2FYKA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with adp and biotin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords biotin--protein ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fykA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2fykA01
2DTOA 4C92A 4PJOB 5F5WA 4WJ3M 5CAIA 5GANf 4H2SA 3HXUA 1HC7A 1X2GA 1YCYA 3V8LA 4CH6A 3RESA 4PJOF 4QVCA 3INZA 1B34A 2CJ9A 3V7CA 2DTIA 3QO3A 2I4MA 1IL2A 2DZ9A 4M7DE 1BIBA 4C92B 5LJ5e 4P3NA 1WYDA 2FYKA 4CS2A 2JN0A 3L4GB 4XTXA 2XTIA 4RCCA 4C92F 2ZT8A 1B34B 5GAMe 3HY0A 4TVWA 4HWOA 3DSQA 4PG3A 4KR3A 3BFMA 4EMKA 4E51A 4P74C 1EOVA 2DVEA 1SETA 1J5WA 5GAOm 1EVKA 1X55A 3PCOB 1WPYA 3VQYA 4C8QE 4JRKA 4RDXA 5K1PA 1TH7A 3RIRA 4PNOA 5LJ5f 4M7AA 4HT9A 2DQ3A 2ZCEA 4YRPA 4EMKB 1B8AA 2AMCA 2EJFA 4M75A 4JLIA 5GAN4 2ZT7A 4DQ2A 4EMGA 2FB7A 1L0WA 4V2SA 1I8FA 1SESA 4YPFA 5GAN5 4M7AB 2I4LA 3HRIA 2I4NA 2AMCB 4YDQA 4M75B 3REXA 3QTCA 1N9WA 3UFGA 1N9RA 4M7AF 4WF2A 5LJ3d 4P73C 1USYA 4X9CA 4KR2A 4M77E 4XTVA 1WNLA 3SWNA 5GAN3 3A32A 4H2VA 1WU7A 3LSSA 4Q6GA 1HK9A 4PJOG 5GAN8 4H2YA 1N9SA 5GANg 4M77B 3SWNB 2Q7GA 4HA8A 1JRIA 3HRKA 5GAMd 3JCMP 1EFWA 1G5HA 4HWSA 4C92G 3JCMd 4XTZA 1NJ5A 3P8YA 1KQ2A 3VQXA 2E10A 3P8VA 1LJOA 4XU2A 5GAOr 2ARTA 1QF6A 4JRIA 1JBMA 2IY5A 3QO8A 5LJ3j 4RMFA 1X2HA 3G1ZA 2E64A 4J5YA 3OD1A 3BJUA 4EX5A 5LJ5g 3HXVA 4PJOC 4H2XA 1WLEA 2E5AA 1NJ8A 4YRQA 4F7UE 2RB6A 4P72C 4YRJA 3NEMA 2DU7A 4YRFA 4YRNA 3A5YA 2P5IA 3L1AA 1KMMA 1MGQA 4ZTUB 4C92C 5GAMj 3RKWA 4M7AG 4H2XB 4UP8A 3JB9H 5DY9A 1NJ2A 2EL9A 3R07A 2ZNIA 2ALYA 4PJOD 3M4QA 3RACA 1HXDA 3JCMb 5GAN2 4OP0A 4M78E 3L4GA 2ZR2A 3ERRA 3VQWA 3JB9G 2K57A 3BW1A 1ASZA 1RIQA 5LJ3h 4M7DA 2ZR3A 4HVCA 5GMKi 4XU1A 4P71C 1B76A 2Q7EA 2ZGWA 3V7RA 1EIYB 4YCVA 4C92D 1HTTA 2ALYB 3PCOA 1PYSB 3UGTA 4EMKC 1U1SA 3RKXA 4YRTA 3FIFA 4YRGA 1YFTA 4M7DB 5GMKh 4ZTZB 4EMHA 1YGBA 2G4CA 3NETA 3MF2A 4TVAA 3LSQA 4C8QA 4NL3A 3TUPA 2Q5HA 1D3BB 3HSBA 4M7AC 1X56A 4M7DF 2ZIMA 4H2TA 4N0AC 4A53A 4WI1A 1ASYA 4J6XA 3JCMh 1G51A 4NL2A 4YROA 4YCUA 5GANd 4XU0A 1ATIA 4G85A 4TVAB 4C8QB 3E9IA 3MEYA 4YRIA 1NJ6A 3HXWA 2EAYA 4K88A 2J3MA 1FYFA 4P75A 1I81A 4CH5A 4C8QF 4XTUA 4M7AD 2EJGA 4P74A 1C0AA 3P8TA 3A74A 1USYC 3SB2A 2YLBA 2ZZGA 3A31A 1Y96B 1G5IA 2Q7HA 5GAOq 4XTYA 3SWNC 3HXYA 4M75F 4M77A 2CJBA 4O2DA 3JB9D 3HFNA 3LC0A 2QHUA 1X01A 1M5Q1 5HGQA 3W3SA 1H641 4X9DA 2PMEA 5LJ5d 1I4K1 4BW9A 4RCBA 2RD1A 4TQFA 5GANj 2ZZEA 4M77F 1E22A 5GAN6 3JCMV 1H4TA 3IKMB 4UP7A 4P73A 4YRMA 5GMKl 3KFUA 3QHSA 1NYRA 2RHSA 4NOYA 2AKWA 5E3IA 4P3PA 2CJAA 4M7DG 3IKLA 4J6YA 1H4QA 2HNIA 2DQ0A 2QHVA 4YREA 5I21A 2ZZFA 3JB9J 2CGHA 2RHSB 2AKWB 1EVLA 4HWRA 4F7UA 3QSUA 3BY7A 4RQEA 4L87A 4XTWA 5LJ5j 3FJPA 2E65A 4C8QG 3V8JA 3JCMQ 1X54A 1NJ1A 3JCMW 5GANh 2DKGA 2EWNA 4F7UB 1VQZA 2E1HA 2ZNJA 4M75G 3WQZA 4MMKA 2QTXA 2C7IA 1EIYA 4M78A 4MMLA 4F7UF 2I4OA 4M7DC 2E41A 3IALA 5GMKm 4HWPA 1PYSA 3VU3C 3HXZA 3TEGA 3E9HA 3PGGA 1Z7MA 3QO5A 5GAN7 4PJOE 5K1XA 3A7RA 3M4PA 3L2ZA 3A5ZA 1LNXA 2QHTA 3HTZA 2ZT5A 4XEOA 4WJ4A 2ZINA 4M78B 2E3CA 1SRYA 3MF1A 4HWTA 1QE0A 1D3BA 4YRKA 1W66A 1YB3A 5LJ3e 4M77G 4K86A 4TVYA 2YLCA 4M78F 4C8QC 4C92E 1E24A 5LJ5h 4M7DD 3NENA 2DTHA 3AHUA 5C52B 2VC8A 4YRRA 4HT8A 4YRSA 3QNEA 2RHQA 3ICAA 5ELOA 5GAMh 3CMQA 4M75C 2PMFA 1JJCA 5GMKe 5GAOn 3I7FA 4YP0A 3A7UA 4CH3A 2J3LA 3REUA 3JCMX 3VQVA 4P71A 2DXTA 5LJ3f 1YFRA 2VXFA 5ELNA 4ZIBA 1WQ7A 1Y96A 4P75C 4UP9A 1WQWA 4C8QD 1ADJA 4YYEA 2RHQB 3JCMe 4TWAA 4J15A 3NELA 1JJCB 2ZT6A 4RQFA 1KQ1A 3RKYA 3JCMc 3EFSA 1B7YA 2RM4A 1ADYA 3JCMJ 1E1TA 4TQDA 4M75D 1LOJA 4M77C 2CIMA 3HFVA 1YFSA 4K87A 2RA2A 3RERA 3IG2A 4N0AA 4CS3A 4NCXA 4XQ3A 4M7AE 1GGMA 4G84A 2P0LA 1BBUA 4H2WA 3RGLA 1NYQA 4M75E 1B7YB 5GAMf 3QUIA 2ZXFA 4F7UG 2DZCA 3JB9I 3JCMf 4YCWA 3HFOA 5C51B 11ASA 1Z7NA 2DEQA 3PZCA 3VBBA 5KNNA 1KMNA 3UGQA 3QO7A 4KQEA 4M77D 4TTVA 3TEHA 2DJZA 4OLFA 4YRLA 1LYLA 3V7SA 3EFRA 4JUVA 2QHSA 4M78G 1NNHA 4AH6A 1BBWA 3JB9F 3TEHB 4EO4A 3M4GA 4J6WA 2DXUA 3HY1A 4H2UA 1M8VA 1BIAA 3RF1A 5GAOp 4P3OA 2ARSA 1EQRA 4DPGA 2ZIOA 4X5OA 4XU3A 4XEMA 4CH4A 4Y91A 2ODRC 1KOGA 3RL6A 2XGTA 2VXEA 4UPAA 2I2LA 5LJ3g 3GIBA 3BDUA 1H4SA 1B70A 2EJ9A 3HFZA 2C8MA 3FB9A 1I5LA 3UH0A 4M78C 2Y90A 3RUXA 1SERA 2ODRD 2YHTA 4H02A 3A7AA 4QVDA 1U1TA 4A54A 4CS4A 5GANe 1B70B 4LNSA 2ARUA 5GAOl 2IY5B 2DDZA 3HFZB 1H4VB 4PHCA 5GMKj 4PJOA 5C53B 5GAMg 2Q5IA 4BWAA 4YRCA 4P72A 3JCMg 1E1OA 12ASA 4Q15A 2DU5A 2ZTGA 3V8KA 3HXXA 4M78D
chains in the Genus database with same CATH superfamily
2B8AA 2COWA 1WA7A 5KYWB 1SKUB 4CC4B 3SD4A 5GANf 2D0NA 1AWXA 3HXUA 2ZPGB 1GL5A 1NE8A 4PJOF 1B34A 1VQ7Q 2LP5A 2DZ9A 3I56T 4C92B 1JB0E 1VQKA 4P3NA 1GBRA 1W1FA 1QVGA 2RHXA 2ZPFB 2FYKA 4ESRA 2JN0A 1UGVA 1WXUA 1D1CA 3QPHA 3A8HB 5AYFA 4QVZA 4HWOA 5FRMA 3CCRQ 2DVEA 1K0SA 2XDPA 3CC2T 4VUBA 2JUFA 4C8QE 1VQ9Q 1QWEA 2KE9A 2DNUA 4PNOA 3I55Q 2I0NA 3HPWA 2V8JA 3OYLA 1UTIA 1Y57A 2CZ7B 3CC7T 1UGPB 3CD6Q 1EFNA 4DBRA 1IGQA 2EIFA 4V2SA 1I8FA 2L3SA 4YPFA 4M7AB 1UGRB 1UJ0A 2AMCB 2LQWA 3UA6A 3UFGA 1KQSS 2LJ0A 1LPLA 3CC4T 1NZ9A 2VASA 1USYA 3VS3A 4KR2A 4Z02A 4M77E 1GFCA 1WNLA 3SWNA 1AZGB 3GBQA 2XIDA 3A32A 4QQDA 3LYIA 4ZN1A 4Q6GA 4R0KA 1RABB 4O5VA 2SEMA 5LL6S 1QKWA 2FPFA 2D9TA 4LN2A 1RLQC 5EC7A 1B7TA 3HRKA 3JCMP 1IREB 3QDRB 3J7AF 1NJ5A 2KR3A 3CMEQ 4HCKA 5IH2A 2FVUA 1UEBA 3CBPA 3G1JA 2ATCB 2IIMA 3G71A 4BDZA 1QF6A 1JBMA 4BUGA 2LCLA 3QO8A 1DJ7B 1X6GA 5LJ3j 5CQXA 3CPWA 1W2BP 2C0IA 1VIEA 2E64A 2LCSA 3GF5A 2C0OA 2DD5A 1TXQA 3PVQA 3CMAQ 2EKOA 2E5AA 2RB6A 4PLLA 4IUUA 1VQ8T 2V8IA 3NEMA 3G6EQ 2K2MA 2A0FB 1KSWA 2A37A 4GLMA 4PLIA 5CK9A 3DLMA 3FDRA 1MGQA 4C92C 2M16A 1P92A 2HL5C 3VRYA 1K8AU 3EFOB 1EX4A 1YI2Q 1WHLA 2E5KA 3X26B 4Z89A 1VQNQ 2MIOA 2KDSA 4PJOD 3EG2A 4QQ6A 8AT1B 3M4QA 1HXDA 5GAN2 4JJNK 3GP8A 2ZR2A 5EG2A 3BW1A 1OX9A 5LJ3h 1B76A 2GGRA 5FU7C 3META 2W0ZA 3L2WA 4IURA 3PCOA 3EHRA 1TOVA 1ZA1B 1T0HA 4YRTA 1E6HA 1NPRA 2ABLA 3A8LB 4M7DB 4FYWB 2MCNA 4J7FA 4ZTZB 2EYZA 3HL8A 1YGBA 1PSEA 2FO0A 3S3NA 2G4CA 3LSQA 4C8QA 3G4SA 3HSBA 4M7AC 1X56A 2QQ9A 1K73C 4J6XA 2K3XA 3JCMh 3OBWA 2LZ6B 4B9XA 4XU0A 1ATIA 4G85A 1RAEB 2EPDA 1K4US 1YIJA 2B86A 2YUOA 5HK0A 2V1QA 3MP8A 4KBMB 2EAYA 4P75A 1I81A 4CH5A 2KAFA 2HKNA 5J3BA 2DETA 2ED0A 2ZZGA 3A31A 3A1PA 1E6GA 2HAXA 4XTYA 2BIVA 2K3YA 4J9GA 4M77A 2CJBA 1EIFA 3MPUB 1Q7YC 3TSWA 1R0CB 1X01A 3W3SA 2KRSA 4C0ZA 5KYXB 1H641 2QA4A 1KC8R 2PMEA 1WHJA 1JJ2A 1VQKT 2LTOA 5DLQE 3MEWA 3QWYA 1Y0MA 4BW9A 1BCMA 2RD1A 4TQFA 2QQSA 2C0TA 5GAN6 4R56A 1M4ZA 1M90U 1PRLC 2RHSA 3OMCA 2AKWA 1NEBA 2MPXC 2HNIA 3LWHA 2DQ0A 2X4JA 3EGUA 3JB9J 1D0XA 4L6V5 1VYTA 2AIRB 3D7SB 3OS1A 4LUEA 1KFZA 4HWRA 2HEQA 1PSFA 1VQPA 3VRZA 1JEGA 3BY7A 2HD0A 3M58A 2HMAA 4XTWA 1G8XA 1WHGA 5LJ5j 2L0AA 4JLGA 4E7LA 2K4YA 2E65A 4C8QG 3HRTA 1WHMA 1X54A 2A8EA 2O4XA 4LDVA 3SFMA 2KGTA 3VS7A 4EPCA 4M75G 4MMKA 2C7IA 2QGGA 3PMTA 4MMLA 4F7UF 5CCAA 2E41A 4M7DC 5GMKm 1PYSA 4OGCA 2AHJB 3HXZA 1Z7MA 3QO5A 1YCSB 3A7RA 3L2ZA 1D0YA 2ZINA 4P5NA 1D3BA 2M9UA 3O5ZA 2DPPB 4M77G 4TVYA 2YLCA 1FYNA 3H9NA 4C92E 5LJ5h 1SPKA 4N4HA 4AFQC 3G71T 2GTOA 2DTHA 3MHXA 1ABQA 3CXCP 2RQVA 4J9IA 2EGAA 4LNPA 2WSCE 4XK8E 4ZGEB 2YWWA 2RI5A 2J3LA 3E1SA 3JCMX 1N27A 3BDLA 2DXTA 3CPFA 2JTFA 1AVZC 2VXFA 4RTXA 5ELNA 2MF2A 2EBPA 2RHQB 3X28B 4JRQA 4RQFA 1KQ1A 3TU4K 1I1JA 2EFIA 1VQOQ 2AT1B 1RL2A 1M27C 1HYOA 3C4SA 3ASKA 4CS3A 4N0AA 2KROA 2LC4A 2RQWA 4M7AE 1WDXA 4HKEA 1LVKA 2ZXFA 2MK5A 4YCWA 3EG9A 11ASA 1Z7NA 2RK1A 2OAUA 2LT1A 1H3HA 2X4XA 3QO7A 3UPUA 4OLFA 5KH6A 3EFRA 1MUZA 2VVKA 3H8ZA 5FW9A 3VV0A 4AH6A 1S72A 1BBWA 3TEHB 4EO4A 1YHQQ 2VUBA 1M8VA 2XDDA 3E19A 4DPGA 2ZIOA 2V8KA 2RHYA 2CP7A 3I56A 1NYFA 4BDYA 2ODRC 4PJNA 1KOGA 2CSQA 5LJ3g 1BYMA 1NJIU 3NFCA 3GIBA 1IRXA 5I2MA 3CC2A 3C94A 2KMTA 3HFZA 2C8MA 3FB9A 1I5LA 2F2VA 4OMQA 2EQKA 1N8RC 2FG0A 2E3HA 2Y90A 3RUXA 4FL6A 2HDAA 2QA4T 4QVDA 1U1TA 3A7AA 2DAQA 2GF7A 5GANe 4H02A 2E6NA 4LNSA 4CS4A 3VS0A 1H4VB 2GQIA 2BTTA 2KXDA 1M3CA 1WHKA 1QVFP 3JCMg 3P8BB 2DU5A 2ZTGA 3OYMA 3CEYA 4C92A 3CC4A 4PJOB 2P4TA 2JT4A 3M53A 5KYYB 4H2SA 1G3WA 1X2GA 3V8LA 4QVCA 1X2QA 2EYWA 5DLOA 2O9VA 3V7CA 3QO3A 2I4MA 3PIPA 4M7DE 4ELYC 2LDMA 2PUKB 1SHGA 2YXYA 3VYGA 1IB8A 2JS2A 2XTIA 4RCCA 3L2UA 3DSQA 4PG3A 5CKDA 2EQUA 3CBOA 5D7UA 2CZ0B 1EOVA 2DL8A 4E7IA 3A8OB 5FRNA 4OGEA 1EVKA 3CCUQ 1X55A 1WPYA 1ZBXA 4QW2A 3VQYA 1UECA 2DE0X 3HRSA 3I5SA 1TH7A 3RIRA 4C0DC 6AT1B 4CC3A 2RHUA 3PVLA 4M7AA 3L2VA 1PRMC 4EMKB 2AMCA 3H6ZA 4JLIA 5GAN4 2ZT7A 3R6OA 2QDLA 4DQ2A 2FZGB 4EMGA 2EGCA 2O9SA 2QTVA 1AHJB 4OMOA 3VS4A 1SESA 3CCQQ 1WFWA 4OMMA 1VQ8A 3OSVA 3QTCA 1VUBA 1N9WA 1N9RA 3H0HA 2GFUA 1M1GA 5KYUB 2BZ8A 4L59A 2JMAA 5LJ3d 2FPDA 3M0SA 4X9CA 2E70A 3NPFA 5D6XA 2QXFA 1QVFS 3RR6A 4X34A 2D6FA 4E6RA 1PHTA 5GAN8 4H2YA 3NTKA 2LJ3A 3C95A 1SRLA 2J05A 1WLPB 1KJWA 4HA8A 2IVWA 1RAGB 2ECZA 3THKA 4C92G 3JCMd 2KRMA 2KVQG 2E10A 3P8VA 1LJOA 4C5IA 1ZSGA 2QQAA 2GCXA 4AFSC 2NUTB 4RTWA 1M1KU 1AWJA 1WJSA 2IY5A 1X2HA 3OQ5A 1IHWA 3CC7Q 1FMKA 1OZ2A 1A0NB 1TUCA 3VYHB 1VQMT 3BE3A 3BJUA 3H0FA 5LJ5g 4HVVA 1Q82C 4PJOC 2BKDN 2X4WA 2EKHA 1K8AC 5KE2A 5I2SA 4P72C 3LH5A 3ZEHA 4YRNA 1W6XA 3CCJA 3L1AA 3I5RA 1KMMA 1FMWA 1G83A 2VKNA 1EZZB 2XG8D 3S6WA 3CCEQ 3OMGA 3QJYA 3CCVT 4M7AG 4H2XB 4UP8A 2RMOA 4MDXA 5DY9A 2HBWA 5GJWB 2OTLQ 5HK3A 1S72T 2ZNIA 5IXBA 2AKLA 3RACA 4XAXB 2D1XA 3L4GA 3VQWA 2K57A 4ORZA 4E7JA 1RIQA 3QYGB 4M7DA 1JU5C 3M55A 4XU1A 5IN1A 3LW5E 3V7RA 1PKTA 5CQYA 1EIYB 2ALYB 4LDUA 4JZ4A 4EMKC 4E7KA 4A63B 3OW2P 2FL7A 2VWFA 1YJNQ 3OYDA 2BE9B 5J26A 3MF2A 4JS5A 1VQ5Q 1X69A 2XD0A 4H2TA 4N0AC 1ASYA 3KBGA 3VS5A 1YJWA 1XJWB 1G51A 4LVKA 4YROA 2EYYA 4YCUA 4IKFA 4TVAB 5CO7A 4E7SA 1QWFA 4YRIA 3HXWA 2JM8A 3ER0A 4Y28E 1T0JA 2F2XA 1KC8U 4XTUA 2EJGA 4P74A 2OTJT 2K5FA 2YLBA 2NWMA 1YITA 4JPBW 3OB9A 3HXYA 2PU9B 2L3QA 5CKFA 1RACB 3JB9D 2QHUA 2LQ8A 2QAZA 1FX7A 2CT3A 2DMOA 2LVMA 2J6KA 2OJ2A 1M90C 3TEEA 5LJ5d 4BY6B 2YUPA 2JMCA 1VQLQ 2RF0A 3OYYA 2COZA 2E4HA 1BI1A 2CKKA 1E22A 2KI7A 1H8KA 3CCLQ 3QHSA 4BI4A 1NYRA 4A4HA 2CP5A 2RI2A 1QCNA 5KCOA 4P3PA 3CCMQ 4M7DG 1CKAA 3CCSA 2DA9A 2LX7A 1VQ7T 3OW2S 2ZZFA 3VS6A 4BD3A 2CGHA 1JXOA 2MMPA 1EVLA 1IGUA 2FRYA 2PVOB 4RKUE 1GXIE 1Q86R 3AT1B 4AT1B 3LLRA 1R8OB 1Q81U 4PL6A 2IG0A 3A8GB 4F7UB 2FRWA 2W10A 3Q1JA 4HCZA 4AG1C 2K7AA 3WQZA 3RMQA 1C6VX 1VQKQ 4BE0A 1ABOA 4WCIA 3P8HA 3TEGA 3PGGA 4FSSA 2CT4A 2VV5A 5GAN7 4PJOE 2KY9A 1H3ZA 3A5ZA 3OYKA 1LNXA 3HTZA 4KH0B 4XEOA 4WJ4A 4HWTA 2HZYA 1QE0A 3TVTA 1YB3A 4IIMA 3OYIA 1PWTA 1R0BG 4D6WA 4M78F 1E24A 3NENA 5C52B 2VC8A 2AZSA 2J6FA 3QNEA 2RHQA 1N8RR 5ELOA 3CMQA 4F14A 2O88A 5GMKe 4E7ZA 2A7YA 1ZSZB 1UGSB 1RUWA 2X35A 5D6YA 3VQVA 4RTVA 4P71A 1AWOA 2JS0A 2QYZA 5LJ3f 1YFRA 4ZIBA 1WQ7A 3WVDB 3H41A 1Y96A 4IUTA 4UP9A 2DL3A 3OA6A 1ADJA 4B6MA 4YYEA 2MI6A 4TWAA 1U8RA 4J15A 2L2PA 1W2BS 3CCJT 4KULA 3CMET 1NYGA 4N4GA 5IHIA 3PIOA 2MYSA 3KUFA 4BY6C 4LVIA 1QVFA 1E7OA 1YFSA 4K87A 1MMAA 4D8DA 2ZPEB 4XQ3A 1OQKA 2JTMA 2L89A 3C0CA 4G84A 5FU6B 4EDUA 4H2WA 1NYQA 1B7YB 3QUIA 2QQBA 4PFPA 4HT4A 1R77A 3OYJA 3JCMf 1M2VB 3HFOA 2PTKA 3OSSC 3CMAT 3OS5A 3PZCA 4GLKA 3FC3A 2JW4A 5A2QE 5KNNA 3UGQA 3G6ET 4KQEA 2GQVA 1RI9A 3TEHA 2X9HA 3OS0A 4YRLA 2DILA 4IUVA 1VQ6A 3V7SA 1LYLA 4E2FB 3GNGA 3G71Q 3PFSA 3FJ5A 2CUDA 2DBMA 2HKQB 2L3PA 2WACA 4JUVA 5IHNA 2RQUA 1YI2T 2FEIA 4H2UA 2LJ1A 1BI3A 3MCAB 2H3EB 1YJWT 1NJIC 2ARSA 2P0PA 1C0MA 1O9SA 4HCBA 3LX7A 3RDVA 4XU3A 4XEMA 3U23A 2J06A 4CH4A 3M0RA 4F17A 5DM7R 2VXEA 4PKCC 4RTYA 2I2LA 2KYMA 3BDUA 1YITT 4FCYA 5C6SA 2EJ9A 1QP2A 2HQXA 1QVGP 1WX6A 2KT1A 2QDYB 2ZZDA 1K0XA 4PJMA 2YRVA 2RPNA 1B70B 2BUDA 2M0OA 2DDZA 1G3YA 2MOXA 3HRUA 5GMKj 3E9FA 4PJOA 5C53B 2G6FX 3QKJA 2Q5IA 4BWAA 3MEAA 4P72A 5KYYA 1ZA2B 4FIBA 1E1OA 12ASA 2DO3A 1PD1A 2KRNA 4KH1B 2ZT5A 4M78D 1JO8A 1W4SA 3G4SQ 2K2VA 5CAIA 3SHWA 3CCST 1JQQA 1OULA 1K9MU 4CH6A 3H0IA 2K6DA 2DTIA 1AD5A 4MDWA 1YIJQ 2KEAA 1WYDA 1TTHB 4FT2A 1VYUA 1Q82R 1KD1C 3OYGA 4BE2A 1OU9A 2ZT8A 5GAMe 3JSCA 1NBEB 5CKHA 1AOJA 3BFMA 4EMKA 4KR3A 4P74C 1J5WA 5GAOm 1BU1A 4OB2B 1ACMB 3M9QA 2E6ZA 3PCOB 4J9BA 1QLYA 4RDXA 5LJ5f 3L2QA 4HT9A 4YRPA 2ZCEA 1OEBA 2LT4A 2QA4Q 2EJFA 1SSFA 5KYUA 1UE9A 3NTHA 1KHIA 5I22A 2FB7A 5IAYA 1L0WA 1VQMA 4BI8B 1X6OA 4FSXA 2I4LA 3HRIA 3G7ZA 2I4NA 4LDYA 4YDQA 4M75B 3REXA 4KT0E 3CPWP 3QIIA 2L5QA 3TQ7P 3DB4A 1YBYA 5A0DA 2ZAEA 4AFUC 2D8JA 4XTVA 4C0GA 3CCVA 2CP0A 2HQEA 3MP6A 3HTRA 5GAN3 3OW2A 2YRCA 2GNCA 4C5EA 4OB0B 4H2VA 4JJDA 3LSSA 4PJOG 5L8RE 1KG1A 4JRPA 2BE7D 2BZYA 4KUIA 2DK3A 4M77B 3OY9A 3FRNA 3I9QA 3OBYA 1VQPQ 1M1KC 3QG1A 3M59A 2NUTA 3VS1A 3R6NA 2BZXA 4DOWA 3CXCS 4XTZA 3LWIA 7AT1B 4J83A 2DIGA 1JXMA 3PE0A 2ROTA 4XU2A 1TUGB 4LDWA 2ESWA 1B07A 4ZN3A 2JZ2A 4RMFA 1LCKA 5A0LA 2CREA 3G1ZA 3L2RA 4J5YA 1MNEA 2X3XD 3HXVA 4H2XA 2HSEB 4LD6A 1WLEA 1NJ8A 5ECAA 3QJ6A 4F7UE 1RAHB 4AFZC 1YWPA 4C5GA 2K79A 5KYWA 3EAEA 3OYHA 4YRFA 2CP3A 1VQ6T 3A5YA 2A28A 2VGMA 4YTLA 4ZTFA 2P5IA 3TREA 1Y71A 5GAMj 2OTJA 3SDZA 2YUNA 2CP2A 4OVAA 1HJDA 2EL9A 3R07A 2ALYA 3M4YA 2VYTA 3ERRA 1ASZA 2OX7A 2ZR3A 2RHZA 3HKSA 4HVCA 1U5SA 4P71C 2Q7EA 2ZGWA 3P8DA 2DF6A 2JXBA 2A08A 1W2BA 1PM3A 1PYSB 1UG1A 3FIFA 4R55A 4YRGA 1U06A 2AKKA 4KGXB 1GCQC 1YJ9A 2FZCB 4EMHA 1JJ2P 3NETA 4TVAA 2EYXA 1D3BB 2Q5HA 1BBZA 1SF9A 2ZIMA 4A53A 4PJLA 1YHQT 2AZVA 5KCHA 1H92A 1VQMQ 2YDLA 1PNJA 4NL2A 1RI0A 2WSEE 4K11A 2QEXT 1VQ7A 2LRQA 3E9IA 3MEYA 4LDXA 2YSQA 3EH1A 2D0QB 1SRMA 4KRTA 4F04B 2J3MA 1K9AA 2PVDB 1UHCA 4C8QF 3P8TA 1X6BA 3SB2A 3MP1A 2NS6A 1XNIA 3DB3A 3CCRA 5GAOq 2Y4YA 1S72Q 4CRIA 4OMPA 4PFOA 1AEYA 2OAWA 2YUQA 4M75F 4OMLA 4OF1A 2F2WA 1VQ9A 1FXXA 3LC0A 3I55A 2CZ1B 2LX9A 3EG1A 1QKXA 4KGZB 2P4RA 3OYAA 2O2OA 1ZBJA 2QI2A 1K73R 3I56Q 3GPLA 2F5KA 5FWBA 1I4K1 3CD6A 4A4EA 4RG8A 1T3SA 3QDFA 2EW3A 5GANj 2LNVA 2ZZEA 2RJEA 1QVPA 4M77F 2H8HA 3JCMV 3EGDB 4HVUA 4UP7A 4P73A 5KYNA 3EGXB 1VQ4T 5GMKl 3CC2Q 3KFUA 4FM4B 1N6AA 1CKBA 1VOMA 1Q86U 2K5IA 2CDTA 3ZFJA 4NOYA 4EIKA 1NLPC 4DEXA 3LGFA 2XKOC 5I21A 1Q81C 1Q7YR 4X1VA 2K5LA 2LNHB 2M02A 4F7UA 2NUPB 4RQEA 3EFOA 2RJDA 2HSPA 3FJPA 2MWPA 4LUDA 4O6JA 3CC4Q 3JCMQ 1G5VA 3JCMW 4KGVB 3MEVA 5GANh 3CMEA 4MZTA 3VUBA 2DKGA 3CCUT 3PMIA 4J9FA 1VQZA 1FWZA 2E1HA 1WYXA 4LE9A 3FEOA 1ZUYA 1RAIB 1KQSP 4J7IA 2I4OA 3IALA 2LCCA 1NJIR 3E9HA 2IPOB 3VKIA 1SEMA 4J9HA 3CMAA 1BI0A 1RAAB 3CCQT 4OB1B 3TCJA 4BACA 4M78B 4E47A 1SRYA 2E3CA 4YRKA 2KQWA 2GTJA 3G6EA 1M3BA 1QP3A 5LJ3e 4K86A 2FHDA 2DERA 2NYSA 3J80E 1ZSZA 2D8HA 3REAB 3AHUA 1YI2A 3JAME 1VQNA 4YRSA 1NEGA 4QT7A 3ZL7C 1J3TA 2PMFA 5GAOn 4YP0A 3A7UA 3UATA 1OPKA 1Q95G 1QMCA 2YRDA 3E2UA 2KK4A 4RTZA 4FU6A 1Y07A 1KK7A 2DD4A 2VGNA 1OPLA 1I0CA 1VQ8Q 2PUOB 4C8QD 2DYBA 2K3BA 1V29B 3OS2A 3JCMe 3NELA 1JJCB 2ZT6A 3HHTB 3JCMc 1B7YA 2DXCA 5FU7B 2DRKA 4M75D 1M2VA 5KYXA 1TU0B 1WXTA 4Z8AA 4F16A 2RA2A 3E9GA 3O8VA 4UC4A 2HBPA 3IG2A 1GGMA 4J8OA 4D8KA 3RGLA 4M75E 2QK0A 3RBBB 4F7UG 4CI0C 3QXEB 4II1A 5C51B 1OU8A 2M51A 3CXCA 1GRIA 1KD1R 4HCCA 4M77D 2F69A 4J9EA 1KHCA 2KXCA 1YJ9T 1OX8A 1RAFB 3CBMA 3QZ9B 3CCET 3M0TA 4WTOB 3DKMA 1NNHA 2OTLT 3VJPA 4IIOA 3UDCA 4BB7A 2WSFE 2F1LA 3OYBA 4J6WA 2DXUA 1AWWA 3RF1A 2DL7A 1GBQA 3T9NA 1KIKA 2EYQA 5FLXE 1WZOA 5GJVB 1W70A 3LH0A 3UA7A 3MO8A 2PNIA 1UHFA 4Y91A 2MWOA 2XDBA 1OV3A 3RL6A 2XGTA 1PG5B 2KT8A 1TWBA 3CCJQ 2XICA 4QQGA 1YJNT 4C5HA 5CR2A 2J7IA 1H4SA 3M57A 3CCRT 1B70A 4ZGDB 1VQ5T 2KBTA 1D09B 2RO0A 1VQ9T 3MQZA 3UH0A 4Y92A 1NG2A 4A4KA 4M78C 4BE1A 3KFVA 3I55T 4OMNA 1SERA 1SG5A 2L3RA 1TUDA 2IY5B 1UDLA 4PHCA 1V1CA 2PVGB 3OYNA 3CD6T 2KNBB 3FLGA 5GAMg 2DBKA 4YRCA 1M1KR 1K9MC 2RQRA 3M0UA 2EQJA 3L42A 2P0QA 3UT1A 3HXXA 1Q82U 1RADB 3GOXA 2DTOA 1YNZA 1BKBA 5F5WA 4ZGJB 4WJ3M 1XQHA 2M1HA 3EH2A 1HC7A 1YJWQ 1YCYA 2A3LA 4JDSA 3RESA 3INZA 2CJ9A 2CH4A 1IL2A 3UWNA 1BIBA 5LJ5e 1GCPA 4CS2A 1RLPC 3X20B 1VQLT 3OYCA 3L4GB 5FROA 1OYXA 4XTXA 4C92F 1B34B 3HY0A 4TVWA 3M0PA 1YITQ 4E51A 1SETA 3CCLT 2ZPIB 3PNWC 1WJRA 2AK5A 2K9GA 1GCQA 4JRKA 1ZLMA 4ZNXA 5K1PA 4FT4A 1O75A 3CCMT 2LQKA 2DQ3A 4A4GA 1B8AA 2ENMA 2J6OA 4M75A 1T3LA 2RH2A 4FW1A 1Z9ZA 2EVRA 1K1ZA 3RNJA 1Y7XA 4LD9K 1UB4A 3REBB 5GAN5 1TSFA 1PC0A 2DYIA 1MMGA 2DL5A 2Z0WA 5AT1B 3MEUA 1VA7A 3QBYA 9ATCB 2X51A 4M7AF 4WF2A 4P73C 5L23A 3NMZC 1IXDA 3PTAA 1G2BA 2L8DA 1VQOA 3CCSQ 2JNGA 4ELZC 1VQNT 1WU7A 2MAMA 1HK9A 2QASA 2GBQA 4ZTJA 1N9SA 5GANg 1M8MA 5HY6A 4CC2A 4DBFA 1PKSA 3ZBDA 3SWNB 2Q7GA 4N4IA 3DLLA 1JRIA 5GAMd 5CVIA 1AZEA 1EFWA 1G5HA 4HWSA 1OI1A 2RJFA 2ZPHB 3P8YA 1ZQ1A 2DRMA 4C0FA 1KQ2A 3VQXA 2QQRA 3ULRB 2M0YA 2RNAA 5GAOr 2VB6A 1XOVA 2ARTA 4JRIA 2XK0A 3HP9A 1AT1B 4L5GA 2F5TX 1YHQA 4IUPA 2RN8A 1X2KA 2DM1A 3OD1A 3TSZA 4DOVA 2RHIA 4EX5A 2CP6A 1HD3A 5HKCA 4LVJA 3EG0A 4RMOA 2QEXA 1X27A 4YRQA 4FW2A 1IHVA 4YRJA 3X25B 2DU7A 1F1BB 1K76A 5C0MA 1I5OB 1M2OA 5IHKA 1UFFA 1GFDA 4ZTUB 3JRZA 4CC7A 3OYEA 3RKWA 1ZSZC 3JB9H 1NJ2A 2PQWA 1BK2A 1YFNA 2CH4W 2QG9B 4FYVB 3JCMb 4OP0A 4M78E 1MNDA 3JB9G 1ZX6A 1CSKA 2HQHA 5GMKi 1Q81R 3KXTA 1MV3A 4FYYB 3S3OA 1PD0A 4YCVA 4C92D 3NHNA 1HTTA 1M3AA 4Q5WA 2E5QA 2DX1A 1M1FA 3UGTA 1QCFA 1K8AR 1U1SA 4OB3B 2EQMA 3RKXA 5FU6C 1YFTA 5GMKh 1ZUKA 1ARKA 3A5ZB 2CS7A 1MV0B 1VQ4A 2DLPA 4NL3A 3TUPA 4M7DF 3URGA 3WVEB 4WI1A 3NGPA 4HVWA 1OZ3A 3SEMA 5I11A 3N5BB 5GANd 4C8QB 1KQSA 3C12A 1NJ6A 1QVGS 2FPEA 4K88A 1FYFA 1VQ6Q 1K73U 1IZ6A 3X24B 5M9OA 4M7AD 1C0AA 1X43A 3A74A 3QZ5B 1USYC 1WJQA 3UF4A 1OOTA 3A8MB 1Y96B 1G5IA 2Q7HA 3M54A 3OYFA 2DEUA 1IO6A 3SWNC 2GFAA 4FYXB 1U3OA 4PK4A 3CCUA 4O2DA 3HFNA 3PT9A 1M5Q1 5HGQA 2LMJA 3M5AA 1SHFA 4X9DA 3EGDA 1WIEA 1Q86C 3EGXA 4GBQA 4C0DB 2O01E 5KE3A 4RCBA 1Q7YU 1UGQB 2XMFA 1HSQA 3CCQA 3IKMB 1H4TA 4IUQA 4J9CA 4LVLA 4YRMA 3G4ST 2EQIA 2DVJA 2E12A 5E3IA 2PZ1A 2CJAA 2DFUA 2X3WD 2NUPA 2DXBA 4J6YA 3IKLA 1H4QA 1B3QA 4TVRA 2QHVA 1FMVA 4YREA 3VUZA 2QEXQ 2XU8A 4RTTA 5CIUA 1YIJT 3NTIA 4AG2C 2FZKB 2DJQA 2RHSB 1BCOA 2AKWB 2JM9A 2SRCA 4ATOA 4JZ3A 3A98A 1M90R 3QSUA 2CSIA 4LXCA 1NM7A 4L87A 2P0KA 3V8JA 3WXMB 4M4ZA 1NJ1A 1X75C 1D1BA 3EG3A 1YP5A 2R58A 2EWNA 3EHQA 4KUDK 3CQTA 1VQOT 4DA4A 2X4YA 1BB9A 2ZNJA 1D1AA 1C1AA 2QTXA 1EIYA 4M78A 1V76A 3CPWS 4HWPA 2O4XB 3M0QA 3CC7A 4JJBA 3VU3C 2ZCFB 1NLOC 4BI3A 1MMDA 1UUEA 4ANJA 1WI7A 5K1XA 4HXJA 3M4PA 2QHTA 3MF1A 1YWOA 2NLUA 4AMCA 1W66A 1VQ4Q 1SSHA 4DEYA 1QW1A 4C8QC 4M7DD 3CCEA 5D6WA 4MZPA 2KYBA 2JTEA 2OTLA 2YT6A 4HT8A 4YRRA 5HCKA 3ICAA 4LVMA 5GAMh 1KC8C 4PJJA 3MJXA 4M75C 1JJCA 3I7FA 2G3RA 4CH3A 2RI3A 2V1RA 3REUA 3QWXX 3VS2A 2QGFB 3M56A 1Z9QA 1VQPT 4P75C 1WQWA 5CKBA 3QYHB 2R5MA 8ATCB 1K9MR 3RKYA 3EFSA 2RM4A 4RG2A 4ME7A 2CZ6B 1ADYA 3JCMJ 4Z88A 5IXFA 4NS5A 3CCVQ 1KD1U 1E1TA 1YJNA 4TQDA 4M77C 1LOJA 2HCKA 2CIMA 3HFVA 3RERA 4RTUA 3LGLA 4NCXA 1VQ5A 2P0LA 2JOYA 1BBUA 3RMSA 4DBHA 1WHHA 5GAMf 1VYVA 2RK2A 2EGEA 2DZCA 3JB9I 5IT9E 1PCXA 2DIQA 2XHCA 2DEQA 1I07A 3VBBA 2O31A 3J81E 1KMNA 1S1NA 1ZHIA 3I35A 2LQNA 1M30A 1NPPA 1ZUUA 2COYA 4TTVA 2DJZA 2OI3A 2CYZB 1WXBA 2C06A 2Y4XA 2XI9A 1VIFA 3EG9B 2DL4A 2QHSA 4M78G 5J39A 2JVVA 2ZPBB 1YN8A 1M9SA 3JB9F 2JJ9A 3M4GA 3HY1A 1BIAA 2H3JA 5GAOp 4P3OA 3GNFB 4JS4A 3F70A 4B9WA 1EQRA 3IQLA 4X5OA 2HL3A 1TG0A 1MHNA 1JJ2S 1WGSA 3ME9A 3JV3A 1VQLA 2ED1A 2V26A 2CUBA 4UPAA 4RUGA 5CKEA 2OTJQ 1G3TA 1D0ZA 2NUZA 4JJCA 4E7HA 4A4FA 3CCLA 4J9DA 2KSSA 4MZMA 1QQJA 1N5ZA 2A36A 2RJCA 3CCMA 1QCOA 2RQTA 4PFZA 3MKDA 2P84A 4GY5A 2YHTA 4OMFB 2ODRD 4A54A 1MMNA 4QKUA 2ARUA 5GAOl 5FWCA 3HFZB 1UJYA 3GLXA 2R5AA 2R57A 2E3IA 1TS9A 1XTDA 2ROLA 1N8RU 1G3SA 4DBQA 5A0GA 3S3MA 4Q15A 1YJ9Q 3V8KA 1BI2A
chains in the Genus database with same CATH topology
2B8AA 3SD4A 5GANf 3HXUA 2ZPGB 1NE8A 4PJOF 1B34A 2DZ9A 3I56T 4C92B 1JB0E 1VQKA 4P3NA 1QVGA 2RHXA 2ZPFB 2FYKA 2JN0A 3QPHA 3A8HB 5AYFA 4QVZA 4HWOA 5FRMA 2DVEA 2XDPA 3CC2T 4VUBA 2JUFA 4C8QE 4PNOA 3HPWA 2V8JA 3OYLA 2CZ7B 3CC7T 1UGPB 2EIFA 4V2SA 1I8FA 4YPFA 4M7AB 1UGRB 2AMCB 3UFGA 1KQSS 3CC4T 1NZ9A 1USYA 4KR2A 4Z02A 4M77E 1WNLA 3SWNA 2XIDA 3A32A 4QQDA 3LYIA 4ZN1A 4Q6GA 4O5VA 5LL6S 2D9TA 3HRKA 3JCMP 1IREB 3QDRB 3J7AF 1NJ5A 2FVUA 1UEBA 3CBPA 3G71A 4BDZA 1QF6A 1JBMA 4BUGA 2LCLA 3QO8A 1DJ7B 5LJ3j 5CQXA 3CPWA 1VIEA 2E64A 3GF5A 2DD5A 2EKOA 2E5AA 2RB6A 4PLLA 4IUUA 1VQ8T 2V8IA 3NEMA 5CK9A 4PLIA 3DLMA 3FDRA 1MGQA 4C92C 2M16A 1P92A 1K8AU 3X26B 2KDSA 4PJOD 4QQ6A 3M4QA 1HXDA 5GAN2 4JJNK 3GP8A 2ZR2A 5EG2A 3BW1A 5LJ3h 1B76A 5FU7C 3META 3L2WA 4IURA 3PCOA 4YRTA 1NPRA 3A8LB 4M7DB 4ZTZB 4J7FA 3HL8A 1YGBA 1PSEA 2G4CA 3S3NA 3LSQA 4C8QA 3G4SA 3HSBA 4M7AC 1X56A 2QQ9A 1K73C 4J6XA 2K3XA 3JCMh 3OBWA 4B9XA 4XU0A 1ATIA 4G85A 1YIJA 5HK0A 3MP8A 4KBMB 2EAYA 4P75A 1I81A 4CH5A 2KAFA 5J3BA 2ZZGA 3A31A 2HAXA 4XTYA 2BIVA 2K3YA 4M77A 2CJBA 1EIFA 1Q7YC 1X01A 3W3SA 4C0ZA 1H641 2QA4A 2PMEA 1JJ2A 1VQKT 2LTOA 5DLQE 3MEWA 4BW9A 2RD1A 4TQFA 2QQSA 5GAN6 4R56A 1M4ZA 1M90U 2RHSA 3OMCA 2AKWA 2HNIA 3LWHA 2DQ0A 2X4JA 3JB9J 4L6V5 3OS1A 4HWRA 1PSFA 1VQPA 3BY7A 2HD0A 3M58A 4XTWA 5LJ5j 4E7LA 4JLGA 2K4YA 2E65A 4C8QG 3HRTA 2A8EA 1X54A 2O4XA 4LDVA 3SFMA 4EPCA 4M75G 4MMKA 2C7IA 3PMTA 4MMLA 4F7UF 5CCAA 2E41A 4M7DC 5GMKm 1PYSA 4OGCA 2AHJB 3HXZA 1Z7MA 3QO5A 3A7RA 3L2ZA 2ZINA 4P5NA 1D3BA 2M9UA 2DPPB 4M77G 4TVYA 2YLCA 4C92E 5LJ5h 3G71T 4N4HA 2DTHA 3MHXA 2WSCE 4XK8E 4ZGEB 2RI5A 2J3LA 3E1SA 3JCMX 1N27A 3BDLA 2DXTA 3CPFA 2JTFA 2VXFA 5ELNA 2MF2A 2RHQB 3X28B 4JRQA 4RQFA 1KQ1A 3TU4K 2EFIA 1RL2A 3C4SA 3ASKA 4CS3A 4N0AA 2LC4A 4M7AE 4HKEA 2ZXFA 4YCWA 11ASA 1Z7NA 2RK1A 2OAUA 2LT1A 2X4XA 3QO7A 3UPUA 4OLFA 5KH6A 3EFRA 3H8ZA 3VV0A 4AH6A 1S72A 1BBWA 3TEHB 4EO4A 2VUBA 1M8VA 2XDDA 3E19A 4DPGA 2ZIOA 2V8KA 2RHYA 3I56A 4BDYA 2ODRC 1KOGA 5LJ3g 1BYMA 1NJIU 3NFCA 3GIBA 5I2MA 3CC2A 3C94A 2KMTA 3HFZA 2C8MA 3FB9A 1I5LA 2EQKA 1N8RC 2Y90A 3RUXA 4FL6A 4H02A 2QA4T 4QVDA 1U1TA 3A7AA 2DAQA 2GF7A 5GANe 4CS4A 2E6NA 4LNSA 1H4VB 3JCMg 3P8BB 2DU5A 2ZTGA 3OYMA 3CEYA 4C92A 3CC4A 4PJOB 2P4TA 3M53A 4H2SA 1G3WA 1X2GA 3V8LA 4QVCA 5DLOA 3V7CA 3QO3A 2I4MA 3PIPA 4M7DE 4ELYC 2LDMA 2PUKB 3VYGA 2XTIA 4RCCA 3L2UA 3DSQA 4PG3A 5CKDA 2EQUA 3CBOA 2CZ0B 1EOVA 4E7IA 3A8OB 5FRNA 4OGEA 1EVKA 1X55A 1WPYA 1ZBXA 4QW2A 3VQYA 3HRSA 1TH7A 3RIRA 4C0DC 2RHUA 4M7AA 3L2VA 4EMKB 2AMCA 3H6ZA 4JLIA 5GAN4 2ZT7A 3R6OA 4DQ2A 4EMGA 1AHJB 1SESA 1VQ8A 3OSVA 3QTCA 1VUBA 1N9WA 1N9RA 2GFUA 1M1GA 4L59A 5LJ3d 4X9CA 2E70A 5D6XA 2QXFA 1QVFS 4X34A 2D6FA 5GAN8 4H2YA 3NTKA 3C95A 4HA8A 2IVWA 4C92G 3JCMd 2KVQG 2E10A 3P8VA 1LJOA 4C5IA 2QQAA 2GCXA 1M1KU 1WJSA 2IY5A 1X2HA 3OQ5A 1OZ2A 3VYHB 1VQMT 3BJUA 5LJ5g 1Q82C 4PJOC 2BKDN 2X4WA 1K8AC 5KE2A 5I2SA 4P72C 3ZEHA 4YRNA 3CCJA 3L1AA 1KMMA 2XG8D 3S6WA 4M7AG 3OMGA 3QJYA 3CCVT 4H2XB 4UP8A 4MDXA 5DY9A 5HK3A 1S72T 2ZNIA 3RACA 4XAXB 3L4GA 3VQWA 2K57A 4E7JA 1RIQA 3QYGB 4M7DA 3M55A 4XU1A 5IN1A 3LW5E 3V7RA 5CQYA 1EIYB 2ALYB 4LDUA 4EMKC 4E7KA 2FL7A 3OYDA 5J26A 3MF2A 4JS5A 2XD0A 4H2TA 4N0AC 1ASYA 3KBGA 1YJWA 1G51A 4LVKA 4YROA 4YCUA 4IKFA 4TVAB 5CO7A 4YRIA 3HXWA 3ER0A 4Y28E 1KC8U 4XTUA 2EJGA 4P74A 2OTJT 2K5FA 2YLBA 1YITA 3OB9A 3HXYA 2PU9B 5CKFA 3JB9D 2QHUA 2LQ8A 1FX7A 2LVMA 1M90C 3TEEA 5LJ5d 4BY6B 3OYYA 1BI1A 2CKKA 1E22A 3QHSA 4BI4A 1NYRA 4A4HA 2RI2A 5KCOA 4P3PA 4M7DG 3CCSA 1VQ7T 3OW2S 2ZZFA 4BD3A 2CGHA 2MMPA 1EVLA 2PVOB 4RKUE 1GXIE 3LLRA 1R8OB 1Q81U 4PL6A 2IG0A 3A8GB 4F7UB 3Q1JA 4HCZA 3WQZA 3RMQA 4BE0A 3P8HA 3TEGA 3PGGA 2VV5A 5GAN7 4PJOE 2KY9A 1H3ZA 3A5ZA 3OYKA 1LNXA 3HTZA 4XEOA 4WJ4A 4HWTA 1QE0A 1YB3A 3OYIA 4D6WA 4M78F 1E24A 3NENA 5C52B 2VC8A 3QNEA 2RHQA 5ELOA 3CMQA 5GMKe 2A7YA 1UGSB 2X35A 5D6YA 3VQVA 4P71A 5LJ3f 1YFRA 4ZIBA 1WQ7A 3WVDB 1Y96A 4IUTA 4UP9A 3OA6A 1ADJA 4YYEA 2MI6A 4TWAA 1U8RA 4J15A 1W2BS 3CCJT 4KULA 3CMET 4N4GA 3PIOA 3KUFA 4BY6C 4LVIA 1QVFA 1YFSA 4K87A 2ZPEB 4XQ3A 2JTMA 2L89A 4G84A 5FU6B 4EDUA 4H2WA 1NYQA 1B7YB 3QUIA 2QQBA 4HT4A 3OYJA 3JCMf 3HFOA 3OSSC 3CMAT 3OS5A 3PZCA 4GLKA 3FC3A 5A2QE 5KNNA 3UGQA 3G6ET 4KQEA 2GQVA 3TEHA 3OS0A 4YRLA 1VQ6A 4IUVA 1LYLA 3V7SA 3GNGA 3PFSA 2WACA 4JUVA 1YI2T 4H2UA 1BI3A 3MCAB 1YJWT 1NJIC 2ARSA 2P0PA 1O9SA 4HCBA 3LX7A 4XU3A 4XEMA 4CH4A 5DM7R 2VXEA 4PKCC 2I2LA 3BDUA 1YITT 5C6SA 2EJ9A 1QP2A 2HQXA 2QDYB 2ZZDA 2YRVA 1B70B 2BUDA 2M0OA 2DDZA 1G3YA 3HRUA 5GMKj 3E9FA 4PJOA 5C53B 3QKJA 2Q5IA 4BWAA 3MEAA 4P72A 4FIBA 1E1OA 12ASA 2DO3A 2ZT5A 4M78D 1W4SA 2K2VA 5CAIA 3CCST 1K9MU 4CH6A 2DTIA 4MDWA 1WYDA 4FT2A 1KD1C 3OYGA 4BE2A 2ZT8A 5GAMe 3JSCA 5CKHA 4KR3A 3BFMA 4EMKA 4P74C 1J5WA 5GAOm 4OB2B 3M9QA 2E6ZA 3PCOB 4RDXA 5LJ5f 3L2QA 4HT9A 4YRPA 2ZCEA 2LT4A 2EJFA 1SSFA 3NTHA 1KHIA 2FB7A 5IAYA 1L0WA 1VQMA 4BI8B 1X6OA 4FSXA 2I4LA 3HRIA 3G7ZA 2I4NA 4LDYA 4YDQA 4M75B 3REXA 4KT0E 3QIIA 2L5QA 3DB4A 1YBYA 5A0DA 4XTVA 4C0GA 3CCVA 2HQEA 3MP6A 5GAN3 3OW2A 4C5EA 4OB0B 4H2VA 3LSSA 4PJOG 5L8RE 1KG1A 4JRPA 4KUIA 2DK3A 4M77B 3OY9A 3FRNA 3OBYA 1M1KC 3QG1A 3M59A 4DOWA 3CXCS 4XTZA 3LWIA 4J83A 2DIGA 4XU2A 4LDWA 4ZN3A 2JZ2A 4RMFA 5A0LA 3G1ZA 3L2RA 4J5YA 3HXVA 4H2XA 4LD6A 1WLEA 1NJ8A 3QJ6A 4F7UE 4C5GA 3EAEA 3OYHA 4YRFA 1VQ6T 3A5YA 2VGMA 4ZTFA 4YTLA 2P5IA 3TREA 1Y71A 5GAMj 2OTJA 3SDZA 4OVAA 2EL9A 3R07A 2ALYA 3M4YA 2VYTA 3ERRA 1ASZA 2ZR3A 2RHZA 3HKSA 4HVCA 4P71C 2Q7EA 2ZGWA 3P8DA 1W2BA 1PYSB 4R55A 3FIFA 4YRGA 1YJ9A 4EMHA 3NETA 4TVAA 2Q5HA 1D3BB 2ZIMA 4A53A 1YHQT 5KCHA 4NL2A 1RI0A 2WSEE 2QEXT 1VQ7A 2LRQA 3E9IA 3MEYA 4LDXA 2D0QB 2J3MA 2PVDB 4C8QF 3P8TA 3SB2A 3MP1A 2NS6A 1XNIA 3DB3A 3CCRA 5GAOq 2Y4YA 4CRIA 4M75F 4OF1A 1VQ9A 1FXXA 3LC0A 3I55A 2CZ1B 2LX9A 3OYAA 2QI2A 3GPLA 2F5KA 1I4K1 3CD6A 4A4EA 4RG8A 5GANj 2LNVA 2ZZEA 2RJEA 1QVPA 4M77F 3JCMV 4UP7A 4P73A 1VQ4T 5GMKl 3KFUA 4FM4B 1N6AA 1Q86U 2K5IA 3ZFJA 4NOYA 3LGFA 2XKOC 5I21A 1Q81C 2K5LA 4F7UA 4RQEA 2RJDA 3FJPA 2MWPA 4O6JA 3JCMQ 1G5VA 3JCMW 3MEVA 5GANh 3CMEA 4MZTA 3VUBA 2DKGA 3CCUT 3PMIA 1VQZA 1FWZA 2E1HA 3FEOA 4J7IA 2I4OA 3IALA 2LCCA 3E9HA 3VKIA 3CMAA 1BI0A 3CCQT 4OB1B 3TCJA 4BACA 4M78B 4E47A 1SRYA 2E3CA 4YRKA 2KQWA 3G6EA 1QP3A 5LJ3e 4K86A 2FHDA 3J80E 3AHUA 1YI2A 3JAME 1VQNA 4YRSA 2PMFA 5GAOn 4YP0A 3A7UA 2KK4A 4FU6A 1Y07A 2VGNA 2DD4A 2PUOB 4C8QD 1V29B 3OS2A 3JCMe 3NELA 1JJCB 2ZT6A 3HHTB 3JCMc 1B7YA 2DXCA 5FU7B 4M75D 2RA2A 3E9GA 3O8VA 4UC4A 2HBPA 3IG2A 1GGMA 4J8OA 3RGLA 4M75E 4F7UG 4CI0C 3QXEB 4II1A 5C51B 3CXCA 4HCCA 4M77D 2F69A 1KHCA 1YJ9T 3CBMA 3QZ9B 3CCET 3DKMA 1NNHA 2OTLT 3VJPA 3UDCA 4BB7A 2WSFE 3OYBA 4J6WA 2DXUA 3RF1A 3T9NA 2EYQA 5FLXE 3LH0A 3MO8A 4Y91A 2MWOA 2XDBA 3RL6A 2XGTA 2XICA 4QQGA 1YJNT 4C5HA 5CR2A 1H4SA 3M57A 3CCRT 1B70A 4ZGDB 1VQ5T 2RO0A 1VQ9T 3MQZA 3UH0A 4A4KA 4BE1A 4M78C 3I55T 1SERA 2L3RA 2IY5B 4PHCA 2PVGB 3OYNA 3CD6T 3FLGA 5GAMg 4YRCA 1K9MC 2EQJA 3L42A 2P0QA 3UT1A 3HXXA 1Q82U 3GOXA 2DTOA 1BKBA 5F5WA 4ZGJB 4WJ3M 1XQHA 2M1HA 1HC7A 1YCYA 2A3LA 4JDSA 3RESA 3INZA 2CJ9A 1IL2A 3UWNA 1BIBA 5LJ5e 4CS2A 3X20B 1VQLT 3OYCA 3L4GB 5FROA 1OYXA 4XTXA 4C92F 1B34B 3HY0A 4TVWA 4E51A 1SETA 3CCLT 2ZPIB 3PNWC 1WJRA 4JRKA 5K1PA 4FT4A 1O75A 3CCMT 2LQKA 2DQ3A 4A4GA 1B8AA 4M75A 2RH2A 1Y7XA 4LD9K 1UB4A 5GAN5 3MEUA 3QBYA 4M7AF 4WF2A 4P73C 3PTAA 2L8DA 1VQOA 2JNGA 4ELZC 1VQNT 1WU7A 2MAMA 1HK9A 4ZTJA 1N9SA 5GANg 5HY6A 3ZBDA 3SWNB 2Q7GA 4N4IA 3DLLA 1JRIA 5GAMd 5CVIA 1EFWA 1G5HA 4HWSA 1OI1A 2RJFA 2ZPHB 3P8YA 1ZQ1A 4C0FA 1KQ2A 3VQXA 2QQRA 5GAOr 1XOVA 2ARTA 4JRIA 2XK0A 3HP9A 4L5GA 2F5TX 1YHQA 4IUPA 3OD1A 4DOVA 2RHIA 4EX5A 5HKCA 4LVJA 4RMOA 2QEXA 4YRQA 4YRJA 3X25B 2DU7A 5C0MA 4ZTUB 3JRZA 3OYEA 3RKWA 3JB9H 1NJ2A 2PQWA 3JCMb 4OP0A 4M78E 3JB9G 5GMKi 3KXTA 3S3OA 4YCVA 4C92D 1HTTA 4Q5WA 2E5QA 1M1FA 3UGTA 1U1SA 4OB3B 2EQMA 3RKXA 5FU6C 1YFTA 5GMKh 3A5ZB 2CS7A 1VQ4A 4NL3A 3TUPA 4M7DF 3URGA 3WVEB 4WI1A 1OZ3A 3N5BB 5GANd 4C8QB 1KQSA 3C12A 1NJ6A 1QVGS 4K88A 1FYFA 1K73U 1IZ6A 3X24B 5M9OA 4M7AD 1C0AA 3A74A 3QZ5B 1USYC 1WJQA 3A8MB 1Y96B 1G5IA 2Q7HA 3M54A 3OYFA 3SWNC 2GFAA 3CCUA 4O2DA 3HFNA 3PT9A 1M5Q1 5HGQA 3M5AA 4X9DA 1Q86C 4C0DB 2O01E 5KE3A 4RCBA 1Q7YU 1UGQB 3CCQA 3IKMB 1H4TA 4IUQA 4LVLA 4YRMA 3G4ST 2E12A 5E3IA 2CJAA 3IKLA 2DXBA 4J6YA 1H4QA 4TVRA 2QHVA 4YREA 3VUZA 2XU8A 5CIUA 1YIJT 3NTIA 2RHSB 2AKWB 4ATOA 3QSUA 4L87A 2P0KA 3V8JA 3WXMB 1NJ1A 1X75C 2R58A 2EWNA 4KUDK 1VQOT 4DA4A 2X4YA 2ZNJA 2QTXA 1EIYA 4M78A 3CPWS 4HWPA 2O4XB 3CC7A 3VU3C 2ZCFB 4BI3A 5K1XA 3M4PA 2QHTA 3MF1A 2NLUA 1W66A 1QW1A 4C8QC 4M7DD 3CCEA 5D6WA 4MZPA 2OTLA 4YRRA 4HT8A 3ICAA 4LVMA 5GAMh 1KC8C 4M75C 1JJCA 3I7FA 2G3RA 4CH3A 2RI3A 3REUA 1VQPT 3M56A 4P75C 1WQWA 5CKBA 3QYHB 2R5MA 3RKYA 3EFSA 2RM4A 4RG2A 4ME7A 2CZ6B 1ADYA 3JCMJ 4NS5A 1KD1U 1E1TA 1YJNA 4TQDA 4M77C 1LOJA 2CIMA 3HFVA 3RERA 3LGLA 4NCXA 1VQ5A 2P0LA 2JOYA 1BBUA 3RMSA 5GAMf 2RK2A 2DZCA 3JB9I 5IT9E 2DIQA 2XHCA 2DEQA 3VBBA 3J81E 1KMNA 1ZHIA 1NPPA 4TTVA 2DJZA 2CYZB 2C06A 2Y4XA 2XI9A 1VIFA 2QHSA 4M78G 5J39A 2JVVA 2ZPBB 1M9SA 3JB9F 3M4GA 3HY1A 1BIAA 2H3JA 5GAOp 4P3OA 3GNFB 4JS4A 3F70A 4B9WA 1EQRA 4X5OA 1MHNA 1JJ2S 1WGSA 3ME9A 1VQLA 4UPAA 5CKEA 1G3TA 4E7HA 4A4FA 3CCLA 2KSSA 4MZMA 2RJCA 3CCMA 4GY5A 4OMFB 2ODRD 2YHTA 4A54A 2ARUA 5GAOl 3HFZB 3GLXA 2R5AA 2R57A 1XTDA 1N8RU 1G3SA 5A0GA 3S3MA 4Q15A 3V8KA 1BI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  4C92 A;  4PJO B;  5F5W A;  4WJ3 M;  5CAI A;  5GAN f;  4H2S A;  3HXU A;  1HC7 A;  1X2G A;  1YCY A;  3V8L A;  4CH6 A;  3RES A;  4PJO F;  4QVC A;  3INZ A;  1B34 A;  2CJ9 A;  3V7C A;  2DTI A;  3QO3 A;  2I4M A;  1IL2 A;  2DZ9 A;  4M7D E;  1BIB A;  4C92 B;  5LJ5 e;  4P3N A;  1WYD A;  2FYK A;  4CS2 A;  2JN0 A;  3L4G B;  4XTX A;  2XTI A;  4RCC A;  4C92 F;  2ZT8 A;  1B34 B;  5GAM e;  3HY0 A;  4TVW A;  4HWO A;  3DSQ A;  4PG3 A;  4KR3 A;  3BFM A;  4EMK A;  4E51 A;  4P74 C;  1EOV A;  2DVE A;  1SET A;  1J5W A;  5GAO m;  1EVK A;  1X55 A;  3PCO B;  1WPY A;  3VQY A;  4C8Q E;  4JRK A;  4RDX A;  5K1P A;  1TH7 A;  3RIR A;  4PNO A;  5LJ5 f;  4M7A A;  4HT9 A;  2DQ3 A;  2ZCE A;  4YRP A;  4EMK B;  1B8A A;  2AMC A;  2EJF A;  4M75 A;  4JLI A;  5GAN 4;  2ZT7 A;  4DQ2 A;  4EMG A;  2FB7 A;  1L0W A;  4V2S A;  1I8F A;  1SES A;  4YPF A;  5GAN 5;  4M7A B;  2I4L A;  3HRI A;  2I4N A;  2AMC B;  4YDQ A;  4M75 B;  3REX A;  3QTC A;  1N9W A;  3UFG A;  1N9R A;  4M7A F;  4WF2 A;  5LJ3 d;  4P73 C;  1USY A;  4X9C A;  4KR2 A;  4M77 E;  4XTV A;  1WNL A;  3SWN A;  5GAN 3;  3A32 A;  4H2V A;  1WU7 A;  3LSS A;  4Q6G A;  1HK9 A;  4PJO G;  5GAN 8;  4H2Y A;  1N9S A;  5GAN g;  4M77 B;  3SWN B;  2Q7G A;  4HA8 A;  1JRI A;  3HRK A;  5GAM d;  3JCM P;  1EFW A;  1G5H A;  4HWS A;  4C92 G;  3JCM d;  4XTZ A;  1NJ5 A;  3P8Y A;  1KQ2 A;  3VQX A;  2E10 A;  3P8V A;  1LJO A;  4XU2 A;  5GAO r;  2ART A;  1QF6 A;  4JRI A;  1JBM A;  2IY5 A;  3QO8 A;  5LJ3 j;  4RMF A;  1X2H A;  3G1Z A;  2E64 A;  4J5Y A;  3OD1 A;  3BJU A;  4EX5 A;  5LJ5 g;  3HXV A;  4PJO C;  4H2X A;  1WLE A;  2E5A A;  1NJ8 A;  4YRQ A;  4F7U E;  2RB6 A;  4P72 C;  4YRJ A;  3NEM A;  2DU7 A;  4YRF A;  4YRN A;  3A5Y A;  2P5I A;  3L1A A;  1KMM A;  1MGQ A;  4ZTU B;  4C92 C;  5GAM j;  3RKW A;  4M7A G;  4H2X B;  4UP8 A;  3JB9 H;  5DY9 A;  1NJ2 A;  2EL9 A;  3R07 A;  2ZNI A;  2ALY A;  4PJO D;  3M4Q A;  3RAC A;  1HXD A;  3JCM b;  5GAN 2;  4OP0 A;  4M78 E;  3L4G A;  2ZR2 A;  3ERR A;  3VQW A;  3JB9 G;  2K57 A;  3BW1 A;  1ASZ A;  1RIQ A;  5LJ3 h;  4M7D A;  2ZR3 A;  4HVC A;  5GMK i;  4XU1 A;  4P71 C;  1B76 A;  2Q7E A;  2ZGW A;  3V7R A;  1EIY B;  4YCV A;  4C92 D;  1HTT A;  2ALY B;  3PCO A;  1PYS B;  3UGT A;  4EMK C;  1U1S A;  3RKX A;  4YRT A;  3FIF A;  4YRG A;  1YFT A;  4M7D B;  5GMK h;  4ZTZ B;  4EMH A;  1YGB A;  2G4C A;  3NET A;  3MF2 A;  4TVA A;  3LSQ A;  4C8Q A;  4NL3 A;  3TUP A;  2Q5H A;  1D3B B;  3HSB A;  4M7A C;  1X56 A;  4M7D F;  2ZIM A;  4H2T A;  4N0A C;  4A53 A;  4WI1 A;  1ASY A;  4J6X A;  3JCM h;  1G51 A;  4NL2 A;  4YRO A;  4YCU A;  5GAN d;  4XU0 A;  1ATI A;  4G85 A;  4TVA B;  4C8Q B;  3E9I A;  3MEY A;  4YRI A;  1NJ6 A;  3HXW A;  2EAY A;  4K88 A;  2J3M A;  1FYF A;  4P75 A;  1I81 A;  4CH5 A;  4C8Q F;  4XTU A;  4M7A D;  2EJG A;  4P74 A;  1C0A A;  3P8T A;  3A74 A;  1USY C;  3SB2 A;  2YLB A;  2ZZG A;  3A31 A;  1Y96 B;  1G5I A;  2Q7H A;  5GAO q;  4XTY A;  3SWN C;  3HXY A;  4M75 F;  4M77 A;  2CJB A;  4O2D A;  3JB9 D;  3HFN A;  3LC0 A;  2QHU A;  1X01 A;  1M5Q 1;  5HGQ A;  3W3S A;  1H64 1;  4X9D A;  2PME A;  5LJ5 d;  1I4K 1;  4BW9 A;  4RCB A;  2RD1 A;  4TQF A;  5GAN j;  2ZZE A;  4M77 F;  1E22 A;  5GAN 6;  3JCM V;  1H4T A;  3IKM B;  4UP7 A;  4P73 A;  4YRM A;  5GMK l;  3KFU A;  3QHS A;  1NYR A;  2RHS A;  4NOY A;  2AKW A;  5E3I A;  4P3P A;  2CJA A;  4M7D G;  3IKL A;  4J6Y A;  1H4Q A;  2HNI A;  2DQ0 A;  2QHV A;  4YRE A;  5I21 A;  2ZZF A;  3JB9 J;  2CGH A;  2RHS B;  2AKW B;  1EVL A;  4HWR A;  4F7U A;  3QSU A;  3BY7 A;  4RQE A;  4L87 A;  4XTW A;  5LJ5 j;  3FJP A;  2E65 A;  4C8Q G;  3V8J A;  3JCM Q;  1X54 A;  1NJ1 A;  3JCM W;  5GAN h;  2DKG A;  2EWN A;  4F7U B;  1VQZ A;  2E1H A;  2ZNJ A;  4M75 G;  3WQZ A;  4MMK A;  2QTX A;  2C7I A;  1EIY A;  4M78 A;  4MML A;  4F7U F;  2I4O A;  4M7D C;  2E41 A;  3IAL A;  5GMK m;  4HWP A;  1PYS A;  3VU3 C;  3HXZ A;  3TEG A;  3E9H A;  3PGG A;  1Z7M A;  3QO5 A;  5GAN 7;  4PJO E;  5K1X A;  3A7R A;  3M4P A;  3L2Z A;  3A5Z A;  1LNX A;  2QHT A;  3HTZ A;  2ZT5 A;  4XEO A;  4WJ4 A;  2ZIN A;  4M78 B;  2E3C A;  1SRY A;  3MF1 A;  4HWT A;  1QE0 A;  1D3B A;  4YRK A;  1W66 A;  1YB3 A;  5LJ3 e;  4M77 G;  4K86 A;  4TVY A;  2YLC A;  4M78 F;  4C8Q C;  4C92 E;  1E24 A;  5LJ5 h;  4M7D D;  3NEN A;  2DTH A;  3AHU A;  5C52 B;  2VC8 A;  4YRR A;  4HT8 A;  4YRS A;  3QNE A;  2RHQ A;  3ICA A;  5ELO A;  5GAM h;  3CMQ A;  4M75 C;  2PMF A;  1JJC A;  5GMK e;  5GAO n;  3I7F A;  4YP0 A;  3A7U A;  4CH3 A;  2J3L A;  3REU A;  3JCM X;  3VQV A;  4P71 A;  2DXT A;  5LJ3 f;  1YFR A;  2VXF A;  5ELN A;  4ZIB A;  1WQ7 A;  1Y96 A;  4P75 C;  4UP9 A;  1WQW A;  4C8Q D;  1ADJ A;  4YYE A;  2RHQ B;  3JCM e;  4TWA A;  4J15 A;  3NEL A;  1JJC B;  2ZT6 A;  4RQF A;  1KQ1 A;  3RKY A;  3JCM c;  3EFS A;  1B7Y A;  2RM4 A;  1ADY A;  3JCM J;  1E1T A;  4TQD A;  4M75 D;  1LOJ A;  4M77 C;  2CIM A;  3HFV A;  1YFS A;  4K87 A;  2RA2 A;  3RER A;  3IG2 A;  4N0A A;  4CS3 A;  4NCX A;  4XQ3 A;  4M7A E;  1GGM A;  4G84 A;  2P0L A;  1BBU A;  4H2W A;  3RGL A;  1NYQ A;  4M75 E;  1B7Y B;  5GAM f;  3QUI A;  2ZXF A;  4F7U G;  2DZC A;  3JB9 I;  3JCM f;  4YCW A;  3HFO A;  5C51 B;  11AS A;  1Z7N A;  2DEQ A;  3PZC A;  3VBB A;  5KNN A;  1KMN A;  3UGQ A;  3QO7 A;  4KQE A;  4M77 D;  4TTV A;  3TEH A;  2DJZ A;  4OLF A;  4YRL A;  1LYL A;  3V7S A;  3EFR A;  4JUV A;  2QHS A;  4M78 G;  1NNH A;  4AH6 A;  1BBW A;  3JB9 F;  3TEH B;  4EO4 A;  3M4G A;  4J6W A;  2DXU A;  3HY1 A;  4H2U A;  1M8V A;  1BIA A;  3RF1 A;  5GAO p;  4P3O A;  2ARS A;  1EQR A;  4DPG A;  2ZIO A;  4X5O A;  4XU3 A;  4XEM A;  4CH4 A;  4Y91 A;  2ODR C;  1KOG A;  3RL6 A;  2XGT A;  2VXE A;  4UPA A;  2I2L A;  5LJ3 g;  3GIB A;  3BDU A;  1H4S A;  1B70 A;  2EJ9 A;  3HFZ A;  2C8M A;  3FB9 A;  1I5L A;  3UH0 A;  4M78 C;  2Y90 A;  3RUX A;  1SER A;  2ODR D;  2YHT A;  4H02 A;  3A7A A;  4QVD A;  1U1T A;  4A54 A;  4CS4 A;  5GAN e;  1B70 B;  4LNS A;  2ARU A;  5GAO l;  2IY5 B;  2DDZ A;  3HFZ B;  1H4V B;  4PHC A;  5GMK j;  4PJO A;  5C53 B;  5GAM g;  2Q5I A;  4BWA A;  4YRC A;  4P72 A;  3JCM g;  1E1O A;  12AS A;  4Q15 A;  2DU5 A;  2ZTG A;  3V8K A;  3HXX A;  4M78 D; 
#chains in the Genus database with same CATH topology
 2B8A A;  2COW A;  1WA7 A;  5KYW B;  1SKU B;  4CC4 B;  3SD4 A;  5GAN f;  2D0N A;  1AWX A;  3HXU A;  2ZPG B;  1GL5 A;  1NE8 A;  4PJO F;  1B34 A;  1VQ7 Q;  2LP5 A;  2DZ9 A;  3I56 T;  4C92 B;  1JB0 E;  1VQK A;  4P3N A;  1GBR A;  1W1F A;  1QVG A;  2RHX A;  2ZPF B;  2FYK A;  4ESR A;  2JN0 A;  1UGV A;  1WXU A;  1D1C A;  3QPH A;  3A8H B;  5AYF A;  4QVZ A;  4HWO A;  5FRM A;  3CCR Q;  2DVE A;  1K0S A;  2XDP A;  3CC2 T;  4VUB A;  2JUF A;  4C8Q E;  1VQ9 Q;  1QWE A;  2KE9 A;  2DNU A;  4PNO A;  3I55 Q;  2I0N A;  3HPW A;  2V8J A;  3OYL A;  1UTI A;  1Y57 A;  2CZ7 B;  3CC7 T;  1UGP B;  3CD6 Q;  1EFN A;  4DBR A;  1IGQ A;  2EIF A;  4V2S A;  1I8F A;  2L3S A;  4YPF A;  4M7A B;  1UGR B;  1UJ0 A;  2AMC B;  2LQW A;  3UA6 A;  3UFG A;  1KQS S;  2LJ0 A;  1LPL A;  3CC4 T;  1NZ9 A;  2VAS A;  1USY A;  3VS3 A;  4KR2 A;  4Z02 A;  4M77 E;  1GFC A;  1WNL A;  3SWN A;  1AZG B;  3GBQ A;  2XID A;  3A32 A;  4QQD A;  3LYI A;  4ZN1 A;  4Q6G A;  4R0K A;  1RAB B;  4O5V A;  2SEM A;  5LL6 S;  1QKW A;  2FPF A;  2D9T A;  4LN2 A;  1RLQ C;  5EC7 A;  1B7T A;  3HRK A;  3JCM P;  1IRE B;  3QDR B;  3J7A F;  1NJ5 A;  2KR3 A;  3CME Q;  4HCK A;  5IH2 A;  2FVU A;  1UEB A;  3CBP A;  3G1J A;  2ATC B;  2IIM A;  3G71 A;  4BDZ A;  1QF6 A;  1JBM A;  4BUG A;  2LCL A;  3QO8 A;  1DJ7 B;  1X6G A;  5LJ3 j;  5CQX A;  3CPW A;  1W2B P;  2C0I A;  1VIE A;  2E64 A;  2LCS A;  3GF5 A;  2C0O A;  2DD5 A;  1TXQ A;  3PVQ A;  3CMA Q;  2EKO A;  2E5A A;  2RB6 A;  4PLL A;  4IUU A;  1VQ8 T;  2V8I A;  3NEM A;  3G6E Q;  2K2M A;  2A0F B;  1KSW A;  2A37 A;  4GLM A;  4PLI A;  5CK9 A;  3DLM A;  3FDR A;  1MGQ A;  4C92 C;  2M16 A;  1P92 A;  2HL5 C;  3VRY A;  1K8A U;  3EFO B;  1EX4 A;  1YI2 Q;  1WHL A;  2E5K A;  3X26 B;  4Z89 A;  1VQN Q;  2MIO A;  2KDS A;  4PJO D;  3EG2 A;  4QQ6 A;  8AT1 B;  3M4Q A;  1HXD A;  5GAN 2;  4JJN K;  3GP8 A;  2ZR2 A;  5EG2 A;  3BW1 A;  1OX9 A;  5LJ3 h;  1B76 A;  2GGR A;  5FU7 C;  3MET A;  2W0Z A;  3L2W A;  4IUR A;  3PCO A;  3EHR A;  1TOV A;  1ZA1 B;  1T0H A;  4YRT A;  1E6H A;  1NPR A;  2ABL A;  3A8L B;  4M7D B;  4FYW B;  2MCN A;  4J7F A;  4ZTZ B;  2EYZ A;  3HL8 A;  1YGB A;  1PSE A;  2FO0 A;  3S3N A;  2G4C A;  3LSQ A;  4C8Q A;  3G4S A;  3HSB A;  4M7A C;  1X56 A;  2QQ9 A;  1K73 C;  4J6X A;  2K3X A;  3JCM h;  3OBW A;  2LZ6 B;  4B9X A;  4XU0 A;  1ATI A;  4G85 A;  1RAE B;  2EPD A;  1K4U S;  1YIJ A;  2B86 A;  2YUO A;  5HK0 A;  2V1Q A;  3MP8 A;  4KBM B;  2EAY A;  4P75 A;  1I81 A;  4CH5 A;  2KAF A;  2HKN A;  5J3B A;  2DET A;  2ED0 A;  2ZZG A;  3A31 A;  3A1P A;  1E6G A;  2HAX A;  4XTY A;  2BIV A;  2K3Y A;  4J9G A;  4M77 A;  2CJB A;  1EIF A;  3MPU B;  1Q7Y C;  3TSW A;  1R0C B;  1X01 A;  3W3S A;  2KRS A;  4C0Z A;  5KYX B;  1H64 1;  2QA4 A;  1KC8 R;  2PME A;  1WHJ A;  1JJ2 A;  1VQK T;  2LTO A;  5DLQ E;  3MEW A;  3QWY A;  1Y0M A;  4BW9 A;  1BCM A;  2RD1 A;  4TQF A;  2QQS A;  2C0T A;  5GAN 6;  4R56 A;  1M4Z A;  1M90 U;  1PRL C;  2RHS A;  3OMC A;  2AKW A;  1NEB A;  2MPX C;  2HNI A;  3LWH A;  2DQ0 A;  2X4J A;  3EGU A;  3JB9 J;  1D0X A;  4L6V 5;  1VYT A;  2AIR B;  3D7S B;  3OS1 A;  4LUE A;  1KFZ A;  4HWR A;  2HEQ A;  1PSF A;  1VQP A;  3VRZ A;  1JEG A;  3BY7 A;  2HD0 A;  3M58 A;  2HMA A;  4XTW A;  1G8X A;  1WHG A;  5LJ5 j;  2L0A A;  4JLG A;  4E7L A;  2K4Y A;  2E65 A;  4C8Q G;  3HRT A;  1WHM A;  1X54 A;  2A8E A;  2O4X A;  4LDV A;  3SFM A;  2KGT A;  3VS7 A;  4EPC A;  4M75 G;  4MMK A;  2C7I A;  2QGG A;  3PMT A;  4MML A;  4F7U F;  5CCA A;  2E41 A;  4M7D C;  5GMK m;  1PYS A;  4OGC A;  2AHJ B;  3HXZ A;  1Z7M A;  3QO5 A;  1YCS B;  3A7R A;  3L2Z A;  1D0Y A;  2ZIN A;  4P5N A;  1D3B A;  2M9U A;  3O5Z A;  2DPP B;  4M77 G;  4TVY A;  2YLC A;  1FYN A;  3H9N A;  4C92 E;  5LJ5 h;  1SPK A;  4N4H A;  4AFQ C;  3G71 T;  2GTO A;  2DTH A;  3MHX A;  1ABQ A;  3CXC P;  2RQV A;  4J9I A;  2EGA A;  4LNP A;  2WSC E;  4XK8 E;  4ZGE B;  2YWW A;  2RI5 A;  2J3L A;  3E1S A;  3JCM X;  1N27 A;  3BDL A;  2DXT A;  3CPF A;  2JTF A;  1AVZ C;  2VXF A;  4RTX A;  5ELN A;  2MF2 A;  2EBP A;  2RHQ B;  3X28 B;  4JRQ A;  4RQF A;  1KQ1 A;  3TU4 K;  1I1J A;  2EFI A;  1VQO Q;  2AT1 B;  1RL2 A;  1M27 C;  1HYO A;  3C4S A;  3ASK A;  4CS3 A;  4N0A A;  2KRO A;  2LC4 A;  2RQW A;  4M7A E;  1WDX A;  4HKE A;  1LVK A;  2ZXF A;  2MK5 A;  4YCW A;  3EG9 A;  11AS A;  1Z7N A;  2RK1 A;  2OAU A;  2LT1 A;  1H3H A;  2X4X A;  3QO7 A;  3UPU A;  4OLF A;  5KH6 A;  3EFR A;  1MUZ A;  2VVK A;  3H8Z A;  5FW9 A;  3VV0 A;  4AH6 A;  1S72 A;  1BBW A;  3TEH B;  4EO4 A;  1YHQ Q;  2VUB A;  1M8V A;  2XDD A;  3E19 A;  4DPG A;  2ZIO A;  2V8K A;  2RHY A;  2CP7 A;  3I56 A;  1NYF A;  4BDY A;  2ODR C;  4PJN A;  1KOG A;  2CSQ A;  5LJ3 g;  1BYM A;  1NJI U;  3NFC A;  3GIB A;  1IRX A;  5I2M A;  3CC2 A;  3C94 A;  2KMT A;  3HFZ A;  2C8M A;  3FB9 A;  1I5L A;  2F2V A;  4OMQ A;  2EQK A;  1N8R C;  2FG0 A;  2E3H A;  2Y90 A;  3RUX A;  4FL6 A;  2HDA A;  2QA4 T;  4QVD A;  1U1T A;  3A7A A;  2DAQ A;  2GF7 A;  5GAN e;  4H02 A;  2E6N A;  4LNS A;  4CS4 A;  3VS0 A;  1H4V B;  2GQI A;  2BTT A;  2KXD A;  1M3C A;  1WHK A;  1QVF P;  3JCM g;  3P8B B;  2DU5 A;  2ZTG A;  3OYM A;  3CEY A;  4C92 A;  3CC4 A;  4PJO B;  2P4T A;  2JT4 A;  3M53 A;  5KYY B;  4H2S A;  1G3W A;  1X2G A;  3V8L A;  4QVC A;  1X2Q A;  2EYW A;  5DLO A;  2O9V A;  3V7C A;  3QO3 A;  2I4M A;  3PIP A;  4M7D E;  4ELY C;  2LDM A;  2PUK B;  1SHG A;  2YXY A;  3VYG A;  1IB8 A;  2JS2 A;  2XTI A;  4RCC A;  3L2U A;  3DSQ A;  4PG3 A;  5CKD A;  2EQU A;  3CBO A;  5D7U A;  2CZ0 B;  1EOV A;  2DL8 A;  4E7I A;  3A8O B;  5FRN A;  4OGE A;  1EVK A;  3CCU Q;  1X55 A;  1WPY A;  1ZBX A;  4QW2 A;  3VQY A;  1UEC A;  2DE0 X;  3HRS A;  3I5S A;  1TH7 A;  3RIR A;  4C0D C;  6AT1 B;  4CC3 A;  2RHU A;  3PVL A;  4M7A A;  3L2V A;  1PRM C;  4EMK B;  2AMC A;  3H6Z A;  4JLI A;  5GAN 4;  2ZT7 A;  3R6O A;  2QDL A;  4DQ2 A;  2FZG B;  4EMG A;  2EGC A;  2O9S A;  2QTV A;  1AHJ B;  4OMO A;  3VS4 A;  1SES A;  3CCQ Q;  1WFW A;  4OMM A;  1VQ8 A;  3OSV A;  3QTC A;  1VUB A;  1N9W A;  1N9R A;  3H0H A;  2GFU A;  1M1G A;  5KYU B;  2BZ8 A;  4L59 A;  2JMA A;  5LJ3 d;  2FPD A;  3M0S A;  4X9C A;  2E70 A;  3NPF A;  5D6X A;  2QXF A;  1QVF S;  3RR6 A;  4X34 A;  2D6F A;  4E6R A;  1PHT A;  5GAN 8;  4H2Y A;  3NTK A;  2LJ3 A;  3C95 A;  1SRL A;  2J05 A;  1WLP B;  1KJW A;  4HA8 A;  2IVW A;  1RAG B;  2ECZ A;  3THK A;  4C92 G;  3JCM d;  2KRM A;  2KVQ G;  2E10 A;  3P8V A;  1LJO A;  4C5I A;  1ZSG A;  2QQA A;  2GCX A;  4AFS C;  2NUT B;  4RTW A;  1M1K U;  1AWJ A;  1WJS A;  2IY5 A;  1X2H A;  3OQ5 A;  1IHW A;  3CC7 Q;  1FMK A;  1OZ2 A;  1A0N B;  1TUC A;  3VYH B;  1VQM T;  3BE3 A;  3BJU A;  3H0F A;  5LJ5 g;  4HVV A;  1Q82 C;  4PJO C;  2BKD N;  2X4W A;  2EKH A;  1K8A C;  5KE2 A;  5I2S A;  4P72 C;  3LH5 A;  3ZEH A;  4YRN A;  1W6X A;  3CCJ A;  3L1A A;  3I5R A;  1KMM A;  1FMW A;  1G83 A;  2VKN A;  1EZZ B;  2XG8 D;  3S6W A;  3CCE Q;  3OMG A;  3QJY A;  3CCV T;  4M7A G;  4H2X B;  4UP8 A;  2RMO A;  4MDX A;  5DY9 A;  2HBW A;  5GJW B;  2OTL Q;  5HK3 A;  1S72 T;  2ZNI A;  5IXB A;  2AKL A;  3RAC A;  4XAX B;  2D1X A;  3L4G A;  3VQW A;  2K57 A;  4ORZ A;  4E7J A;  1RIQ A;  3QYG B;  4M7D A;  1JU5 C;  3M55 A;  4XU1 A;  5IN1 A;  3LW5 E;  3V7R A;  1PKT A;  5CQY A;  1EIY B;  2ALY B;  4LDU A;  4JZ4 A;  4EMK C;  4E7K A;  4A63 B;  3OW2 P;  2FL7 A;  2VWF A;  1YJN Q;  3OYD A;  2BE9 B;  5J26 A;  3MF2 A;  4JS5 A;  1VQ5 Q;  1X69 A;  2XD0 A;  4H2T A;  4N0A C;  1ASY A;  3KBG A;  3VS5 A;  1YJW A;  1XJW B;  1G51 A;  4LVK A;  4YRO A;  2EYY A;  4YCU A;  4IKF A;  4TVA B;  5CO7 A;  4E7S A;  1QWF A;  4YRI A;  3HXW A;  2JM8 A;  3ER0 A;  4Y28 E;  1T0J A;  2F2X A;  1KC8 U;  4XTU A;  2EJG A;  4P74 A;  2OTJ T;  2K5F A;  2YLB A;  2NWM A;  1YIT A;  4JPB W;  3OB9 A;  3HXY A;  2PU9 B;  2L3Q A;  5CKF A;  1RAC B;  3JB9 D;  2QHU A;  2LQ8 A;  2QAZ A;  1FX7 A;  2CT3 A;  2DMO A;  2LVM A;  2J6K A;  2OJ2 A;  1M90 C;  3TEE A;  5LJ5 d;  4BY6 B;  2YUP A;  2JMC A;  1VQL Q;  2RF0 A;  3OYY A;  2COZ A;  2E4H A;  1BI1 A;  2CKK A;  1E22 A;  2KI7 A;  1H8K A;  3CCL Q;  3QHS A;  4BI4 A;  1NYR A;  4A4H A;  2CP5 A;  2RI2 A;  1QCN A;  5KCO A;  4P3P A;  3CCM Q;  4M7D G;  1CKA A;  3CCS A;  2DA9 A;  2LX7 A;  1VQ7 T;  3OW2 S;  2ZZF A;  3VS6 A;  4BD3 A;  2CGH A;  1JXO A;  2MMP A;  1EVL A;  1IGU A;  2FRY A;  2PVO B;  4RKU E;  1GXI E;  1Q86 R;  3AT1 B;  4AT1 B;  3LLR A;  1R8O B;  1Q81 U;  4PL6 A;  2IG0 A;  3A8G B;  4F7U B;  2FRW A;  2W10 A;  3Q1J A;  4HCZ A;  4AG1 C;  2K7A A;  3WQZ A;  3RMQ A;  1C6V X;  1VQK Q;  4BE0 A;  1ABO A;  4WCI A;  3P8H A;  3TEG A;  3PGG A;  4FSS A;  2CT4 A;  2VV5 A;  5GAN 7;  4PJO E;  2KY9 A;  1H3Z A;  3A5Z A;  3OYK A;  1LNX A;  3HTZ A;  4KH0 B;  4XEO A;  4WJ4 A;  4HWT A;  2HZY A;  1QE0 A;  3TVT A;  1YB3 A;  4IIM A;  3OYI A;  1PWT A;  1R0B G;  4D6W A;  4M78 F;  1E24 A;  3NEN A;  5C52 B;  2VC8 A;  2AZS A;  2J6F A;  3QNE A;  2RHQ A;  1N8R R;  5ELO A;  3CMQ A;  4F14 A;  2O88 A;  5GMK e;  4E7Z A;  2A7Y A;  1ZSZ B;  1UGS B;  1RUW A;  2X35 A;  5D6Y A;  3VQV A;  4RTV A;  4P71 A;  1AWO A;  2JS0 A;  2QYZ A;  5LJ3 f;  1YFR A;  4ZIB A;  1WQ7 A;  3WVD B;  3H41 A;  1Y96 A;  4IUT A;  4UP9 A;  2DL3 A;  3OA6 A;  1ADJ A;  4B6M A;  4YYE A;  2MI6 A;  4TWA A;  1U8R A;  4J15 A;  2L2P A;  1W2B S;  3CCJ T;  4KUL A;  3CME T;  1NYG A;  4N4G A;  5IHI A;  3PIO A;  2MYS A;  3KUF A;  4BY6 C;  4LVI A;  1QVF A;  1E7O A;  1YFS A;  4K87 A;  1MMA A;  4D8D A;  2ZPE B;  4XQ3 A;  1OQK A;  2JTM A;  2L89 A;  3C0C A;  4G84 A;  5FU6 B;  4EDU A;  4H2W A;  1NYQ A;  1B7Y B;  3QUI A;  2QQB A;  4PFP A;  4HT4 A;  1R77 A;  3OYJ A;  3JCM f;  1M2V B;  3HFO A;  2PTK A;  3OSS C;  3CMA T;  3OS5 A;  3PZC A;  4GLK A;  3FC3 A;  2JW4 A;  5A2Q E;  5KNN A;  3UGQ A;  3G6E T;  4KQE A;  2GQV A;  1RI9 A;  3TEH A;  2X9H A;  3OS0 A;  4YRL A;  2DIL A;  4IUV A;  1VQ6 A;  3V7S A;  1LYL A;  4E2F B;  3GNG A;  3G71 Q;  3PFS A;  3FJ5 A;  2CUD A;  2DBM A;  2HKQ B;  2L3P A;  2WAC A;  4JUV A;  5IHN A;  2RQU A;  1YI2 T;  2FEI A;  4H2U A;  2LJ1 A;  1BI3 A;  3MCA B;  2H3E B;  1YJW T;  1NJI C;  2ARS A;  2P0P A;  1C0M A;  1O9S A;  4HCB A;  3LX7 A;  3RDV A;  4XU3 A;  4XEM A;  3U23 A;  2J06 A;  4CH4 A;  3M0R A;  4F17 A;  5DM7 R;  2VXE A;  4PKC C;  4RTY A;  2I2L A;  2KYM A;  3BDU A;  1YIT T;  4FCY A;  5C6S A;  2EJ9 A;  1QP2 A;  2HQX A;  1QVG P;  1WX6 A;  2KT1 A;  2QDY B;  2ZZD A;  1K0X A;  4PJM A;  2YRV A;  2RPN A;  1B70 B;  2BUD A;  2M0O A;  2DDZ A;  1G3Y A;  2MOX A;  3HRU A;  5GMK j;  3E9F A;  4PJO A;  5C53 B;  2G6F X;  3QKJ A;  2Q5I A;  4BWA A;  3MEA A;  4P72 A;  5KYY A;  1ZA2 B;  4FIB A;  1E1O A;  12AS A;  2DO3 A;  1PD1 A;  2KRN A;  4KH1 B;  2ZT5 A;  4M78 D;  1JO8 A;  1W4S A;  3G4S Q;  2K2V A;  5CAI A;  3SHW A;  3CCS T;  1JQQ A;  1OUL A;  1K9M U;  4CH6 A;  3H0I A;  2K6D A;  2DTI A;  1AD5 A;  4MDW A;  1YIJ Q;  2KEA A;  1WYD A;  1TTH B;  4FT2 A;  1VYU A;  1Q82 R;  1KD1 C;  3OYG A;  4BE2 A;  1OU9 A;  2ZT8 A;  5GAM e;  3JSC A;  1NBE B;  5CKH A;  1AOJ A;  3BFM A;  4EMK A;  4KR3 A;  4P74 C;  1J5W A;  5GAO m;  1BU1 A;  4OB2 B;  1ACM B;  3M9Q A;  2E6Z A;  3PCO B;  4J9B A;  1QLY A;  4RDX A;  5LJ5 f;  3L2Q A;  4HT9 A;  4YRP A;  2ZCE A;  1OEB A;  2LT4 A;  2QA4 Q;  2EJF A;  1SSF A;  5KYU A;  1UE9 A;  3NTH A;  1KHI A;  5I22 A;  2FB7 A;  5IAY A;  1L0W A;  1VQM A;  4BI8 B;  1X6O A;  4FSX A;  2I4L A;  3HRI A;  3G7Z A;  2I4N A;  4LDY A;  4YDQ A;  4M75 B;  3REX A;  4KT0 E;  3CPW P;  3QII A;  2L5Q A;  3TQ7 P;  3DB4 A;  1YBY A;  5A0D A;  2ZAE A;  4AFU C;  2D8J A;  4XTV A;  4C0G A;  3CCV A;  2CP0 A;  2HQE A;  3MP6 A;  3HTR A;  5GAN 3;  3OW2 A;  2YRC A;  2GNC A;  4C5E A;  4OB0 B;  4H2V A;  4JJD A;  3LSS A;  4PJO G;  5L8R E;  1KG1 A;  4JRP A;  2BE7 D;  2BZY A;  4KUI A;  2DK3 A;  4M77 B;  3OY9 A;  3FRN A;  3I9Q A;  3OBY A;  1VQP Q;  1M1K C;  3QG1 A;  3M59 A;  2NUT A;  3VS1 A;  3R6N A;  2BZX A;  4DOW A;  3CXC S;  4XTZ A;  3LWI A;  7AT1 B;  4J83 A;  2DIG A;  1JXM A;  3PE0 A;  2ROT A;  4XU2 A;  1TUG B;  4LDW A;  2ESW A;  1B07 A;  4ZN3 A;  2JZ2 A;  4RMF A;  1LCK A;  5A0L A;  2CRE A;  3G1Z A;  3L2R A;  4J5Y A;  1MNE A;  2X3X D;  3HXV A;  4H2X A;  2HSE B;  4LD6 A;  1WLE A;  1NJ8 A;  5ECA A;  3QJ6 A;  4F7U E;  1RAH B;  4AFZ C;  1YWP A;  4C5G A;  2K79 A;  5KYW A;  3EAE A;  3OYH A;  4YRF A;  2CP3 A;  1VQ6 T;  3A5Y A;  2A28 A;  2VGM A;  4YTL A;  4ZTF A;  2P5I A;  3TRE A;  1Y71 A;  5GAM j;  2OTJ A;  3SDZ A;  2YUN A;  2CP2 A;  4OVA A;  1HJD A;  2EL9 A;  3R07 A;  2ALY A;  3M4Y A;  2VYT A;  3ERR A;  1ASZ A;  2OX7 A;  2ZR3 A;  2RHZ A;  3HKS A;  4HVC A;  1U5S A;  4P71 C;  2Q7E A;  2ZGW A;  3P8D A;  2DF6 A;  2JXB A;  2A08 A;  1W2B A;  1PM3 A;  1PYS B;  1UG1 A;  3FIF A;  4R55 A;  4YRG A;  1U06 A;  2AKK A;  4KGX B;  1GCQ C;  1YJ9 A;  2FZC B;  4EMH A;  1JJ2 P;  3NET A;  4TVA A;  2EYX A;  1D3B B;  2Q5H A;  1BBZ A;  1SF9 A;  2ZIM A;  4A53 A;  4PJL A;  1YHQ T;  2AZV A;  5KCH A;  1H92 A;  1VQM Q;  2YDL A;  1PNJ A;  4NL2 A;  1RI0 A;  2WSE E;  4K11 A;  2QEX T;  1VQ7 A;  2LRQ A;  3E9I A;  3MEY A;  4LDX A;  2YSQ A;  3EH1 A;  2D0Q B;  1SRM A;  4KRT A;  4F04 B;  2J3M A;  1K9A A;  2PVD B;  1UHC A;  4C8Q F;  3P8T A;  1X6B A;  3SB2 A;  3MP1 A;  2NS6 A;  1XNI A;  3DB3 A;  3CCR A;  5GAO q;  2Y4Y A;  1S72 Q;  4CRI A;  4OMP A;  4PFO A;  1AEY A;  2OAW A;  2YUQ A;  4M75 F;  4OML A;  4OF1 A;  2F2W A;  1VQ9 A;  1FXX A;  3LC0 A;  3I55 A;  2CZ1 B;  2LX9 A;  3EG1 A;  1QKX A;  4KGZ B;  2P4R A;  3OYA A;  2O2O A;  1ZBJ A;  2QI2 A;  1K73 R;  3I56 Q;  3GPL A;  2F5K A;  5FWB A;  1I4K 1;  3CD6 A;  4A4E A;  4RG8 A;  1T3S A;  3QDF A;  2EW3 A;  5GAN j;  2LNV A;  2ZZE A;  2RJE A;  1QVP A;  4M77 F;  2H8H A;  3JCM V;  3EGD B;  4HVU A;  4UP7 A;  4P73 A;  5KYN A;  3EGX B;  1VQ4 T;  5GMK l;  3CC2 Q;  3KFU A;  4FM4 B;  1N6A A;  1CKB A;  1VOM A;  1Q86 U;  2K5I A;  2CDT A;  3ZFJ A;  4NOY A;  4EIK A;  1NLP C;  4DEX A;  3LGF A;  2XKO C;  5I21 A;  1Q81 C;  1Q7Y R;  4X1V A;  2K5L A;  2LNH B;  2M02 A;  4F7U A;  2NUP B;  4RQE A;  3EFO A;  2RJD A;  2HSP A;  3FJP A;  2MWP A;  4LUD A;  4O6J A;  3CC4 Q;  3JCM Q;  1G5V A;  3JCM W;  4KGV B;  3MEV A;  5GAN h;  3CME A;  4MZT A;  3VUB A;  2DKG A;  3CCU T;  3PMI A;  4J9F A;  1VQZ A;  1FWZ A;  2E1H A;  1WYX A;  4LE9 A;  3FEO A;  1ZUY A;  1RAI B;  1KQS P;  4J7I A;  2I4O A;  3IAL A;  2LCC A;  1NJI R;  3E9H A;  2IPO B;  3VKI A;  1SEM A;  4J9H A;  3CMA A;  1BI0 A;  1RAA B;  3CCQ T;  4OB1 B;  3TCJ A;  4BAC A;  4M78 B;  4E47 A;  1SRY A;  2E3C A;  4YRK A;  2KQW A;  2GTJ A;  3G6E A;  1M3B A;  1QP3 A;  5LJ3 e;  4K86 A;  2FHD A;  2DER A;  2NYS A;  3J80 E;  1ZSZ A;  2D8H A;  3REA B;  3AHU A;  1YI2 A;  3JAM E;  1VQN A;  4YRS A;  1NEG A;  4QT7 A;  3ZL7 C;  1J3T A;  2PMF A;  5GAO n;  4YP0 A;  3A7U A;  3UAT A;  1OPK A;  1Q95 G;  1QMC A;  2YRD A;  3E2U A;  2KK4 A;  4RTZ A;  4FU6 A;  1Y07 A;  1KK7 A;  2DD4 A;  2VGN A;  1OPL A;  1I0C A;  1VQ8 Q;  2PUO B;  4C8Q D;  2DYB A;  2K3B A;  1V29 B;  3OS2 A;  3JCM e;  3NEL A;  1JJC B;  2ZT6 A;  3HHT B;  3JCM c;  1B7Y A;  2DXC A;  5FU7 B;  2DRK A;  4M75 D;  1M2V A;  5KYX A;  1TU0 B;  1WXT A;  4Z8A A;  4F16 A;  2RA2 A;  3E9G A;  3O8V A;  4UC4 A;  2HBP A;  3IG2 A;  1GGM A;  4J8O A;  4D8K A;  3RGL A;  4M75 E;  2QK0 A;  3RBB B;  4F7U G;  4CI0 C;  3QXE B;  4II1 A;  5C51 B;  1OU8 A;  2M51 A;  3CXC A;  1GRI A;  1KD1 R;  4HCC A;  4M77 D;  2F69 A;  4J9E A;  1KHC A;  2KXC A;  1YJ9 T;  1OX8 A;  1RAF B;  3CBM A;  3QZ9 B;  3CCE T;  3M0T A;  4WTO B;  3DKM A;  1NNH A;  2OTL T;  3VJP A;  4IIO A;  3UDC A;  4BB7 A;  2WSF E;  2F1L A;  3OYB A;  4J6W A;  2DXU A;  1AWW A;  3RF1 A;  2DL7 A;  1GBQ A;  3T9N A;  1KIK A;  2EYQ A;  5FLX E;  1WZO A;  5GJV B;  1W70 A;  3LH0 A;  3UA7 A;  3MO8 A;  2PNI A;  1UHF A;  4Y91 A;  2MWO A;  2XDB A;  1OV3 A;  3RL6 A;  2XGT A;  1PG5 B;  2KT8 A;  1TWB A;  3CCJ Q;  2XIC A;  4QQG A;  1YJN T;  4C5H A;  5CR2 A;  2J7I A;  1H4S A;  3M57 A;  3CCR T;  1B70 A;  4ZGD B;  1VQ5 T;  2KBT A;  1D09 B;  2RO0 A;  1VQ9 T;  3MQZ A;  3UH0 A;  4Y92 A;  1NG2 A;  4A4K A;  4M78 C;  4BE1 A;  3KFV A;  3I55 T;  4OMN A;  1SER A;  1SG5 A;  2L3R A;  1TUD A;  2IY5 B;  1UDL A;  4PHC A;  1V1C A;  2PVG B;  3OYN A;  3CD6 T;  2KNB B;  3FLG A;  5GAM g;  2DBK A;  4YRC A;  1M1K R;  1K9M C;  2RQR A;  3M0U A;  2EQJ A;  3L42 A;  2P0Q A;  3UT1 A;  3HXX A;  1Q82 U;  1RAD B;  3GOX A;  2DTO A;  1YNZ A;  1BKB A;  5F5W A;  4ZGJ B;  4WJ3 M;  1XQH A;  2M1H A;  3EH2 A;  1HC7 A;  1YJW Q;  1YCY A;  2A3L A;  4JDS A;  3RES A;  3INZ A;  2CJ9 A;  2CH4 A;  1IL2 A;  3UWN A;  1BIB A;  5LJ5 e;  1GCP A;  4CS2 A;  1RLP C;  3X20 B;  1VQL T;  3OYC A;  3L4G B;  5FRO A;  1OYX A;  4XTX A;  4C92 F;  1B34 B;  3HY0 A;  4TVW A;  3M0P A;  1YIT Q;  4E51 A;  1SET A;  3CCL T;  2ZPI B;  3PNW C;  1WJR A;  2AK5 A;  2K9G A;  1GCQ A;  4JRK A;  1ZLM A;  4ZNX A;  5K1P A;  4FT4 A;  1O75 A;  3CCM T;  2LQK A;  2DQ3 A;  4A4G A;  1B8A A;  2ENM A;  2J6O A;  4M75 A;  1T3L A;  2RH2 A;  4FW1 A;  1Z9Z A;  2EVR A;  1K1Z A;  3RNJ A;  1Y7X A;  4LD9 K;  1UB4 A;  3REB B;  5GAN 5;  1TSF A;  1PC0 A;  2DYI A;  1MMG A;  2DL5 A;  2Z0W A;  5AT1 B;  3MEU A;  1VA7 A;  3QBY A;  9ATC B;  2X51 A;  4M7A F;  4WF2 A;  4P73 C;  5L23 A;  3NMZ C;  1IXD A;  3PTA A;  1G2B A;  2L8D A;  1VQO A;  3CCS Q;  2JNG A;  4ELZ C;  1VQN T;  1WU7 A;  2MAM A;  1HK9 A;  2QAS A;  2GBQ A;  4ZTJ A;  1N9S A;  5GAN g;  1M8M A;  5HY6 A;  4CC2 A;  4DBF A;  1PKS A;  3ZBD A;  3SWN B;  2Q7G A;  4N4I A;  3DLL A;  1JRI A;  5GAM d;  5CVI A;  1AZE A;  1EFW A;  1G5H A;  4HWS A;  1OI1 A;  2RJF A;  2ZPH B;  3P8Y A;  1ZQ1 A;  2DRM A;  4C0F A;  1KQ2 A;  3VQX A;  2QQR A;  3ULR B;  2M0Y A;  2RNA A;  5GAO r;  2VB6 A;  1XOV A;  2ART A;  4JRI A;  2XK0 A;  3HP9 A;  1AT1 B;  4L5G A;  2F5T X;  1YHQ A;  4IUP A;  2RN8 A;  1X2K A;  2DM1 A;  3OD1 A;  3TSZ A;  4DOV A;  2RHI A;  4EX5 A;  2CP6 A;  1HD3 A;  5HKC A;  4LVJ A;  3EG0 A;  4RMO A;  2QEX A;  1X27 A;  4YRQ A;  4FW2 A;  1IHV A;  4YRJ A;  3X25 B;  2DU7 A;  1F1B B;  1K76 A;  5C0M A;  1I5O B;  1M2O A;  5IHK A;  1UFF A;  1GFD A;  4ZTU B;  3JRZ A;  4CC7 A;  3OYE A;  3RKW A;  1ZSZ C;  3JB9 H;  1NJ2 A;  2PQW A;  1BK2 A;  1YFN A;  2CH4 W;  2QG9 B;  4FYV B;  3JCM b;  4OP0 A;  4M78 E;  1MND A;  3JB9 G;  1ZX6 A;  1CSK A;  2HQH A;  5GMK i;  1Q81 R;  3KXT A;  1MV3 A;  4FYY B;  3S3O A;  1PD0 A;  4YCV A;  4C92 D;  3NHN A;  1HTT A;  1M3A A;  4Q5W A;  2E5Q A;  2DX1 A;  1M1F A;  3UGT A;  1QCF A;  1K8A R;  1U1S A;  4OB3 B;  2EQM A;  3RKX A;  5FU6 C;  1YFT A;  5GMK h;  1ZUK A;  1ARK A;  3A5Z B;  2CS7 A;  1MV0 B;  1VQ4 A;  2DLP A;  4NL3 A;  3TUP A;  4M7D F;  3URG A;  3WVE B;  4WI1 A;  3NGP A;  4HVW A;  1OZ3 A;  3SEM A;  5I11 A;  3N5B B;  5GAN d;  4C8Q B;  1KQS A;  3C12 A;  1NJ6 A;  1QVG S;  2FPE A;  4K88 A;  1FYF A;  1VQ6 Q;  1K73 U;  1IZ6 A;  3X24 B;  5M9O A;  4M7A D;  1C0A A;  1X43 A;  3A74 A;  3QZ5 B;  1USY C;  1WJQ A;  3UF4 A;  1OOT A;  3A8M B;  1Y96 B;  1G5I A;  2Q7H A;  3M54 A;  3OYF A;  2DEU A;  1IO6 A;  3SWN C;  2GFA A;  4FYX B;  1U3O A;  4PK4 A;  3CCU A;  4O2D A;  3HFN A;  3PT9 A;  1M5Q 1;  5HGQ A;  2LMJ A;  3M5A A;  1SHF A;  4X9D A;  3EGD A;  1WIE A;  1Q86 C;  3EGX A;  4GBQ A;  4C0D B;  2O01 E;  5KE3 A;  4RCB A;  1Q7Y U;  1UGQ B;  2XMF A;  1HSQ A;  3CCQ A;  3IKM B;  1H4T A;  4IUQ A;  4J9C A;  4LVL A;  4YRM A;  3G4S T;  2EQI A;  2DVJ A;  2E12 A;  5E3I A;  2PZ1 A;  2CJA A;  2DFU A;  2X3W D;  2NUP A;  2DXB A;  4J6Y A;  3IKL A;  1H4Q A;  1B3Q A;  4TVR A;  2QHV A;  1FMV A;  4YRE A;  3VUZ A;  2QEX Q;  2XU8 A;  4RTT A;  5CIU A;  1YIJ T;  3NTI A;  4AG2 C;  2FZK B;  2DJQ A;  2RHS B;  1BCO A;  2AKW B;  2JM9 A;  2SRC A;  4ATO A;  4JZ3 A;  3A98 A;  1M90 R;  3QSU A;  2CSI A;  4LXC A;  1NM7 A;  4L87 A;  2P0K A;  3V8J A;  3WXM B;  4M4Z A;  1NJ1 A;  1X75 C;  1D1B A;  3EG3 A;  1YP5 A;  2R58 A;  2EWN A;  3EHQ A;  4KUD K;  3CQT A;  1VQO T;  4DA4 A;  2X4Y A;  1BB9 A;  2ZNJ A;  1D1A A;  1C1A A;  2QTX A;  1EIY A;  4M78 A;  1V76 A;  3CPW S;  4HWP A;  2O4X B;  3M0Q A;  3CC7 A;  4JJB A;  3VU3 C;  2ZCF B;  1NLO C;  4BI3 A;  1MMD A;  1UUE A;  4ANJ A;  1WI7 A;  5K1X A;  4HXJ A;  3M4P A;  2QHT A;  3MF1 A;  1YWO A;  2NLU A;  4AMC A;  1W66 A;  1VQ4 Q;  1SSH A;  4DEY A;  1QW1 A;  4C8Q C;  4M7D D;  3CCE A;  5D6W A;  4MZP A;  2KYB A;  2JTE A;  2OTL A;  2YT6 A;  4HT8 A;  4YRR A;  5HCK A;  3ICA A;  4LVM A;  5GAM h;  1KC8 C;  4PJJ A;  3MJX A;  4M75 C;  1JJC A;  3I7F A;  2G3R A;  4CH3 A;  2RI3 A;  2V1R A;  3REU A;  3QWX X;  3VS2 A;  2QGF B;  3M56 A;  1Z9Q A;  1VQP T;  4P75 C;  1WQW A;  5CKB A;  3QYH B;  2R5M A;  8ATC B;  1K9M R;  3RKY A;  3EFS A;  2RM4 A;  4RG2 A;  4ME7 A;  2CZ6 B;  1ADY A;  3JCM J;  4Z88 A;  5IXF A;  4NS5 A;  3CCV Q;  1KD1 U;  1E1T A;  1YJN A;  4TQD A;  4M77 C;  1LOJ A;  2HCK A;  2CIM A;  3HFV A;  3RER A;  4RTU A;  3LGL A;  4NCX A;  1VQ5 A;  2P0L A;  2JOY A;  1BBU A;  3RMS A;  4DBH A;  1WHH A;  5GAM f;  1VYV A;  2RK2 A;  2EGE A;  2DZC A;  3JB9 I;  5IT9 E;  1PCX A;  2DIQ A;  2XHC A;  2DEQ A;  1I07 A;  3VBB A;  2O31 A;  3J81 E;  1KMN A;  1S1N A;  1ZHI A;  3I35 A;  2LQN A;  1M30 A;  1NPP A;  1ZUU A;  2COY A;  4TTV A;  2DJZ A;  2OI3 A;  2CYZ B;  1WXB A;  2C06 A;  2Y4X A;  2XI9 A;  1VIF A;  3EG9 B;  2DL4 A;  2QHS A;  4M78 G;  5J39 A;  2JVV A;  2ZPB B;  1YN8 A;  1M9S A;  3JB9 F;  2JJ9 A;  3M4G A;  3HY1 A;  1BIA A;  2H3J A;  5GAO p;  4P3O A;  3GNF B;  4JS4 A;  3F70 A;  4B9W A;  1EQR A;  3IQL A;  4X5O A;  2HL3 A;  1TG0 A;  1MHN A;  1JJ2 S;  1WGS A;  3ME9 A;  3JV3 A;  1VQL A;  2ED1 A;  2V26 A;  2CUB A;  4UPA A;  4RUG A;  5CKE A;  2OTJ Q;  1G3T A;  1D0Z A;  2NUZ A;  4JJC A;  4E7H A;  4A4F A;  3CCL A;  4J9D A;  2KSS A;  4MZM A;  1QQJ A;  1N5Z A;  2A36 A;  2RJC A;  3CCM A;  1QCO A;  2RQT A;  4PFZ A;  3MKD A;  2P84 A;  4GY5 A;  2YHT A;  4OMF B;  2ODR D;  4A54 A;  1MMN A;  4QKU A;  2ARU A;  5GAO l;  5FWC A;  3HFZ B;  1UJY A;  3GLX A;  2R5A A;  2R57 A;  2E3I A;  1TS9 A;  1XTD A;  2ROL A;  1N8R U;  1G3S A;  4DBQ A;  5A0G A;  3S3M A;  4Q15 A;  1YJ9 Q;  3V8K A;  1BI2 A; 
#chains in the Genus database with same CATH homology
 2B8A A;  3SD4 A;  5GAN f;  3HXU A;  2ZPG B;  1NE8 A;  4PJO F;  1B34 A;  2DZ9 A;  3I56 T;  4C92 B;  1JB0 E;  1VQK A;  4P3N A;  1QVG A;  2RHX A;  2ZPF B;  2FYK A;  2JN0 A;  3QPH A;  3A8H B;  5AYF A;  4QVZ A;  4HWO A;  5FRM A;  2DVE A;  2XDP A;  3CC2 T;  4VUB A;  2JUF A;  4C8Q E;  4PNO A;  3HPW A;  2V8J A;  3OYL A;  2CZ7 B;  3CC7 T;  1UGP B;  2EIF A;  4V2S A;  1I8F A;  4YPF A;  4M7A B;  1UGR B;  2AMC B;  3UFG A;  1KQS S;  3CC4 T;  1NZ9 A;  1USY A;  4KR2 A;  4Z02 A;  4M77 E;  1WNL A;  3SWN A;  2XID A;  3A32 A;  4QQD A;  3LYI A;  4ZN1 A;  4Q6G A;  4O5V A;  5LL6 S;  2D9T A;  3HRK A;  3JCM P;  1IRE B;  3QDR B;  3J7A F;  1NJ5 A;  2FVU A;  1UEB A;  3CBP A;  3G71 A;  4BDZ A;  1QF6 A;  1JBM A;  4BUG A;  2LCL A;  3QO8 A;  1DJ7 B;  5LJ3 j;  5CQX A;  3CPW A;  1VIE A;  2E64 A;  3GF5 A;  2DD5 A;  2EKO A;  2E5A A;  2RB6 A;  4PLL A;  4IUU A;  1VQ8 T;  2V8I A;  3NEM A;  5CK9 A;  4PLI A;  3DLM A;  3FDR A;  1MGQ A;  4C92 C;  2M16 A;  1P92 A;  1K8A U;  3X26 B;  2KDS A;  4PJO D;  4QQ6 A;  3M4Q A;  1HXD A;  5GAN 2;  4JJN K;  3GP8 A;  2ZR2 A;  5EG2 A;  3BW1 A;  5LJ3 h;  1B76 A;  5FU7 C;  3MET A;  3L2W A;  4IUR A;  3PCO A;  4YRT A;  1NPR A;  3A8L B;  4M7D B;  4ZTZ B;  4J7F A;  3HL8 A;  1YGB A;  1PSE A;  2G4C A;  3S3N A;  3LSQ A;  4C8Q A;  3G4S A;  3HSB A;  4M7A C;  1X56 A;  2QQ9 A;  1K73 C;  4J6X A;  2K3X A;  3JCM h;  3OBW A;  4B9X A;  4XU0 A;  1ATI A;  4G85 A;  1YIJ A;  5HK0 A;  3MP8 A;  4KBM B;  2EAY A;  4P75 A;  1I81 A;  4CH5 A;  2KAF A;  5J3B A;  2ZZG A;  3A31 A;  2HAX A;  4XTY A;  2BIV A;  2K3Y A;  4M77 A;  2CJB A;  1EIF A;  1Q7Y C;  1X01 A;  3W3S A;  4C0Z A;  1H64 1;  2QA4 A;  2PME A;  1JJ2 A;  1VQK T;  2LTO A;  5DLQ E;  3MEW A;  4BW9 A;  2RD1 A;  4TQF A;  2QQS A;  5GAN 6;  4R56 A;  1M4Z A;  1M90 U;  2RHS A;  3OMC A;  2AKW A;  2HNI A;  3LWH A;  2DQ0 A;  2X4J A;  3JB9 J;  4L6V 5;  3OS1 A;  4HWR A;  1PSF A;  1VQP A;  3BY7 A;  2HD0 A;  3M58 A;  4XTW A;  5LJ5 j;  4E7L A;  4JLG A;  2K4Y A;  2E65 A;  4C8Q G;  3HRT A;  2A8E A;  1X54 A;  2O4X A;  4LDV A;  3SFM A;  4EPC A;  4M75 G;  4MMK A;  2C7I A;  3PMT A;  4MML A;  4F7U F;  5CCA A;  2E41 A;  4M7D C;  5GMK m;  1PYS A;  4OGC A;  2AHJ B;  3HXZ A;  1Z7M A;  3QO5 A;  3A7R A;  3L2Z A;  2ZIN A;  4P5N A;  1D3B A;  2M9U A;  2DPP B;  4M77 G;  4TVY A;  2YLC A;  4C92 E;  5LJ5 h;  3G71 T;  4N4H A;  2DTH A;  3MHX A;  2WSC E;  4XK8 E;  4ZGE B;  2RI5 A;  2J3L A;  3E1S A;  3JCM X;  1N27 A;  3BDL A;  2DXT A;  3CPF A;  2JTF A;  2VXF A;  5ELN A;  2MF2 A;  2RHQ B;  3X28 B;  4JRQ A;  4RQF A;  1KQ1 A;  3TU4 K;  2EFI A;  1RL2 A;  3C4S A;  3ASK A;  4CS3 A;  4N0A A;  2LC4 A;  4M7A E;  4HKE A;  2ZXF A;  4YCW A;  11AS A;  1Z7N A;  2RK1 A;  2OAU A;  2LT1 A;  2X4X A;  3QO7 A;  3UPU A;  4OLF A;  5KH6 A;  3EFR A;  3H8Z A;  3VV0 A;  4AH6 A;  1S72 A;  1BBW A;  3TEH B;  4EO4 A;  2VUB A;  1M8V A;  2XDD A;  3E19 A;  4DPG A;  2ZIO A;  2V8K A;  2RHY A;  3I56 A;  4BDY A;  2ODR C;  1KOG A;  5LJ3 g;  1BYM A;  1NJI U;  3NFC A;  3GIB A;  5I2M A;  3CC2 A;  3C94 A;  2KMT A;  3HFZ A;  2C8M A;  3FB9 A;  1I5L A;  2EQK A;  1N8R C;  2Y90 A;  3RUX A;  4FL6 A;  4H02 A;  2QA4 T;  4QVD A;  1U1T A;  3A7A A;  2DAQ A;  2GF7 A;  5GAN e;  4CS4 A;  2E6N A;  4LNS A;  1H4V B;  3JCM g;  3P8B B;  2DU5 A;  2ZTG A;  3OYM A;  3CEY A;  4C92 A;  3CC4 A;  4PJO B;  2P4T A;  3M53 A;  4H2S A;  1G3W A;  1X2G A;  3V8L A;  4QVC A;  5DLO A;  3V7C A;  3QO3 A;  2I4M A;  3PIP A;  4M7D E;  4ELY C;  2LDM A;  2PUK B;  3VYG A;  2XTI A;  4RCC A;  3L2U A;  3DSQ A;  4PG3 A;  5CKD A;  2EQU A;  3CBO A;  2CZ0 B;  1EOV A;  4E7I A;  3A8O B;  5FRN A;  4OGE A;  1EVK A;  1X55 A;  1WPY A;  1ZBX A;  4QW2 A;  3VQY A;  3HRS A;  1TH7 A;  3RIR A;  4C0D C;  2RHU A;  4M7A A;  3L2V A;  4EMK B;  2AMC A;  3H6Z A;  4JLI A;  5GAN 4;  2ZT7 A;  3R6O A;  4DQ2 A;  4EMG A;  1AHJ B;  1SES A;  1VQ8 A;  3OSV A;  3QTC A;  1VUB A;  1N9W A;  1N9R A;  2GFU A;  1M1G A;  4L59 A;  5LJ3 d;  4X9C A;  2E70 A;  5D6X A;  2QXF A;  1QVF S;  4X34 A;  2D6F A;  5GAN 8;  4H2Y A;  3NTK A;  3C95 A;  4HA8 A;  2IVW A;  4C92 G;  3JCM d;  2KVQ G;  2E10 A;  3P8V A;  1LJO A;  4C5I A;  2QQA A;  2GCX A;  1M1K U;  1WJS A;  2IY5 A;  1X2H A;  3OQ5 A;  1OZ2 A;  3VYH B;  1VQM T;  3BJU A;  5LJ5 g;  1Q82 C;  4PJO C;  2BKD N;  2X4W A;  1K8A C;  5KE2 A;  5I2S A;  4P72 C;  3ZEH A;  4YRN A;  3CCJ A;  3L1A A;  1KMM A;  2XG8 D;  3S6W A;  4M7A G;  3OMG A;  3QJY A;  3CCV T;  4H2X B;  4UP8 A;  4MDX A;  5DY9 A;  5HK3 A;  1S72 T;  2ZNI A;  3RAC A;  4XAX B;  3L4G A;  3VQW A;  2K57 A;  4E7J A;  1RIQ A;  3QYG B;  4M7D A;  3M55 A;  4XU1 A;  5IN1 A;  3LW5 E;  3V7R A;  5CQY A;  1EIY B;  2ALY B;  4LDU A;  4EMK C;  4E7K A;  2FL7 A;  3OYD A;  5J26 A;  3MF2 A;  4JS5 A;  2XD0 A;  4H2T A;  4N0A C;  1ASY A;  3KBG A;  1YJW A;  1G51 A;  4LVK A;  4YRO A;  4YCU A;  4IKF A;  4TVA B;  5CO7 A;  4YRI A;  3HXW A;  3ER0 A;  4Y28 E;  1KC8 U;  4XTU A;  2EJG A;  4P74 A;  2OTJ T;  2K5F A;  2YLB A;  1YIT A;  3OB9 A;  3HXY A;  2PU9 B;  5CKF A;  3JB9 D;  2QHU A;  2LQ8 A;  1FX7 A;  2LVM A;  1M90 C;  3TEE A;  5LJ5 d;  4BY6 B;  3OYY A;  1BI1 A;  2CKK A;  1E22 A;  3QHS A;  4BI4 A;  1NYR A;  4A4H A;  2RI2 A;  5KCO A;  4P3P A;  4M7D G;  3CCS A;  1VQ7 T;  3OW2 S;  2ZZF A;  4BD3 A;  2CGH A;  2MMP A;  1EVL A;  2PVO B;  4RKU E;  1GXI E;  3LLR A;  1R8O B;  1Q81 U;  4PL6 A;  2IG0 A;  3A8G B;  4F7U B;  3Q1J A;  4HCZ A;  3WQZ A;  3RMQ A;  4BE0 A;  3P8H A;  3TEG A;  3PGG A;  2VV5 A;  5GAN 7;  4PJO E;  2KY9 A;  1H3Z A;  3A5Z A;  3OYK A;  1LNX A;  3HTZ A;  4XEO A;  4WJ4 A;  4HWT A;  1QE0 A;  1YB3 A;  3OYI A;  4D6W A;  4M78 F;  1E24 A;  3NEN A;  5C52 B;  2VC8 A;  3QNE A;  2RHQ A;  5ELO A;  3CMQ A;  5GMK e;  2A7Y A;  1UGS B;  2X35 A;  5D6Y A;  3VQV A;  4P71 A;  5LJ3 f;  1YFR A;  4ZIB A;  1WQ7 A;  3WVD B;  1Y96 A;  4IUT A;  4UP9 A;  3OA6 A;  1ADJ A;  4YYE A;  2MI6 A;  4TWA A;  1U8R A;  4J15 A;  1W2B S;  3CCJ T;  4KUL A;  3CME T;  4N4G A;  3PIO A;  3KUF A;  4BY6 C;  4LVI A;  1QVF A;  1YFS A;  4K87 A;  2ZPE B;  4XQ3 A;  2JTM A;  2L89 A;  4G84 A;  5FU6 B;  4EDU A;  4H2W A;  1NYQ A;  1B7Y B;  3QUI A;  2QQB A;  4HT4 A;  3OYJ A;  3JCM f;  3HFO A;  3OSS C;  3CMA T;  3OS5 A;  3PZC A;  4GLK A;  3FC3 A;  5A2Q E;  5KNN A;  3UGQ A;  3G6E T;  4KQE A;  2GQV A;  3TEH A;  3OS0 A;  4YRL A;  1VQ6 A;  4IUV A;  1LYL A;  3V7S A;  3GNG A;  3PFS A;  2WAC A;  4JUV A;  1YI2 T;  4H2U A;  1BI3 A;  3MCA B;  1YJW T;  1NJI C;  2ARS A;  2P0P A;  1O9S A;  4HCB A;  3LX7 A;  4XU3 A;  4XEM A;  4CH4 A;  5DM7 R;  2VXE A;  4PKC C;  2I2L A;  3BDU A;  1YIT T;  5C6S A;  2EJ9 A;  1QP2 A;  2HQX A;  2QDY B;  2ZZD A;  2YRV A;  1B70 B;  2BUD A;  2M0O A;  2DDZ A;  1G3Y A;  3HRU A;  5GMK j;  3E9F A;  4PJO A;  5C53 B;  3QKJ A;  2Q5I A;  4BWA A;  3MEA A;  4P72 A;  4FIB A;  1E1O A;  12AS A;  2DO3 A;  2ZT5 A;  4M78 D;  1W4S A;  2K2V A;  5CAI A;  3CCS T;  1K9M U;  4CH6 A;  2DTI A;  4MDW A;  1WYD A;  4FT2 A;  1KD1 C;  3OYG A;  4BE2 A;  2ZT8 A;  5GAM e;  3JSC A;  5CKH A;  4KR3 A;  3BFM A;  4EMK A;  4P74 C;  1J5W A;  5GAO m;  4OB2 B;  3M9Q A;  2E6Z A;  3PCO B;  4RDX A;  5LJ5 f;  3L2Q A;  4HT9 A;  4YRP A;  2ZCE A;  2LT4 A;  2EJF A;  1SSF A;  3NTH A;  1KHI A;  2FB7 A;  5IAY A;  1L0W A;  1VQM A;  4BI8 B;  1X6O A;  4FSX A;  2I4L A;  3HRI A;  3G7Z A;  2I4N A;  4LDY A;  4YDQ A;  4M75 B;  3REX A;  4KT0 E;  3QII A;  2L5Q A;  3DB4 A;  1YBY A;  5A0D A;  4XTV A;  4C0G A;  3CCV A;  2HQE A;  3MP6 A;  5GAN 3;  3OW2 A;  4C5E A;  4OB0 B;  4H2V A;  3LSS A;  4PJO G;  5L8R E;  1KG1 A;  4JRP A;  4KUI A;  2DK3 A;  4M77 B;  3OY9 A;  3FRN A;  3OBY A;  1M1K C;  3QG1 A;  3M59 A;  4DOW A;  3CXC S;  4XTZ A;  3LWI A;  4J83 A;  2DIG A;  4XU2 A;  4LDW A;  4ZN3 A;  2JZ2 A;  4RMF A;  5A0L A;  3G1Z A;  3L2R A;  4J5Y A;  3HXV A;  4H2X A;  4LD6 A;  1WLE A;  1NJ8 A;  3QJ6 A;  4F7U E;  4C5G A;  3EAE A;  3OYH A;  4YRF A;  1VQ6 T;  3A5Y A;  2VGM A;  4ZTF A;  4YTL A;  2P5I A;  3TRE A;  1Y71 A;  5GAM j;  2OTJ A;  3SDZ A;  4OVA A;  2EL9 A;  3R07 A;  2ALY A;  3M4Y A;  2VYT A;  3ERR A;  1ASZ A;  2ZR3 A;  2RHZ A;  3HKS A;  4HVC A;  4P71 C;  2Q7E A;  2ZGW A;  3P8D A;  1W2B A;  1PYS B;  4R55 A;  3FIF A;  4YRG A;  1YJ9 A;  4EMH A;  3NET A;  4TVA A;  2Q5H A;  1D3B B;  2ZIM A;  4A53 A;  1YHQ T;  5KCH A;  4NL2 A;  1RI0 A;  2WSE E;  2QEX T;  1VQ7 A;  2LRQ A;  3E9I A;  3MEY A;  4LDX A;  2D0Q B;  2J3M A;  2PVD B;  4C8Q F;  3P8T A;  3SB2 A;  3MP1 A;  2NS6 A;  1XNI A;  3DB3 A;  3CCR A;  5GAO q;  2Y4Y A;  4CRI A;  4M75 F;  4OF1 A;  1VQ9 A;  1FXX A;  3LC0 A;  3I55 A;  2CZ1 B;  2LX9 A;  3OYA A;  2QI2 A;  3GPL A;  2F5K A;  1I4K 1;  3CD6 A;  4A4E A;  4RG8 A;  5GAN j;  2LNV A;  2ZZE A;  2RJE A;  1QVP A;  4M77 F;  3JCM V;  4UP7 A;  4P73 A;  1VQ4 T;  5GMK l;  3KFU A;  4FM4 B;  1N6A A;  1Q86 U;  2K5I A;  3ZFJ A;  4NOY A;  3LGF A;  2XKO C;  5I21 A;  1Q81 C;  2K5L A;  4F7U A;  4RQE A;  2RJD A;  3FJP A;  2MWP A;  4O6J A;  3JCM Q;  1G5V A;  3JCM W;  3MEV A;  5GAN h;  3CME A;  4MZT A;  3VUB A;  2DKG A;  3CCU T;  3PMI A;  1VQZ A;  1FWZ A;  2E1H A;  3FEO A;  4J7I A;  2I4O A;  3IAL A;  2LCC A;  3E9H A;  3VKI A;  3CMA A;  1BI0 A;  3CCQ T;  4OB1 B;  3TCJ A;  4BAC A;  4M78 B;  4E47 A;  1SRY A;  2E3C A;  4YRK A;  2KQW A;  3G6E A;  1QP3 A;  5LJ3 e;  4K86 A;  2FHD A;  3J80 E;  3AHU A;  1YI2 A;  3JAM E;  1VQN A;  4YRS A;  2PMF A;  5GAO n;  4YP0 A;  3A7U A;  2KK4 A;  4FU6 A;  1Y07 A;  2VGN A;  2DD4 A;  2PUO B;  4C8Q D;  1V29 B;  3OS2 A;  3JCM e;  3NEL A;  1JJC B;  2ZT6 A;  3HHT B;  3JCM c;  1B7Y A;  2DXC A;  5FU7 B;  4M75 D;  2RA2 A;  3E9G A;  3O8V A;  4UC4 A;  2HBP A;  3IG2 A;  1GGM A;  4J8O A;  3RGL A;  4M75 E;  4F7U G;  4CI0 C;  3QXE B;  4II1 A;  5C51 B;  3CXC A;  4HCC A;  4M77 D;  2F69 A;  1KHC A;  1YJ9 T;  3CBM A;  3QZ9 B;  3CCE T;  3DKM A;  1NNH A;  2OTL T;  3VJP A;  3UDC A;  4BB7 A;  2WSF E;  3OYB A;  4J6W A;  2DXU A;  3RF1 A;  3T9N A;  2EYQ A;  5FLX E;  3LH0 A;  3MO8 A;  4Y91 A;  2MWO A;  2XDB A;  3RL6 A;  2XGT A;  2XIC A;  4QQG A;  1YJN T;  4C5H A;  5CR2 A;  1H4S A;  3M57 A;  3CCR T;  1B70 A;  4ZGD B;  1VQ5 T;  2RO0 A;  1VQ9 T;  3MQZ A;  3UH0 A;  4A4K A;  4BE1 A;  4M78 C;  3I55 T;  1SER A;  2L3R A;  2IY5 B;  4PHC A;  2PVG B;  3OYN A;  3CD6 T;  3FLG A;  5GAM g;  4YRC A;  1K9M C;  2EQJ A;  3L42 A;  2P0Q A;  3UT1 A;  3HXX A;  1Q82 U;  3GOX A;  2DTO A;  1BKB A;  5F5W A;  4ZGJ B;  4WJ3 M;  1XQH A;  2M1H A;  1HC7 A;  1YCY A;  2A3L A;  4JDS A;  3RES A;  3INZ A;  2CJ9 A;  1IL2 A;  3UWN A;  1BIB A;  5LJ5 e;  4CS2 A;  3X20 B;  1VQL T;  3OYC A;  3L4G B;  5FRO A;  1OYX A;  4XTX A;  4C92 F;  1B34 B;  3HY0 A;  4TVW A;  4E51 A;  1SET A;  3CCL T;  2ZPI B;  3PNW C;  1WJR A;  4JRK A;  5K1P A;  4FT4 A;  1O75 A;  3CCM T;  2LQK A;  2DQ3 A;  4A4G A;  1B8A A;  4M75 A;  2RH2 A;  1Y7X A;  4LD9 K;  1UB4 A;  5GAN 5;  3MEU A;  3QBY A;  4M7A F;  4WF2 A;  4P73 C;  3PTA A;  2L8D A;  1VQO A;  2JNG A;  4ELZ C;  1VQN T;  1WU7 A;  2MAM A;  1HK9 A;  4ZTJ A;  1N9S A;  5GAN g;  5HY6 A;  3ZBD A;  3SWN B;  2Q7G A;  4N4I A;  3DLL A;  1JRI A;  5GAM d;  5CVI A;  1EFW A;  1G5H A;  4HWS A;  1OI1 A;  2RJF A;  2ZPH B;  3P8Y A;  1ZQ1 A;  4C0F A;  1KQ2 A;  3VQX A;  2QQR A;  5GAO r;  1XOV A;  2ART A;  4JRI A;  2XK0 A;  3HP9 A;  4L5G A;  2F5T X;  1YHQ A;  4IUP A;  3OD1 A;  4DOV A;  2RHI A;  4EX5 A;  5HKC A;  4LVJ A;  4RMO A;  2QEX A;  4YRQ A;  4YRJ A;  3X25 B;  2DU7 A;  5C0M A;  4ZTU B;  3JRZ A;  3OYE A;  3RKW A;  3JB9 H;  1NJ2 A;  2PQW A;  3JCM b;  4OP0 A;  4M78 E;  3JB9 G;  5GMK i;  3KXT A;  3S3O A;  4YCV A;  4C92 D;  1HTT A;  4Q5W A;  2E5Q A;  1M1F A;  3UGT A;  1U1S A;  4OB3 B;  2EQM A;  3RKX A;  5FU6 C;  1YFT A;  5GMK h;  3A5Z B;  2CS7 A;  1VQ4 A;  4NL3 A;  3TUP A;  4M7D F;  3URG A;  3WVE B;  4WI1 A;  1OZ3 A;  3N5B B;  5GAN d;  4C8Q B;  1KQS A;  3C12 A;  1NJ6 A;  1QVG S;  4K88 A;  1FYF A;  1K73 U;  1IZ6 A;  3X24 B;  5M9O A;  4M7A D;  1C0A A;  3A74 A;  3QZ5 B;  1USY C;  1WJQ A;  3A8M B;  1Y96 B;  1G5I A;  2Q7H A;  3M54 A;  3OYF A;  3SWN C;  2GFA A;  3CCU A;  4O2D A;  3HFN A;  3PT9 A;  1M5Q 1;  5HGQ A;  3M5A A;  4X9D A;  1Q86 C;  4C0D B;  2O01 E;  5KE3 A;  4RCB A;  1Q7Y U;  1UGQ B;  3CCQ A;  3IKM B;  1H4T A;  4IUQ A;  4LVL A;  4YRM A;  3G4S T;  2E12 A;  5E3I A;  2CJA A;  3IKL A;  2DXB A;  4J6Y A;  1H4Q A;  4TVR A;  2QHV A;  4YRE A;  3VUZ A;  2XU8 A;  5CIU A;  1YIJ T;  3NTI A;  2RHS B;  2AKW B;  4ATO A;  3QSU A;  4L87 A;  2P0K A;  3V8J A;  3WXM B;  1NJ1 A;  1X75 C;  2R58 A;  2EWN A;  4KUD K;  1VQO T;  4DA4 A;  2X4Y A;  2ZNJ A;  2QTX A;  1EIY A;  4M78 A;  3CPW S;  4HWP A;  2O4X B;  3CC7 A;  3VU3 C;  2ZCF B;  4BI3 A;  5K1X A;  3M4P A;  2QHT A;  3MF1 A;  2NLU A;  1W66 A;  1QW1 A;  4C8Q C;  4M7D D;  3CCE A;  5D6W A;  4MZP A;  2OTL A;  4YRR A;  4HT8 A;  3ICA A;  4LVM A;  5GAM h;  1KC8 C;  4M75 C;  1JJC A;  3I7F A;  2G3R A;  4CH3 A;  2RI3 A;  3REU A;  1VQP T;  3M56 A;  4P75 C;  1WQW A;  5CKB A;  3QYH B;  2R5M A;  3RKY A;  3EFS A;  2RM4 A;  4RG2 A;  4ME7 A;  2CZ6 B;  1ADY A;  3JCM J;  4NS5 A;  1KD1 U;  1E1T A;  1YJN A;  4TQD A;  4M77 C;  1LOJ A;  2CIM A;  3HFV A;  3RER A;  3LGL A;  4NCX A;  1VQ5 A;  2P0L A;  2JOY A;  1BBU A;  3RMS A;  5GAM f;  2RK2 A;  2DZC A;  3JB9 I;  5IT9 E;  2DIQ A;  2XHC A;  2DEQ A;  3VBB A;  3J81 E;  1KMN A;  1ZHI A;  1NPP A;  4TTV A;  2DJZ A;  2CYZ B;  2C06 A;  2Y4X A;  2XI9 A;  1VIF A;  2QHS A;  4M78 G;  5J39 A;  2JVV A;  2ZPB B;  1M9S A;  3JB9 F;  3M4G A;  3HY1 A;  1BIA A;  2H3J A;  5GAO p;  4P3O A;  3GNF B;  4JS4 A;  3F70 A;  4B9W A;  1EQR A;  4X5O A;  1MHN A;  1JJ2 S;  1WGS A;  3ME9 A;  1VQL A;  4UPA A;  5CKE A;  1G3T A;  4E7H A;  4A4F A;  3CCL A;  2KSS A;  4MZM A;  2RJC A;  3CCM A;  4GY5 A;  4OMF B;  2ODR D;  2YHT A;  4A54 A;  2ARU A;  5GAO l;  3HFZ B;  3GLX A;  2R5A A;  2R57 A;  1XTD A;  1N8R U;  1G3S A;  5A0G A;  3S3M A;  4Q15 A;  3V8K A;  1BI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...