG A;  4PJN A;  1NYG A;  1YIJ A;  4PJO G;  2JN0 A;  3W3S A;  3G7Z A;  5IH2 A;  2EKO A;  1W1F A;  2DNU A;  2HBP A;  4P3P A;  2VKN A;  4P71 C;  4Q5W A;  2FRW A;  4JJB A;  4CC3 A;  4KGX B;  2CGH A;  4BB7 A;  2DQ0 A;  2JW4 A;  4DBQ A;  4KH1 B;  2CP5 A;  1BBZ A;  2AIR B;  2L5Q A;  3HRK A;  2PZ1 A;  1OEB A;  1PYS B;  3M0U A;  5GMK h;  2LNV A;  1K9M C;  3MP6 A;  3AHU A;  1XTD A;  2QYZ A;  5KYY B;  4JJC A;  5EG2 A;  5J3B A;  4DBF A;  5KCH A;  1GXI E;  4F04 B;  3OW2 S;  5ELO A;  4YRN A;  3I5S A;  3TQ7 P;  3MHX A;  1BIB A;  1NEB A;  3RKX A;  2KNB B;  3PZC A;  4P74 C;  2LNH B;  3QWX X;  2KXD A;  1YBY A;  1VQL A;  2KEA A;  5K1P A;  1LCK A;  4Y91 A;  2ART A;  2FG0 A;  3VYH B;  1Y7X A;  2HQX A;  4P75 C;  3C94 A;  3SFM A;  3THK A;  1OU9 A;  2LT1 A;  2IG0 A;  1QW1 A; 
#chains in the Genus database with same CATH homology
 5J39 A;  3M5A A;  2K4Y A;  1UEB A;  3VBB A;  1VQN T;  3TEH A;  4A53 A;  3G71 T;  4BI8 B;  4MDW A;  2RJC A;  1E24 A;  2VYT A;  2AMC A;  3QO7 A;  2MI6 A;  2WAC A;  1WU7 A;  3PNW C;  3CCR T;  4J7F A;  4E7L A;  1MGQ A;  2E64 A;  1G5H A;  4IUT A;  1E22 A;  1N27 A;  2XDB A;  3GIB A;  1H4Q A;  5GAM d;  1LJO A;  3MEV A;  1VQ5 A;  4O6J A;  2QEX T;  1X2H A;  4IUR A;  3OYB A;  1M8V A;  1NJ5 A;  4JDS A;  2ZPB B;  2ZR3 A;  3TEE A;  3IG2 A;  4O5V A;  2HNI A;  4TVY A;  3L4G B;  1RI0 A;  3RMS A;  4FL6 A;  1G3W A;  2O4X A;  3QYH B;  3INZ A;  2QHV A;  3GOX A;  5FLX E;  4N0A A;  1QVG A;  3CME T;  4X9D A;  3JCM Q;  2EAY A;  3HRS A;  3M4Q A;  4J6X A;  3JCM g;  5LJ5 e;  3ZEH A;  3CCE T;  4XTU A;  4C92 B;  3OYE A;  3FLG A;  4YCW A;  1D3B B;  3MO8 A;  4NOY A;  3OYL A;  1YJN T;  2RI2 A;  4PNO A;  1VQO A;  1GGM A;  1G5I A;  2DQ3 A;  5GAN 4;  3JB9 J;  2PQW A;  2YLB A;  5CIU A;  4XTY A;  2CKK A;  3ERR A;  4OB0 B;  3OYJ A;  3VUZ A;  4K87 A;  1Q81 U;  4C0Z A;  2ZPI B;  4LDW A;  2DTO A;  4M75 B;  4EPC A;  5M9O A;  4C0D C;  3REU A;  4NS5 A;  4RMO A;  1B7Y A;  2DXC A;  4C0F A;  4DQ2 A;  5GMK l;  2ZIN A;  4NL3 A;  2CS7 A;  3X20 B;  1OZ2 A;  5FRN A;  4CRI A;  2O01 E;  3HRU A;  1G3T A;  4XEM A;  3RUX A;  4M7A D;  1M1F A;  1SSF A;  4M7A A;  3JCM X;  2RHS A;  5FU7 C;  1S72 A;  2RHI A;  4J8O A;  4HWT A;  1LOJ A;  2FVU A;  3X24 B;  5KCO A;  1ZHI A;  3A32 A;  3CBM A;  1XQH A;  4F7U B;  3BFM A;  3QG1 A;  4YRK A;  2ZPF B;  4PKC C;  3OD1 A;  1H4S A;  2YRV A;  2D6F A;  3NFC A;  3M57 A;  2VC8 A;  4CH3 A;  4P72 C;  1M90 U;  5CK9 A;  5KNN A;  4ZTF A;  5FU6 C;  3JCM f;  2DZ9 A;  4PHC A;  1SER A;  4QQG A;  4YRC A;  1VQ8 T;  1YB3 A;  1ADY A;  3ER0 A;  2DDZ A;  4H2S A;  3M54 A;  2Q7E A;  4FIB A;  3NEN A;  2HD0 A;  1MHN A;  3JCM W;  4P75 A;  1UGR B;  1YHQ A;  1BI0 A;  5GAM h;  4XQ3 A;  4EMK C;  2F5T X;  2DIQ A;  2DAQ A;  5GAN e;  3L2U A;  3QZ9 B;  4O2D A;  4M78 C;  4K86 A;  1X01 A;  1K73 U;  1ZQ1 A;  2LTO A;  4HT8 A;  3RAC A;  4WF2 A;  5C6S A;  4DOV A;  3IKM B;  2XGT A;  4C8Q D;  2DPP B;  4M78 E;  2QI2 A;  4C8Q A;  4K88 A;  4P3N A;  2X4W A;  2DZC A;  4M75 F;  3V8J A;  3JB9 I;  5DLO A;  4KQE A;  2E70 A;  1HTT A;  1UGQ B;  4BE0 A;  3OBW A;  3G71 A;  4UP9 A;  3CCS T;  5LJ5 g;  4FU6 A;  2OTJ A;  4XTV A;  4RCC A;  1M1K U;  1K73 C;  1Q86 U;  1VIF A;  4ZN3 A;  2K5L A;  4J7I A;  1VQK A;  2X4Y A;  2IY5 A;  4EDU A;  5LJ3 h;  2E1H A;  4BD3 A;  5CR2 A;  3VQW A;  2CJ9 A;  1NYQ A;  3A8H B;  4PJO B;  1X6O A;  3QDR B;  2QEX A;  2R57 A;  2C7I A;  1N9W A;  4M78 G;  4N4I A;  3JCM P;  3E9I A;  1VQ5 T;  3S3M A;  1M1K C;  4HVC A;  4MZT A;  2D9T A;  3TEG A;  1JBM A;  5CKH A;  1QVG S;  4XTX A;  3X25 B;  2EJ9 A;  4RQF A;  2P5I A;  3DSQ A;  4H2X B;  2RHX A;  2M9U A;  1BBU A;  3HFO A;  3HFZ A;  3IAL A;  3VQV A;  5GAM e;  2Y90 A;  1N8R C;  5CKB A;  2P4T A;  3LWH A;  2J3L A;  2JVV A;  3OYY A;  1I5L A;  2ODR C;  1IRE B;  1JJC A;  2DTH A;  2XD0 A;  3F70 A;  2WSE E;  4UPA A;  1YJN A;  1W4S A;  2E5Q A;  4LVM A;  4N0A C;  3CBO A;  1PSE A;  5GMK i;  3HXV A;  1KD1 U;  2WSF E;  3OYH A;  3QYG B;  1VQO T;  3OS0 A;  2P0K A;  3GP8 A;  3VYG A;  1KHI A;  4C5E A;  1VIE A;  2PU9 B;  4UP7 A;  1EIY B;  3CCJ A;  4P73 A;  2I4M A;  2JOY A;  2ZTG A;  4ELZ C;  5A0D A;  2P0P A;  4TQD A;  2ZXF A;  1Q7Y U;  5LJ5 f;  1QF6 A;  3HRT A;  5DM7 R;  1N9S A;  5I2S A;  4J6Y A;  4XK8 E;  3GNF B;  2CJA A;  2C8M A;  5LJ3 e;  1KD1 C;  2ZZD A;  2QQS A;  5LJ5 j;  3E9F A;  1G5V A;  5A0L A;  4X34 A;  2E6Z A;  2RH2 A;  3CC7 A;  4QVD A;  3JCM b;  5FRM A;  2CZ1 B;  1SET A;  4YRR A;  3NEM A;  2GQV A;  3JAM E;  1HXD A;  1S72 T;  3PMT A;  4P72 A;  1LYL A;  3JB9 H;  4KUD K;  2EL9 A;  3CC4 T;  3NTK A;  3M4P A;  2DEQ A;  4QVZ A;  4M77 D;  5C52 B;  4OB1 B;  4M77 A;  1M5Q 1;  4LDX A;  2RHQ B;  4H2U A;  2QQA A;  2JZ2 A;  1PSF A;  4RMF A;  4M7A C;  4PG3 A;  3IKL A;  5AYF A;  4MZP A;  3P8H A;  5A0G A;  3P8T A;  4HWS A;  1VQ8 A;  4J5Y A;  4M78 D;  1IL2 A;  1KQ2 A;  4M7A E;  3OMG A;  2KMT A;  3MP8 A;  2G4C A;  1U1T A;  3DB3 A;  4M7A F;  3PCO A;  2EQK A;  2I4O A;  3SD4 A;  3RGL A;  2EYQ A;  5ELN A;  3HP9 A;  2LCC A;  3E9G A;  4Q15 A;  2EQM A;  4YRL A;  4IKF A;  4FSX A;  4BI3 A;  4UP8 A;  2CZ0 B;  3UGT A;  3FJP A;  4MMK A;  1YHQ T;  4PLL A;  1H3Z A;  4J15 A;  1NJ8 A;  3J7A F;  1WYD A;  2Q7H A;  5GAO l;  4RKU E;  5CAI A;  3A8M B;  2KSS A;  4LVJ A;  4L87 A;  3RKY A;  2XI9 A;  2P0Q A;  3OYF A;  3OYN A;  2PMF A;  4M7A G;  3A7U A;  2QHU A;  3REX A;  2ALY B;  3M9Q A;  1YJW T;  4QQD A;  1KOG A;  2V8I A;  4Z02 A;  3CCS A;  2PVD B;  2XU8 A;  2ZPH B;  2EQU A;  1X75 C;  3CXC A;  1WLE A;  5GAM g;  2E5A A;  4LVL A;  4V2S A;  1HC7 A;  1O75 A;  2DIG A;  4TTV A;  4LVK A;  1AHJ B;  2RHY A;  1USY A;  2OTJ T;  4TVA A;  3L2Z A;  2DXU A;  3LWI A;  5GAN f;  4C0D B;  1YFS A;  4NCX A;  1Z7N A;  2KQW A;  2Y4Y A;  4C8Q C;  1VQK T;  3OY9 A;  3S3N A;  4H2Y A;  4ZTZ B;  1KQS A;  3OYI A;  4YCU A;  4QW2 A;  3SWN A;  5GAN j;  3QNE A;  1NJI C;  2KY9 A;  2XIC A;  3CBP A;  1EQR A;  4E7K A;  4LDY A;  5CO7 A;  3QXE B;  4C5I A;  4C8Q E;  5FU7 B;  4BW9 A;  4G85 A;  2ODR D;  3M58 A;  3SB2 A;  4HCZ A;  4C8Q F;  1KHC A;  1K8A U;  4LNS A;  2K3Y A;  1QP2 A;  5GAN 8;  5HK3 A;  3QBY A;  4II1 A;  1WQ7 A;  2QA4 A;  2ZT5 A;  3FB9 A;  3RER A;  4TVW A;  5CVI A;  5LJ3 g;  1X54 A;  1EVK A;  3CPF A;  3KFU A;  2E12 A;  1B70 B;  4EMH A;  2RI5 A;  3QHS A;  1JB0 E;  5GMK e;  4HCC A;  1NJ2 A;  4B9W A;  2K5F A;  2DTI A;  2LC4 A;  2DXB A;  2YHT A;  1WJQ A;  1K8A C;  5FU6 B;  3P8V A;  1BI3 A;  3NTI A;  2XG8 D;  4C8Q G;  3SDZ A;  2ZGW A;  5LJ3 d;  2RJE A;  3A5Z A;  1EIF A;  3MEA A;  2FB7 A;  1Q82 C;  1NJ1 A;  3L42 A;  3HTZ A;  2AKW A;  4BUG A;  3OYK A;  1ZBX A;  3EFR A;  3LYI A;  2XDP A;  3HFV A;  4QVC A;  4EMK B;  3CCJ T;  2NLU A;  1W2B A;  5CKD A;  3A31 A;  5GAM f;  4M78 B;  4YRI A;  2DO3 A;  4EO4 A;  3OYA A;  3BDL A;  4KUI A;  4ZGE B;  3LH0 A;  1W66 A;  2PVG B;  1DJ7 B;  3OS5 A;  1VQ7 A;  3DB4 A;  1VQZ A;  1QVF A;  1N9R A;  2RK1 A;  3LGF A;  2PVO B;  3CC7 T;  2EWN A;  3CC4 A;  4P73 C;  3FEO A;  1L0W A;  2JTF A;  1B8A A;  3LSS A;  5D6Y A;  3MF1 A;  3VJP A;  1FWZ A;  4XTW A;  4E51 A;  3JSC A;  4ZN1 A;  2PUO B;  4C0G A;  3FDR A;  3H6Z A;  4EMG A;  3LC0 A;  4YRS A;  5K1X A;  3OB9 A;  3GPL A;  3M55 A;  4AH6 A;  2E10 A;  4OGE A;  3P8D A;  2FHD A;  2KAF A;  3TCJ A;  1M9S A;  3TEH B;  1B34 A;  1QE0 A;  4M77 C;  2DVE A;  5HKC A;  2AMC B;  5CKE A;  4CS3 A;  2BKD N;  4XU3 A;  2K5I A;  2VGM A;  3V8L A;  4C92 C;  2BIV A;  1Y96 A;  1M1G A;  1E1O A;  4A4K A;  4M77 E;  5I21 A;  1QP3 A;  4JJN K;  3CCQ T;  5GAO q;  1N6A A;  3M4Y A;  1U8R A;  2LQK A;  3RIR A;  4ZTJ A;  1I81 A;  5L8R E;  4M77 F;  3QPH A;  3HKS A;  4D6W A;  3URG A;  4YRM A;  5E3I A;  2X4X A;  1WQW A;  2O4X B;  3QII A;  3S6W A;  1UGS B;  1YJW A;  2L3R A;  3M56 A;  5F5W A;  1KQ1 A;  1EOV A;  1WJS A;  4M7D D;  3CXC S;  3R6O A;  4M7D A;  3PTA A;  3HY1 A;  4M78 F;  4MML A;  3WXM B;  1ATI A;  4P5N A;  4IUV A;  5DY9 A;  3E9H A;  2C06 A;  4M77 G;  3H8Z A;  2GCX A;  3BDU A;  3HL8 A;  3DLL A;  1TH7 A;  1VQP A;  1KQS S;  3L1A A;  1NYR A;  4H02 A;  4TVR A;  2XTI A;  1I4K 1;  3NTH A;  4XTZ A;  3A5Z B;  3FRN A;  3KBG A;  3Q1J A;  3G4S A;  1UGP B;  1YIT A;  3M59 A;  3CC2 A;  5GAO p;  2LCL A;  4A4H A;  1JJ2 A;  1N8R U;  1VUB A;  1USY C;  3CMA A;  4YRO A;  4C5H A;  3A74 A;  3JCM h;  4ZIB A;  3RL6 A;  3PFS A;  4GLK A;  1PYS A;  4X9C A;  1NE8 A;  1B7Y B;  3QO5 A;  3A7A A;  3VU3 C;  3SWN C;  2P0L A;  4C5G A;  2QA4 T;  1KMM A;  2PME A;  4GY5 A;  2LQ8 A;  3T9N A;  4MZM A;  3M53 A;  2M16 A;  4M7A B;  2FL7 A;  2RHS B;  3HXW A;  4H2W A;  3CEY A;  4BDZ A;  5I2M A;  4MDX A;  5GAN 3;  3OSS C;  1YI2 A;  2HQE A;  2CZ6 B;  3HXX A;  5HY6 A;  1IZ6 A;  4XU2 A;  3QSU A;  4OB2 B;  2YLC A;  3I55 A;  3ICA A;  4JLG A;  1G3Y A;  1YCY A;  1W2B S;  2Q7G A;  3FIF A;  4E47 A;  2DK3 A;  4BY6 C;  3WVD B;  2ZZG A;  1WPY A;  3C12 A;  3RKW A;  2EIF A;  1QVF S;  2NS6 A;  3L4G A;  1G51 A;  2VGN A;  2EJG A;  3MET A;  4WJ4 A;  1VQ9 A;  5GMK j;  2F5K A;  5CCA A;  4EX5 A;  2M1H A;  3L2W A;  1VQ7 T;  5J26 A;  5GAN 6;  4BAC A;  2OTL A;  3OBY A;  3LSQ A;  5D6X A;  3MCA B;  2MMP A;  4RG2 A;  4PJO C;  2I2L A;  1FYF A;  3E1S A;  2RHZ A;  2RM4 A;  3S3O A;  2AHJ B;  2DU5 A;  1LNX A;  2VV5 A;  4FM4 B;  5GAN 5;  3UT1 A;  2DD5 A;  4C92 D;  2ZNI A;  3HHT B;  3QO3 A;  4C92 A;  3RMQ A;  1KG1 A;  4C8Q B;  2XID A;  1D3B A;  4G84 A;  1H64 1;  4E7J A;  2RJD A;  5C0M A;  2F69 A;  2ZPE B;  2CJB A;  4BE2 A;  1X2G A;  3RES A;  4ME7 A;  2J3M A;  3X28 B;  4P3O A;  1SES A;  2GFU A;  3GNG A;  2QDY B;  4JS4 A;  4KBM B;  2DXT A;  4YRG A;  4IUP A;  2QQR A;  4M75 D;  2LT4 A;  4XU0 A;  2QQ9 A;  2KK4 A;  4M75 A;  2IY5 B;  4A54 A;  3UGQ A;  4IUU A;  1VQ4 A;  3HSB A;  3CCQ A;  4LDV A;  4WJ3 M;  4J6W A;  1C0A A;  3CCU T;  1VQ6 A;  3HY0 A;  2E6N A;  3FC3 A;  3BW1 A;  3CD6 A;  2B8A A;  3OYG A;  3I56 A;  4YTL A;  5IT9 E;  1E1T A;  2MWP A;  5LJ5 h;  3MEU A;  5KH6 A;  4Q6G A;  5LL6 S;  4RG8 A;  4HWR A;  1KC8 U;  4F7U A;  2K57 A;  2ZIO A;  3O8V A;  3R07 A;  5GAO n;  3HFZ B;  3N5B B;  1NJI U;  3E19 A;  2XK0 A;  3HXY A;  4H2T A;  4XU1 A;  1YGB A;  3LW5 E;  3QUI A;  3HFN A;  4ZTU B;  1ADJ A;  1BKB A;  4YRJ A;  4DPG A;  4OP0 A;  2K2V A;  3ZFJ A;  4CH6 A;  3QJ6 A;  2RA2 A;  3NET A;  1JJC B;  1RIQ A;  3HRI A;  4ZGD B;  1VQP T;  2EQJ A;  1KC8 C;  1FX7 A;  2MF2 A;  3I7F A;  5C53 B;  4M7D C;  4JUV A;  4HWP A;  1JJ2 S;  3G4S T;  1YIT T;  1EVL A;  3CC2 T;  2E65 A;  3UPU A;  4DOW A;  1V29 B;  3OA6 A;  3JB9 D;  2L8D A;  1NNH A;  4QQ6 A;  2VUB A;  3CMA T;  3RF1 A;  4M7D E;  11AS A;  2E3C A;  3MF2 A;  4NL2 A;  1KMN A;  1BI1 A;  4HT4 A;  2RJF A;  3MEY A;  4M7D F;  2H3J A;  5GAN 2;  4LD6 A;  4XEO A;  5KE3 A;  1Q82 U;  4WI1 A;  2G3R A;  3MQZ A;  4X5O A;  1OYX A;  4PL6 A;  2CIM A;  1NZ9 A;  2EFI A;  2XKO C;  2DU7 A;  1H4V B;  4PLI A;  3LLR A;  1YJ9 A;  3QZ5 B;  5GMK m;  4BDY A;  3MEW A;  1YI2 T;  4UC4 A;  4HT9 A;  3JCM J;  4M77 B;  2OAU A;  3M4G A;  3PMI A;  1BI2 A;  4RQE A;  3DKM A;  2DKG A;  1Y07 A;  4ATO A;  1HK9 A;  2X4J A;  3OSV A;  3JRZ A;  4M7D G;  1NPP A;  3CCM A;  5FRO A;  2ZPG B;  3BJU A;  2ZT8 A;  2ZNJ A;  2L89 A;  3I55 T;  4FT2 A;  2QHT A;  3CCV A;  1EFW A;  4JRQ A;  2LX9 A;  4YRE A;  3TU4 K;  3QO8 A;  4A4G A;  4PJO D;  3ME9 A;  3JCM d;  4PJO A;  4RDX A;  2X35 A;  2CZ7 B;  2ZT6 A;  4TQF A;  5GAN h;  2R5M A;  2ZT7 A;  3G6E A;  4YRT A;  3PCO B;  2VXE A;  5GAM j;  1NPR A;  1BBW A;  4LVI A;  4JRI A;  5GAN 7;  4L5G A;  1VQ9 T;  3J80 E;  4H2X A;  3PT9 A;  2LVM A;  2OTL T;  3ASK A;  4Y28 E;  3TUP A;  3A8O B;  3G1Z A;  4YP0 A;  2KDS A;  3NEL A;  2EJF A;  1FXX A;  5CKF A;  5C51 B;  3J81 E;  4YRF A;  4HKE A;  5KE2 A;  1JRI A;  4YPF A;  2R5A A;  1Q81 C;  4HCB A;  3CCL A;  3HPW A;  2ZR2 A;  4BE1 A;  2I4L A;  2KVQ G;  2ZCF B;  1P92 A;  1VQM A;  3QTC A;  2E41 A;  5DLQ E;  2ZCE A;  5LJ3 f;  1WJR A;  3V8K A;  3VUB A;  4XAX B;  2CYZ B;  3OS2 A;  2ZZE A;  4FT4 A;  1U1S A;  1I8F A;  2D0Q B;  3CPW A;  4KT0 E;  4P71 A;  5LJ3 j;  4TVA B;  1EIY A;  2Y4X A;  5D6W A;  3SWN B;  3CCU A;  1VQ4 T;  2K3X A;  4P74 A;  1G3S A;  2XDD A;  1R8O B;  2QQB A;  3V7C A;  4C92 E;  1YIJ T;  3LX7 A;  2A7Y A;  1VQ6 T;  3OQ5 A;  3MP1 A;  3BY7 A;  4OLF A;  3KUF A;  3CD6 T;  2R58 A;  2RK2 A;  4VUB A;  4YYE A;  4C92 F;  4M75 C;  3I56 T;  1M90 C;  5HGQ A;  3PIO A;  4OF1 A;  1J5W A;  1O9S A;  3A8G B;  4OB3 B;  3OW2 A;  2HAX A;  2A8E A;  4M75 E;  2MWO A;  3GLX A;  2RHQ A;  3GF5 A;  4L59 A;  4CI0 C;  2JNG A;  1WGS A;  1VQL T;  3P8Y A;  4A4E A;  4CS4 A;  3VKI A;  3L2Q A;  4TWA A;  4C92 G;  1VQN A;  4BY6 B;  2JUF A;  1OZ3 A;  3C4S A;  3QJY A;  4YDQ A;  1WNL A;  3LGL A;  3CCR A;  5IN1 A;  3V7S A;  1BIA A;  4F7U E;  1BYM A;  2AKW B;  3P8B B;  4BI4 A;  1H4T A;  5HK0 A;  1X55 A;  3HXU A;  1Z7M A;  3UDC A;  2IVW A;  5LJ5 d;  4M75 G;  4F7U F;  3EAE A;  2JTM A;  3PIP A;  2ARU A;  3VV0 A;  3VQX A;  2V8J A;  4J83 A;  2QHS A;  2RHU A;  3WVE B;  2VXF A;  1XNI A;  2QXF A;  4R55 A;  1X56 A;  1Q86 C;  2Q5H A;  4IUQ A;  1UB4 A;  12AS A;  1XOV A;  4ELY C;  4H2V A;  2ZIM A;  3CME A;  2ALY A;  1Y71 A;  2GFA A;  3OS1 A;  2A3L A;  2DD4 A;  4E7I A;  1YJ9 T;  2RI3 A;  3CMQ A;  4R56 A;  5GAO r;  4F7U G;  3OMC A;  3A5Y A;  3CCE A;  4OMF B;  4KR2 A;  5A2Q E;  3EFS A;  4OVA A;  3UFG A;  2Q5I A;  4YRP A;  2RB6 A;  3A7R A;  3CCM T;  4JS5 A;  2WSC E;  3KXT A;  3JB9 F;  2LDM A;  3V7R A;  4OGC A;  2MAM A;  4HA8 A;  1YFR A;  4LD9 K;  3CCV T;  4CS2 A;  1RL2 A;  3C95 A;  4HWO A;  3DLM A;  3HXZ A;  1B34 B;  4YRQ A;  1ASZ A;  4BWA A;  3JCM c;  2RO0 A;  1NJ6 A;  2LRQ A;  1Y96 B;  3G6E T;  4JRK A;  3ZBD A;  3L2R A;  4N4H A;  4ZGJ B;  1SRY A;  3VQY A;  4E7H A;  4RCB A;  3OYM A;  4CH5 A;  3JB9 G;  3OYC A;  3L2V A;  3UH0 A;  4JLI A;  2ARS A;  3JCM e;  1B70 A;  2I4N A;  4CH4 A;  2BUD A;  4KUL A;  4LDU A;  2ZZF A;  3A8L B;  5CQX A;  4PJO E;  4N4G A;  1M4Z A;  3QKJ A;  5GAN g;  2XHC A;  3CCL T;  1Q7Y C;  4A4F A;  1OI1 A;  4KR3 A;  3TRE A;  4PJO F;  2DJZ A;  1B76 A;  5IAY A;  1VQM T;  4M7D B;  3X26 B;  3CPW S;  5GAO m;  2V8K A;  1YFT A;  2FYK A;  3WQZ A;  2PUK B;  4JRP A;  2QTX A;  4YCV A;  1QVP A;  3UWN A;  5GAN d;  1ASY A;  4B9X A;  2GF7 A;  4EMK A;  4DA4 A;  2M0O A;  1K9M U;  3OYD A;  4M78 A;  2RD1 A;  4L6V 5;  5CQY A;  3JCM V;  3PGG A;  1YIJ A;  4PJO G;  2JN0 A;  3W3S A;  3G7Z A;  2EKO A;  2HBP A;  4P3P A;  4P71 C;  4Q5W A;  2CGH A;  4BB7 A;  2DQ0 A;  3HRK A;  2L5Q A;  1PYS B;  5GMK h;  2LNV A;  1K9M C;  3MP6 A;  3AHU A;  1XTD A;  5EG2 A;  5J3B A;  5KCH A;  1GXI E;  3OW2 S;  5ELO A;  4YRN A;  3MHX A;  1BIB A;  3RKX A;  3PZC A;  4P74 C;  1YBY A;  1VQL A;  5K1P A;  2ART A;  4Y91 A;  3VYH B;  1Y7X A;  2HQX A;  4P75 C;  3C94 A;  3SFM A;  2LT1 A;  2IG0 A;  1QW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...