2FYKA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with adp and biotin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords biotin--protein ligase
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fykA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2fykA01
2I2LA 4C92C 2I4OA 3REUA 4EMHA 4TTVA 3M4PA 2RHQB 2VXEA 2DQ3A 4JRKA 3A5YA 5GAMe 3JCMg 1VQZA 1PYSB 4MMLA 3E9IA 2PMFA 2YHTA 3V7SA 3PZCA 4H2VA 4NCXA 3P8VA 5GAOr 2E1HA 1LJOA 5GAN3 2I4NA 1G51A 3JCMb 2CGHA 3V8JA 1NJ1A 2ZT8A 4C8QB 2ZT7A 1H4TA 5LJ5f 3RL6A 2DZCA 4F7UB 3VQYA 1NJ8A 5LJ3g 4E51A 4JRIA 3JB9I 3JCMf 4H2WA 4KR3A 3JCMc 4G84A 4C8QE 1I5LA 3FIFA 1Y96A 1YCYA 2ZR3A 5KNNA 2XGTA 2ZCEA 4XEMA 3QTCA 2PMEA 3L1AA 4M7AF 1E1OA 4HA8A 4TVWA 4M78D 4PJOF 5GAN4 2FB7A 5C53B 4YPFA 1NNHA 2ZINA 4YRKA 3HXWA 1U1SA 1WQ7A 2DTIA 3QNEA 1JBMA 2YLBA 4H2SA 1D3BB 2DXUA 5GANd 4Q15A 2DVEA 5GAOq 4X5OA 1ADJA 4HWPA 1B8AA 2HNIA 5GANe 4DPGA 1WPYA 2K57A 1X56A 4NOYA 4TVYA 4H2XA 1EVLA 1Y96B 3HXYA 4M75D 3A7AA 2DJZA 3V8LA 4M75C 3V8KA 1Z7NA 3QUIA 4F7UE 1JJCB 3HXXA 4M78A 3HXUA 4P73A 3NENA 2YLCA 4P3OA 1B7YB 1NYQA 3G1ZA 2ZR2A 2Q7EA 2DXTA 2QHUA 1EIYA 1YGBA 4LNSA 4V2SA 1J5WA 5GAOn 4YRCA 3M4GA 4PG3A 4M78G 4A54A 3REXA 4P72C 4AH6A 1M5Q1 3VQXA 1LYLA 2I4MA 5LJ3d 4XTWA 2QHVA 3SB2A 4EMKB 5GAMj 4M78C 3W3SA 3JB9F 4H2YA 2CIMA 1LNXA 3JB9J 5CAIA 5LJ5e 2XTIA 3JCMe 4H2TA 4C8QA 4TVAA 2DU5A 4XU2A 2ZTGA 2P5IA 2ZNJA 3LSQA 4EO4A 4UP7A 4M77A 4X9DA 3BDUA 1NYRA 4CH3A 4ZTZB 4XTXA 3NEMA 2DQ0A 5K1PA 4XTUA 4M7AB 4F7UA 1WLEA 1B34A 3M4QA 5GMKl 2Q5HA 2ARUA 4RQEA 3HXZA 2Y90A 3KFUA 1GGMA 2ZT5A 1YB3A 4TVAB 2ARTA 4M7DE 2QHSA 1KOGA 1EIYB 4P75C 2EAYA 3JCMV 4XU3A 4M7AE 4XTZA 4EMKA 2AMCA 3JCMX 3HRKA 4M78B 3RKYA 3HFZB 3PGGA 3HFZA 3VQWA 2RA2A 5LJ3h 4CH5A 1WU7A 4YCWA 4TQDA 3HSBA 2CJBA 12ASA 1BIBA 5LJ3j 4QVCA 3TUPA 2RD1A 3L2ZA 5I21A 5GAMd 1IL2A 4N0AA 4XU0A 2ZZEA 3JCMQ 4J15A 5LJ3f 2DU7A 2RHSA 3RKXA 3WQZA 4M7DD 2ZZGA 1X2GA 1I8FA 1BBUA 3R07A 4C8QF 3RACA 1B76A 1N9SA 4P71A 1X55A 4OLFA 2ZGWA 2RHQA 1HK9A 4YRNA 4M75G 3HY1A 1LOJA 3LC0A 4HVCA 3HFNA 1H4VB 3JCMW 3QO3A 2C8MA 3MEYA 5GAN2 4ZTUB 4WJ4A 4N0AC 2QHTA 2ZIMA 5GMKj 4M7AA 4PJOG 4C92A 5GMKi 4YRFA 1MGQA 1Z7MA 3HFOA 4YROA 5HGQA 2C7IA 4HWOA 4M77B 5GANg 3JCMh 4P74A 4J5YA 4RCCA 1HC7A 2ARSA 2AKWB 2DDZA 4PJOE 4PNOA 1E22A 1YFTA 1EFWA 1KMNA 2Q5IA 2E64A 4YRMA 4EMKC 3HTZA 4UP8A 3JCMP 3UGTA 2AKWA 3HXVA 5LJ5d 1TH7A 1JJCA 4CH6A 3A31A 4XTYA 4XU1A 3SWNC 4WI1A 5C52B 4G85A 4RMFA 4M7DG 3HY0A 4L87A 4NL2A 4M75F 1BIAA 1E1TA 4BWAA 5GAOl 4M77E 1B70A 4YYEA 3SWNB 3TEHA 4M7AD 3V7RA 4M7DC 4K87A 2E10A 1B34B 3A5ZA 2QTXA 4JLIA 4C8QG 2ODRC 5GAN6 3EFSA 5GMKe 3FB9A 5LJ3e 4YREA 3RF1A 2DZ9A 2E65A 1D3BA 4M77C 3IALA 2E41A 4XEOA 4Q6GA 4Y91A 5GAN7 1ASZA 1I4K1 4KR2A 5GMKh 4OP0A 3LSSA 3A7RA 1FYFA 4XTVA 1WNLA 4M77G 5GANf 1SRYA 3VBBA 3AHUA 2Q7HA 4C92F 1USYC 4BW9A 1NJ5A 5GAMg 4C92D 3GIBA 3P8TA 2P0LA 1KQ1A 4CS4A 4HT9A 5GAN8 3JB9H 2JN0A 5ELOA 3RIRA 3NETA 3RGLA 4NL3A 4HT8A 3MF2A 1WQWA 3I7FA 4RDXA 4P73C 3QO7A 4YP0A 1YFRA 3DSQA 4M78F 1G5HA 4EMGA 5GMKm 3IG2A 4M7DB 3VQVA 4YRSA 1B70B 3L4GA 2VXFA 3UGQA 4HWTA 1W66A 1NJ6A 4YRRA 2ZNIA 4H2UA 3BW1A 5GAMf 1N9RA 4TWAA 4YCVA 4RCBA 2EJFA 1EQRA 1H4SA 3QHSA 2VC8A 4UPAA 1X54A 4P3PA 5K1XA 5LJ5h 4M75E 4KQEA 3JB9G 1NJ2A 3IKMB 5F5WA 2IY5B 3ERRA 4PJOD 3E9HA 2E3CA 1U1TA 4CS2A 1KMMA 4K88A 1EOVA 4M77D 1ATIA 4YCUA 3HRIA 1WYDA 3TEGA 5ELNA 1PYSA 5E3IA 1SETA 4C92G 4PJOA 4WF2A 4P72A 3PCOB 4YRTA 4ZIBA 4UP9A 1ASYA 5GAMh 3QSUA 4O2DA 3SWNA 3TEHB 1BBWA 3P8YA 3RUXA 1E24A 3QO8A 2ALYA 2G4CA 1H4QA 4J6WA 3PCOA 4HWSA 4J6YA 3OD1A 2EWNA 2J3LA 4M7AG 2ZXFA 4DQ2A 4QVDA 5LJ5g 2J3MA 4YRJA 4C8QD 4CH4A 4C8QC 2RHSB 3A7UA 2ALYB 3EFRA 2E5AA 1SERA 1EVKA 2CJAA 5LJ5j 3JB9D 1HXDA 5GAOp 1ADYA 4A53A 3RKWA 2IY5A 4JUVA 1G5IA 1USYA 3BFMA 4P3NA 2DKGA 4YRPA 2DTHA 4F7UF 3UFGA 3FJPA 3UH0A 4C92B 4K86A 1L0WA 2DTOA 3VU3C 2CJ9A 3IKLA 4MMKA 3L4GB 4P71C 4YRQA 4WJ3M 4J6XA 4C92E 1M8VA 1B7YA 1HTTA 1KQ2A 2EJ9A 2DEQA 4M75A 1N9WA 4HWRA 1QF6A 1SESA 4TQFA 4M7DA 5GAOm 4YRGA 3RESA 1JRIA 3BJUA 4YDQA 1YFSA 3A74A 2AMCB 4CS3A 2ZIOA 2Q7GA 3ICAA 4RQFA 4H2XB 3JCMJ 4PHCA 1C0AA 4M77F 4M75B 4M7AC 1RIQA 1X01A 2I4LA 2ZT6A 3A32A 2EL9A 3HFVA 4PJOC 4M78E 1QE0A 4H02A 2ODRD 2RB6A 4F7UG 4M7DF 3QO5A 5GANh 4YRIA 2ZZFA 5C51B 4XQ3A 4PJOB 1X2HA 3BY7A 4X9CA 5GAN5 4P75A 4YRLA 5DY9A 5GANj 4P74C 3V7CA 4EX5A 3RERA 3JCMd 3NELA 3MF1A 2RM4A 2EJGA 1I81A 3INZA 2FYKA 11ASA 3CMQA 1H641
chains in the Genus database with same CATH superfamily
2I2LA 4JDSA 4YTLA 1NYGA 5A0DA 1M2OA 4LDXA 1J3TA 3O5ZA 1VQ8A 4JRKA 4EPCA 1PYSB 2RJEA 2RH2A 5A2QE 2RQRA 2YRDA 2E1HA 5GAOr 4IUTA 3S3NA 4MZMA 4OB1B 4LXCA 5KH6A 1D1CA 4ZTJA 1JB0E 4BUGA 1VQLQ 3MP1A 2CSQA 2FVUA 2FPEA 3SDZA 3MP8A 4JRIA 3JB9I 2V26A 2JJ9A 3LGLA 4ZTFA 1KQSA 2ZR3A 5KNNA 2XGTA 3PMIA 1IREB 4KH1B 8ATCB 2KAFA 2CUDA 4M7AF 2F1LA 2KEAA 1VQOQ 3KUFA 5GAN4 2RHYA 1M1KR 2ZINA 2YUNA 2WACA 3OA6A 3M57A 2Y4YA 3HXWA 4JZ3A 2D0NA 2RHIA 1BYMA 1LPLA 1U1SA 2BZXA 2NWMA 1WQ7A 2AHJB 2RHZA 4F16A 1D3BB 1UGVA 2YSQA 2ESWA 3HPWA 1QQJA 3VS7A 1FWZA 3CBOA 4XK8E 4DBQA 1ADJA 1B8AA 3KFVA 5GANe 3LLRA 4DPGA 1WPYA 2K57A 3CD6A 4TVYA 5HCKA 3VS6A 3HXYA 3CD6Q 2P4TA 4M75D 3A7AA 3V8LA 3G71T 4L59A 2RQWA 1K76A 4OB2B 2KI7A 3J81E 2X9HA 2CP0A 4F7UE 2KBTA 3CMEQ 1JJCB 1VQNA 3NENA 1QWEA 3CCMA 1X2KA 2ZPIB 1YBYA 1RAEB 2ZR2A 2QHUA 4V2SA 1G2BA 3META 5GAOn 4YRCA 2JTMA 5ECAA 4K11A 4PG3A 1Q86C 1QW1A 3DLLA 1VIEA 2MF2A 1VQMT 4Y92A 1S72T 4Z02A 4XTWA 1QCNA 3SHWA 1K4US 1NZ9A 3CCVT 3OY9A 3JB9J 2XTIA 3TSWA 3JCMe 2Y4XA 4JS5A 1TUDA 3GNGA 4CH3A 5IN1A 4ZTZB 1NLPC 3CCVA 3I35A 4PFOA 4QVZA 5K1PA 1CKAA 1QVPA 4PFZA 1KK7A 2CZ7B 3OSSC 1K9MU 1CKBA 2PVDB 1VQPQ 2QA4Q 1UFFA 2ARUA 4OMLA 2KSSA 1GGMA 1PRLC 4M7DE 2QHSA 5FWBA 2L3QA 1BU1A 2AMCA 4PFPA 2DNUA 3JCMX 1ARKA 3EAEA 3OW2P 1W70A 3RKYA 3PGGA 2RA2A 3EFOA 1WU7A 4P5NA 1H3HA 4FSXA 4YCWA 5KYNA 1D0YA 3HSBA 2CJBA 3ASKA 5LJ3j 4QVCA 2RD1A 4DBHA 1S72Q 3SFMA 4HVWA 2L5QA 5I21A 1IL2A 2XU8A 4N0AA 1GCQA 1WXTA 5IH2A 2ZZEA 4CC7A 3OYEA 1D0XA 2RHSA 3WQZA 4CC2A 1OZ3A 1BBUA 1N9SA 1FX7A 1N8RU 4CRIA 1LOJA 2JXBA 3JCMW 3G71Q 3CC4A 4O5VA 4ZTUB 5D7UA 1VQ7A 2QHTA 2JUFA 2YUOA 1V76A 2L89A 5GMKi 2WSCE 1WZOA 2D1XA 2K3XA 1NPPA 1Z7MA 3HFOA 4YROA 1SPKA 2ZPBB 2C7IA 2FEIA 3CCJQ 4P74A 4J5YA 4RCCA 2AKWB 2LQKA 2DERA 1M1KC 1Q95G 1EFWA 1KMNA 2E64A 4J9HA 3ZFJA 4UP8A 3JCMP 2KE9A 3UGTA 3HXVA 5KE2A 4FCYA 5LJ5d 2M0OA 1OYXA 1KQSS 2QEXT 3TEEA 4RUGA 1M3CA 2ZPHB 4OMNA 1SSHA 4G85A 3BE3A 3MP6A 2K5FA 4BWAA 4AG2C 3PFSA 3L2QA 1AWJA 1I5OB 2SEMA 1MMAA 2PTKA 2NYSA 2E5KA 4II1A 5FU6C 4JS4A 4C8QG 2ODRC 5GAN6 3EFSA 1ZUYA 5GMKe 2GTOA 4C0DC 2QGGA 2XICA 4XEOA 1IXDA 2KT1A 2QEXA 3LGFA 4Y91A 1I4K1 5GMKh 2CKKA 3OYNA 4OP0A 3LSSA 4J9DA 2ROLA 1JXMA 4XTVA 5FRNA 1TTHB 4A63B 4BW9A 1AOJA 1Q86R 5D6WA 3HTRA 4C92D 4ZN1A 2P0LA 4HT9A 1W2BP 3OS0A 3NTHA 3NPFA 3NETA 3CEYA 1QLYA 4NL3A 2VB6A 3MF2A 4E7SA 3U23A 1ABOA 2DK3A 4M78F 5KCOA 2X4XA 4EMGA 3HRTA 3JSCA 2JMCA 1IHWA 4PJLA 4C5IA 3UGQA 1NJ6A 4A4HA 4JLGA 4DEXA 4BE1A 1P92A 2F2VA 4RCBA 2VASA 1X43A 2GCXA 2VC8A 3QHSA 4UPAA 3MEWA 1X54A 2HQEA 5LJ5h 4M75E 4KQEA 4LNPA 4WTOB 3ER0A 5F5WA 1YIJQ 1KJWA 4DEYA 2ENMA 3UF4A 2LNVA 1U1TA 3P8DA 2OTLA 1KMMA 2GF7A 1T0HA 4Q5WA 4D6WA 1FYNA 3HRIA 2O9VA 2RI2A 5IXBA 2J06A 5ELNA 3TEGA 2IPOB 4C92G 2JM8A 2BZYA 3S3MA 2QI2A 1ZBXA 3PCOB 2ABLA 2ED1A 4X34A 2WSEE 5L8RE 4O2DA 2K5IA 1BBWA 2VKNA 3RUXA 1E24A 2DF6A 2ALYA 4C5GA 2VVKA 3QZ9B 1H8KA 1K1ZA 3UT1A 2EQMA 2ZXFA 1UECA 2J3MA 4C8QD 1RADB 2OTJA 4C8QC 1UJ0A 2RHSB 3CCSA 1SERA 4LVJA 4KGZB 3EG9A 1EVKA 1Q86U 5GAOp 1ADYA 3M0UA 3RKWA 2V1RA 2HSPA 2CDTA 1G5IA 1F1BB 2NS6A 3A8HB 4P3NA 4YRPA 3GPLA 5CR2A 2GQIA 1OU9A 1XOVA 3AT1B 4K86A 2GGRA 2LT1A 2J7IA 4N4IA 2PVGB 1QKWA 3L4GB 4NS5A 2RJFA 4DOVA 1D1BA 2EJ9A 1SEMA 2DL5A 2FRYA 4M75A 1N9WA 4HWRA 1QF6A 5J3BA 4M7DA 3RESA 1M90R 3MEUA 2ZCFB 4KUDK 2MCNA 3VYGA 5GJWB 1YJ9Q 2ZIOA 2AZVA 4FM4B 4D8KA 3OYKA 3PNWC 1C0AA 1VQPT 2DMOA 4M75B 2FO0A 3EHRA 4OMPA 3HFVA 2QDYB 3VJPA 5IHIA 2ODRD 3QO5A 3DLMA 1OI1A 1B7TA 3N5BB 2IVWA 2VYTA 2X4WA 2DYBA 4AFQC 4O6JA 5C51B 4BY6C 1QCOA 4PJOB 3S6WA 1BI2A 3QWXX 1QVGA 2W0ZA 5DY9A 4YRLA 4EX5A 3V7CA 3RERA 4N4GA 1KHIA 2J05A 3X26B 1TXQA 2P84A 1FMKA 1AEYA 2EFIA 2FYKA 3IQLA 3OYGA 3CMQA 4C92C 2I4OA 3CMAA 4EMHA 5FWCA 5HKCA 4TTVA 2DL4A 2GFAA 2C0TA 1NPRA 2DQ3A 1SHGA 1VQZA 4J9FA 2YHTA 3V7SA 2KRSA 3PZCA 4H2VA 4NCXA 1M2VB 3P8VA 5CQXA 3UA6A 3CMAQ 5GAN3 3OYDA 1GXIE 1YCSB 2I4NA 1WHMA 2YRVA 2QQSA 1X69A 1C0MA 1BB9A 4KH0B 2ATCB 2DZCA 4F7UB 1UUEA 4LUDA 2EBPA 4E51A 4BACA 1WHHA 4H2WA 1MUZA 2A37A 3FIFA 4BE2A 1RUWA 3EG1A 2RQVA 3VRYA 4FSSA 3MEAA 1ZBJA 1VQ6Q 3EHQA 2QTVA 2FB7A 1K73C 2J6FA 2KMTA 3CBPA 4WCIA 2BE9B 1E6HA 1AVZC 1JEGA 1WXUA 1JBMA 2YLBA 4H2SA 2CREA 5AT1B 1KD1R 2DXUA 1C1AA 4Q15A 2DXCA 2DAQA 3H6ZA 2BIVA 2K7AA 2FPFA 1DJ7B 3VS0A 4E7LA 1VQ5T 2L0AA 2DFUA 4JJBA 3I5SA 3EGDB 3JAME 4QW2A 3OMCA 4ANJA 4E7HA 2C0OA 3T9NA 1Y96B 3I56Q 2DL3A 3OS2A 1YWPA 2X35A 3CC7Q 3FC3A 1XQHA 1UG1A 3QBYA 3I56A 2R5MA 1D1AA 1HJDA 2YT6A 1VQLA 4M78A 2FZCB 5C6SA 2YLCA 4OGEA 1NYQA 5I22A 1YI2A 1B3QA 1EIYA 1YJWA 1PRMC 3RDVA 5LL6S 3TQ7P 1ACMB 3A1PA 3VS3A 2QK0A 5IT9E 1GFDA 3PIOA 2RK1A 3CCST 1M5Q1 2LC4A 3VQXA 3QKJA 5LJ3d 3L42A 1G83A 2PUKB 1UGPB 1VQ7T 2CIMA 5EC7A 3QYHB 4H2TA 1TWBA 1QKXA 4HT4A 1QVGP 2FZGB 2KRMA 1VQ8Q 3LSQA 4EO4A 2L2PA 1AHJB 1K8AC 1NYRA 3BDUA 3P8BB 1WFWA 2LQNA 2CP5A 3ZBDA 1VQ4T 4PK4A 3J80E 2V8KA 3H9NA 2L3RA 4Z88A 7AT1B 3CXCA 3UWNA 3M4QA 5GMKl 2D8HA 2CZ0B 5A0GA 2ZT5A 2RQTA 1YB3A 4TVAB 3S3OA 2ARTA 4JRPA 1VQ4Q 1RAFB 3TREA 2LQWA 1EIYB 4P75C 1UTIA 4KBMB 2EQKA 2LX7A 4FL6A 1K8AU 3HRKA 1QCFA 1CSKA 3QDFA 4M78B 3HFZB 3HFZA 2CZ1B 5LJ3h 1KSWA 2K79A 1GL5A 1BIBA 2OI3A 2OTLT 2HKQB 3L2ZA 1KG1A 2HQHA 3VYHB 2DA9A 4AFUC 4M7DD 2ZZGA 2LMJA 4C0FA 2AKKA 2O01E 4E7JA 3FLGA 1QWFA 2LT4A 3RACA 3Q1JA 1JQQA 2EYQA 1T3SA 4OLFA 4LVLA 3G6ET 3QZ5B 1Q7YR 2KY9A 2KYBA 3OYJA 3GNFB 2RNAA 3HY1A 1OV3A 2H3EB 3HFNA 1H4VB 3QO3A 3MEYA 1SRMA 4AMCA 5GAN2 4C0GA 4WJ4A 2FRWA 1XTDA 4M7AA 4YRFA 1MGQA 1WGSA 2CP7A 2A36A 3G1JA 4J9CA 5HGQA 1OX9A 1O9SA 4M77B 5IHKA 5GANg 2I0NA 1HC7A 2ARSA 2QQ9A 1NE8A 2DDZA 3C95A 2PNIA 1E7OA 2EW3A 1YITQ 2K4YA 1G3WA 4KGXB 3CC7T 1VIFA 4KRTA 2Q5IA 3C4SA 4YRMA 4EMKC 3HTZA 1M9SA 1UHCA 1M90C 1AWOA 2AKWA 2EIFA 2QQAA 1TH7A 1M30A 1FMVA 4AFZC 3CC2T 4XTYA 3MKDA 2O2OA 3KBGA 4M7DG 2LCLA 3HY0A 1WJRA 3I55A 2NLUA 1BIAA 2XKOC 2M1HA 1RL2A 4M77E 2DL8A 2KYMA 2HSEB 1VQNT 4ZGEB 2ZZDA 1IRXA 2FL7A 1YWOA 3OW2A 2KROA 1M2VA 1MNDA 4YREA 2DZ9A 2E65A 3IALA 2E41A 5J26A 4Q6GA 1VYUA 2DXBA 3A8GB 2AIRB 3I55Q 1VQ6T 3CCJT 1FYFA 3A7RA 3MO8A 1K0XA 1USYC 2FPDA 1BK2A 3NMZC 4E7KA 1W2BA 3GIBA 2LVMA 1PM3A 3P8TA 4CS4A 2B86A 3CPWS 5GAN8 2QG9B 1MV0B 5ELOA 1UEBA 3RR6A 3CCUQ 1FMWA 1TOVA 3QO7A 4P73C 1ZSZA 3MHXA 2JT4A 4JJCA 3VQVA 3RMSA 2LX9A 4YRSA 4RTTA 4C0DB 3L4GA 3EGXA 3QXEB 1AZGB 2A3LA 3LH0A 1VQKT 1I1JA 3QJ6A 4H2UA 1JO8A 3HP9A 4LVIA 3BW1A 2K3BA 3HKSA 1N9RA 2GFUA 2LJ3A 2O9SA 4R56A 4PJJA 1MMGA 3EGXB 4P3PA 3JB9G 1U5SA 4MZPA 3IKMB 4PJOD 2QQBA 2E3CA 2IIMA 4BE0A 2JS2A 2MIOA 1WIEA 2B8AA 1VYTA 2K2MA 4J83A 3H0IA 1Z9ZA 1BI3A 5CKHA 1SRLA 3A8OB 4PJOA 2QA4T 3NFCA 2EGAA 3CC7A 1KQSP 1PD1A 4P72A 4YRTA 4HCZA 3HRSA 3WVEB 3QSUA 3SWNA 3TEHB 1YP5A 3X28B 2M51A 1YFNA 3QO8A 2D0QB 4ZNXA 5KYUA 2E5QA 1H4QA 4J6WA 3PCOA 4J6YA 2YXYA 1K73R 2P4RA 4VUBA 4XAXB 3UATA 4M7AG 4DQ2A 4LD9K 3H41A 1R0CB 2KXDA 4F17A 4YRJA 4CH4A 2V8JA 1YN8A 1S72A 1RABB 2ALYB 3A7UA 1QP2A 2LTOA 2SRCA 2G3RA 1RI9A 2F69A 1GCQC 3JB9D 1HXDA 5KYWA 4LVMA 4LD6A 2IY5A 2EKOA 2DL7A 4JUVA 1USYA 2E6NA 1W1FA 2DTHA 2QAZA 1K9MR 4F7UF 1WXBA 3UH0A 5CKEA 5I2MA 1EX4A 1L0WA 2VUBA 1OU8A 3VU3C 2CJ9A 2CSIA 4YRQA 4J6XA 3EG2A 4C92E 3CD6T 2JVVA 3CCMT 3BDLA 1VQ5A 2IG0A 1YJWQ 1T0JA 4J7IA 2JMAA 1WA7A 1YFSA 3A74A 2AMCB 1NEGA 1U06A 2DRMA 1M8MA 3X24B 3G71A 3OB9A 3HRUA 1AWXA 4RQFA 4H2XB 1PSFA 1NG2A 2HL3A 1RIQA 2I4LA 2EL9A 1X27A 4KUIA 2RB6A 2O88A 2E3HA 5DLOA 3X20B 2OJ2A 1VQ9Q 3CPWP 2ZZFA 3L2VA 5GAN5 4P74C 4OF1A 3JCMd 3M0TA 3NELA 3MF1A 2RM4A 3I9QA 3VRZA 1H641 5CKFA 2KNBB 2PZ1A 3CCLT 2YUQA 4HKEA 3M4PA 2ECZA 2EVRA 4A4EA 1VQLT 2RHQB 1VQ6A 3E9FA 3M59A 4E47A 3E9IA 2DBKA 2MAMA 2HBWA 1NM7A 2FZKB 3URGA 2RMOA 1TS9A 1VA7A 2RJDA 3V8JA 2ZT7A 3C12A 5FU7B 3VQYA 3QWYA 3I56T 3JCMc 4C8QE 1I5LA 1H92A 1ZQ1A 1ZSGA 1ZUKA 3CXCP 2O4XB 2P0QA 3NTKA 1WJQA 2EPDA 2ZCEA 3QTCA 3R6OA 2CH4A 4PL6A 1LCKA 1HSQA 3L1AA 3VS4A 4E2FB 2PMEA 3EGUA 4TVWA 1KC8U 5CO7A 2NUZA 3OYYA 5C53B 1NNHA 1IZ6A 1N5ZA 1Y07A 1UE9A 3QNEA 4KGVB 3SD4A 4HCBA 1YJNQ 2BZ8A 4OVAA 3M5AA 2HNIA 1G3TA 1N27A 3X25B 1X56A 2X4YA 4NOYA 4MDWA 1NJIC 4H2XA 1EVLA 2DJZA 3JRZA 4M75C 3V8KA 1Z7NA 1PC0A 1K0SA 2XMFA 2FHDA 2AT1B 3HXXA 2VV5A 4IIMA 2NUPA 4LN2A 3CCLA 2DD5A 4CI0C 4P73A 2YRCA 3CMAT 1B7YB 3G1ZA 4P3OA 3PMTA 2DXTA 2LQ8A 1J5WA 3OYFA 3M55A 4RG8A 4PLLA 3E19A 4FYYB 4FYXB 1KIKA 1Y0MA 3M4GA 2HAXA 4AT1B 1BBZA 1NYFA 2CP2A 2NUPB 3REXA 4GBQA 1QVFA 4E7IA 1AT1B 3SB2A 4EMKB 3W3SA 4M78C 4H2YA 2CH4W 2O31A 1VQ4A 5D6YA 3D7SB 2J6KA 1R8OB 5LJ5e 1YHQA 2DU5A 4C8QA 3WVDB 4XU2A 2ZTGA 2MK5A 3TVTA 4OB3B 4J8OA 4UP7A 3LYIA 2AKLA 5KCHA 2E70A 1WLPB 2EQIA 4XTXA 3H8ZA 3C94A 1IGUA 1Q82U 3VKIA 2DQ0A 3NEMA 4F7UA 2JM9A 4MZTA 3G4ST 3VS2A 4IIOA 2DPPB 3CQTA 4RQEA 3HXZA 1IB8A 1AWWA 2Y90A 2COZA 1KOGA 1VQOT 1WYXA 2JOYA 3JCMV 2XDDA 3PE0A 4XTZA 4EMKA 1A0NB 1WX6A 2R57A 5L23A 2NUTB 3VQWA 4IUVA 2Z0WA 3CCRQ 4TQDA 4OMQA 2DIQA 2ED0A 5FW9A 2MYSA 2K6DA 4FW2A 1M3AA 2DILA 2DU7A 2OTJT 3E1SA 3RKXA 5FRMA 1I8FA 1HYOA 3R07A 4Y28E 1B76A 4P71A 1X75C 1X55A 1GBQA 2OAWA 1NJIR 2ZGWA 2RHQA 4LE9A 2JNGA 3OBYA 4M75G 1VQMQ 3G4SA 3LC0A 4HVCA 2DD4A 2KRNA 5GMKj 3VS1A 1JJ2P 4C92A 3OS5A 4DA4A 3TU4K 2OTJQ 2XK0A 3JCMh 1V29B 4LDWA 2OAUA 1YHQT 1NLOC 2X51A 3QJYA 3CC4Q 4B6MA 1NJIU 2RI5A 5HY6A 4RTVA 3OMGA 1JJCA 4HXJA 4JJDA 1UGQB 2L3SA 2AK5A 2COYA 4XU1A 4WI1A 1MNEA 4RMFA 1NBEB 3HL8A 4A4KA 5DLQE 1YJNT 4L87A 2QEXQ 1G8XA 2VGMA 1E1TA 1B70A 1BCOA 2LRQA 4M7AD 4E7ZA 2FG0A 4M7DC 2E10A 3A5ZA 1JJ2A 2QTXA 4JLIA 2KDSA 3KXTA 1M1KU 3FB9A 5LJ3e 1YITA 1D3BA 4M77C 2JZ2A 3CCET 4D8DA 2JS0A 3FDRA 4KR2A 5GAN7 9ATCB 1ZLMA 2QQRA 3PVQA 5GANf 1WNLA 2A08A 1N6AA 4PJMA 2Q7HA 2CZ6B 1GBRA 2EYYA 4FIBA 1NJ5A 1Y7XA 5IHNA 2LDMA 1MHNA 4J9EA 5M9OA 1KQ1A 1BI0A 3JB9H 2JN0A 3REAB 4IURA 3RIRA 3H0FA 4HT8A 2HMAA 1EFNA 2XHCA 3QYGB 4QQ6A 4RDXA 3OYMA 1PWTA 1D0ZA 4M4ZA 3CCQA 1YFRA 3DSQA 1X6BA 3P8HA 3A5ZB 3O8VA 5GMKm 4J9IA 1B70B 3CCEQ 5CK9A 3I55T 4HWTA 1W66A 4X1VA 4YRRA 1UDLA 4GY5A 1BI1A 4QQGA 2E12A 4YCVA 2KGTA 2EYWA 1H4SA 4RTYA 1BKBA 3QG1A 1PKTA 2IY5B 4QKUA 4IKFA 3ERRA 1KHCA 2X3XD 1ATIA 4DOWA 1WYDA 3CCMQ 4BI8B 1K9MC 1PYSA 1M1FA 1WHLA 5CIUA 1SETA 4BDYA 4QQDA 4WF2A 2KXCA 1KC8C 1VQKQ 4UP9A 3VS5A 4FU6A 1ASYA 1M1GA 5GAMh 2OX7A 3VUZA 8AT1B 4HWSA 3E9GA 1JXOA 1W4SA 3OD1A 2J3LA 2EKHA 4QVDA 2QA4A 1WHJA 2C0IA 1XNIA 1NEBA 1VQMA 3TSZA 5IAYA 5KYUB 4ORZA 4ELYC 5HK3A 1PCXA 3EH2A 2DYIA 2CJAA 2E4HA 3DB4A 5LJ5j 4C0ZA 3OYCA 4F04B 4A53A 2H8HA 3PIPA 2YUPA 2F5KA 3CMET 4C92B 4LDYA 3LW5E 2QYZA 2OTLQ 2LP5A 2VGNA 5KYWB 3IKLA 2K3YA 1QVGS 1TSFA 4MMKA 2ZAEA 4WJ3M 3OYIA 1U8RA 4ZGDB 1M8VA 3A8LB 2LZ6B 2M16A 4JRQA 5GAOm 1YNZA 4YRGA 4LDUA 1JRIA 4YDQA 1VQ5Q 4FT4A 1VQ9T 1R77A 2RPNA 3ICAA 3JCMJ 4PHCA 4M77F 5KYYB 4M7AC 4PJOC 4M78E 1K73U 1M27C 4F7UG 4LUEA 2J6OA 3VUBA 4M7DF 4IUQA 1RACB 3QPHA 5GANh 1Q82C 3EFOB 4XQ3A 2LJ0A 1X2HA 2MPXC 2XIDA 4P75A 3EH1A 3CPFA 1JU5C 3CCVQ 3LH5A 2EJGA 2L3PA 1M90U 2R58A 2QASA 3M56A 1RLQC 3OW2S 2QXFA 2P0PA 4C5HA 3GBQA 3REUA 1SF9A 3PVLA 2CP6A 2K5LA 4ZN3A 2VXEA 2NUTA 3A5YA 1ZA2B 3FJ5A 3JCMg 5GAMe 3G6EQ 4MMLA 2PMFA 1SG5A 3CC2A 3I5RA 3JV3A 2DRKA 1LJOA 1OZ2A 4PLIA 2EYXA 3E2UA 1G51A 3CCLQ 1LVKA 3JCMb 2CGHA 1NJ1A 2ZT8A 4C8QB 1AD5A 1H4TA 4BY6B 3LWIA 5LJ5f 3RL6A 1UJYA 1NJ8A 5LJ3g 2CT4A 3CCQQ 3FEOA 3JCMf 4R55A 3PT9A 1VQNQ 4KR3A 5DM7R 4G84A 4MDXA 1Y96A 2RJCA 5HK0A 4UC4A 4BI4A 1YCYA 3WXMB 1S1NA 1ABQA 5FU7C 2YDLA 4XEMA 2M9UA 3EGDA 1E1OA 1BCMA 4HA8A 1K9AA 4M78D 2KVQG 1ZUUA 2MI6A 4PJOF 1YJ9A 4OMOA 1Z9QA 2MWPA 4YPFA 1ZA1B 4KT0E 2DIGA 3CCJA 2G6FX 4YRKA 1PNJA 2DO3A 1QVFP 2BE7D 2DTIA 2DX1A 3CPWA 1YI2Q 4ZGJB 1Q81R 4B9XA 1YITT 1W2BS 4L5GA 2HKNA 4RMOA 4KULA 5GANd 2DVEA 5GAOq 2HEQA 4X5OA 4HWPA 3CC2Q 3MJXA 2A8EA 2A0FB 1Q7YC 2E3IA 4FYVB 1RAAB 2JTEA 3G6EA 3R6NA 1R0BG 2DM1A 3QUIA 2HQXA 1VUBA 3TCJA 1G3YA 4HCKA 3HXUA 1EZZB 3LX7A 2EQUA 4ELZC 3CCSQ 1WHKA 2Q7EA 1YGBA 1MMNA 4LNSA 1QVFS 2XI9A 3PTAA 4RTWA 1PSEA 4EIKA 2HDAA 4M78G 4A54A 2ZPGB 4P72C 4AH6A 2O4XA 1V1CA 1LYLA 1EIFA 4OGCA 4ATOA 2I4MA 2XD0A 3GF5A 2HL5C 3NHNA 1RAGB 1ZX6A 2QHVA 2K2VA 2ZPFB 5GAMj 2QDLA 3G7ZA 3JB9F 1AZEA 2X4JA 1IO6A 1LNXA 1UGSB 2F2WA 3EG9B 5CAIA 3M0PA 4TVAA 1Q81C 2P5IA 2ZNJA 1OPKA 1ZSZC 4FW1A 1VQPA 1UHFA 4M77A 3ZL7C 4X9DA 1N8RR 1G5VA 2P0KA 2EGCA 5FROA 2EQJA 4OB0B 4XTUA 4M7AB 4RKUE 2M02A 1WLEA 3M58A 5FU6B 1B34A 5CQYA 2CT3A 4RTUA 2Q5HA 2DE0X 3KFUA 5KYYA 1VQ9A 5I2SA 2EAYA 1YJWT 2R5AA 4XU3A 4M7AE 4Z8AA 2HCKA 2A7YA 1X6GA 4E6RA 1QP3A 4GLMA 4EDUA 3M0QA 2CYZB 1Q81U 4CH5A 2RI3A 4AFSC 1OULA 3M9QA 12ASA 1G3SA 4PJNA 3TUPA 4DBRA 3RBBB 5GAMd 1PG5B 2LCCA 2RN8A 4XU0A 3CMEA 1TUCA 3JCMQ 4J15A 5LJ3f 3MQZA 4HVUA 3UPUA 1X2GA 2DBMA 2BKDN 4C8QF 3GLXA 3OYHA 3RMQA 1IHVA 2COWA 1U3OA 1PKSA 1VQKA 2E6ZA 1K8AR 1HK9A 2ROTA 4YRNA 1Y57A 5KYXA 4HVVA 3CXCS 4JJNK 2C8MA 1E6GA 1Q82R 1OOTA 4N0AC 1I0CA 1PD0A 2ZIMA 1KD1C 3OYAA 4PJOG 4RTZA 5IXFA 2RQUA 2QGFB 3GOXA 2DLPA 2A28A 1W6XA 4HWOA 3OYBA 3DB3A 4B9WA 1PHTA 2XG8D 3M4YA 2GBQA 2KQWA 3M53A 2PQWA 4PJOE 1OX8A 4PNOA 1E22A 1GCPA 1YFTA 3LWHA 2KK4A 4OMMA 1X6OA 3FRNA 1M4ZA 3THKA 2W10A 4BD3A 2PVOB 4CH6A 1OPLA 3A31A 2CS7A 3SWNC 3CCEA 5C52B 4QT7A 3VV0A 4F14A 1XJWB 4ME7A 4TVRA 3RNJA 4NL2A 1RAIB 2LJ1A 4FT2A 4M75F 1B07A 5GAOl 4ESRA 1YI2T 4YYEA 3SWNB 3NTIA 3TEHA 1SSFA 3V7RA 4K87A 2WSFE 3UDCA 1B34B 1WHGA 2EGEA 6AT1B 2RF0A 2CUBA 1YJNA 3MEVA 3RF1A 1O75A 4GLKA 3M54A 1ASZA 1WJSA 2MOXA 1VQ8T 2HZYA 1UGRB 2XDPA 4M77G 5CKDA 1KD1U 1SRYA 3EG3A 3AHUA 3VBBA 3C0CA 2XDBA 5CKBA 4C92F 3CCUT 2KR3A 5D6XA 4IUUA 3CCUA 5GAMg 2RO0A 3CCQT 1UB4A 1C6VX 1WDXA 2DJQA 1VQ7Q 5CVIA 1T3LA 2D8JA 1N8RC 4J7FA 4BI3A 2V8IA 4BB7A 1QMCA 1YIJA 3RGLA 1WQWA 3OQ5A 3QIIA 3I7FA 4YP0A 3HHTB 1KC8R 1G5HA 3IG2A 2YWWA 1HD3A 4M7DB 1Q7YU 2F5TX 1M3BA 3M0SA 1FXXA 2BUDA 5AYFA 2VXFA 3CCRA 2D6FA 3OSVA 2ZNIA 1ZSZB 3L2RA 2MMPA 3UA7A 5KE3A 5GAMf 4FYWB 1D09B 1KFZA 4TWAA 2KT8A 5FLXE 3REBB 2EJFA 1EQRA 3A98A 1H3ZA 1JJ2S 5K1XA 2C06A 2AZSA 1NJ2A 3A8MB 2D9TA 3E9HA 1TUGB 4CS2A 3H0HA 4K88A 4M77D 1EOVA 5EG2A 4YCUA 2M0YA 4J9BA 4RG2A 3ULRB 2RHUA 5E3IA 1I07A 4N4HA 4R0KA 3G4SQ 2DETA 3CC4T 4LDVA 4ZIBA 2H3JA 1YHQQ 4Z89A 3EG0A 2HBPA 2DVJA 4PKCC 3P8YA 3L2WA 1MMDA 4J9GA 1GFCA 2G4CA 1GRIA 3ME9A 2LNHB 2EWNA 4DBFA 3OS1A 5LJ5g 2X3WD 2ZPEB 1OEBA 1RAHB 2LCSA 1WI7A 3EFRA 3L2UA 2JTFA 4L6V5 4RTXA 2E5AA 3MPUB 2PUOB 2V1QA 5GJVB 1VOMA 3SEMA 4IUPA 4BDZA 3CBMA 4HCCA 5I11A 5J39A 3BFMA 2DKGA 1TG0A 1IGQA 1MV3A 5A0LA 2JW4A 3UFGA 3FJPA 3GP8A 2EYZA 5C0MA 2CP3A 1OQKA 2DTOA 4JPBW 2F2XA 3MCAB 3OYLA 4P71C 2HD0A 3DKMA 3M0RA 3CCRT 4OMFB 4CC4B 1B7YA 1HTTA 4C5EA 4CC3A 1KQ2A 2BTTA 2DEQA 1SESA 1X2QA 4TQFA 1RI0A 1Y71A 1VYVA 4LVKA 3BJUA 2VWFA 4CS3A 1VQOA 2DEUA 2RK2A 3F70A 2Q7GA 4A4FA 3OBWA 2L8DA 1X01A 2ZT6A 3A32A 5KYXB 1QE0A 4H02A 1SKUB 3ZEHA 4JZ4A 1ZHIA 2PU9B 5CCAA 1YJ9T 1RLPC 4YRIA 4A4GA 2GTJA 3QDRB 3BY7A 4X9CA 2K9GA 1YIJT 5GANj 1SHFA 3NGPA 2RHXA 2GNCA 3INZA 1I81A 2GQVA 4AG1C 3J7AF 11ASA 1TU0B 2MWOA
chains in the Genus database with same CATH topology
2I2LA 4JDSA 4YTLA 5A0DA 4LDXA 1VQ8A 4JRKA 4EPCA 1PYSB 2RJEA 2RH2A 5A2QE 5GAOr 2E1HA 4IUTA 3S3NA 4MZMA 4OB1B 5KH6A 4ZTJA 1JB0E 4BUGA 3MP1A 2FVUA 3SDZA 3MP8A 4JRIA 3JB9I 3LGLA 4ZTFA 1KQSA 2ZR3A 5KNNA 2XGTA 3PMIA 1IREB 2KAFA 4M7AF 3KUFA 5GAN4 2RHYA 2ZINA 2WACA 3OA6A 3M57A 2Y4YA 3HXWA 2RHIA 1BYMA 1U1SA 1WQ7A 2AHJB 2RHZA 1D3BB 3HPWA 1FWZA 3CBOA 4XK8E 1ADJA 1B8AA 5GANe 3LLRA 4DPGA 1WPYA 2K57A 3CD6A 4TVYA 3HXYA 2P4TA 4M75D 3A7AA 3V8LA 3G71T 4L59A 4OB2B 3J81E 4F7UE 1JJCB 1VQNA 3NENA 3CCMA 2ZR2A 2ZPIB 1YBYA 2QHUA 4V2SA 3META 5GAOn 4YRCA 2JTMA 4PG3A 1QW1A 3DLLA 2MF2A 1VIEA 1VQMT 1S72T 4Z02A 4XTWA 1NZ9A 3CCVT 3OY9A 3JB9J 2XTIA 3JCMe 2Y4XA 4JS5A 3GNGA 4CH3A 5IN1A 4ZTZB 3CCVA 4QVZA 5K1PA 1QVPA 2CZ7B 3OSSC 1K9MU 2PVDB 2ARUA 2KSSA 1GGMA 4M7DE 2QHSA 2AMCA 3JCMX 3EAEA 3RKYA 3PGGA 2RA2A 1WU7A 4P5NA 4YCWA 4FSXA 3HSBA 2CJBA 3ASKA 5LJ3j 4QVCA 2RD1A 3SFMA 2L5QA 5I21A 1IL2A 2XU8A 4N0AA 2ZZEA 3OYEA 2RHSA 3WQZA 1OZ3A 1BBUA 1N9SA 1FX7A 1N8RU 4CRIA 1LOJA 3JCMW 3CC4A 4O5VA 4ZTUB 1VQ7A 2QHTA 2JUFA 2L89A 5GMKi 2WSCE 2K3XA 1Z7MA 1NPPA 3HFOA 4YROA 2ZPBB 2C7IA 4P74A 4J5YA 4RCCA 2AKWB 2LQKA 1M1KC 1EFWA 1KMNA 2E64A 3ZFJA 4UP8A 3JCMP 3UGTA 3HXVA 5KE2A 5LJ5d 2M0OA 1OYXA 1KQSS 2QEXT 3TEEA 2ZPHB 4G85A 3MP6A 2K5FA 4BWAA 3PFSA 3L2QA 4II1A 5FU6C 4JS4A 4C8QG 2ODRC 5GAN6 3EFSA 5GMKe 4C0DC 2XICA 4XEOA 2QEXA 3LGFA 4Y91A 1I4K1 5GMKh 2CKKA 3OYNA 4OP0A 3LSSA 4XTVA 5FRNA 4BW9A 5D6WA 4C92D 2P0LA 4ZN1A 4HT9A 3OS0A 3NTHA 3NETA 3CEYA 4NL3A 3MF2A 2DK3A 4M78F 5KCOA 2X4XA 4EMGA 3HRTA 3JSCA 4C5IA 3UGQA 1NJ6A 4A4HA 4JLGA 4BE1A 1P92A 4RCBA 2GCXA 2VC8A 3QHSA 4UPAA 3MEWA 1X54A 2HQEA 5LJ5h 4M75E 4KQEA 3ER0A 5F5WA 2LNVA 1U1TA 3P8DA 2OTLA 1KMMA 2GF7A 4Q5WA 4D6WA 3HRIA 2RI2A 3TEGA 5ELNA 4C92G 3S3MA 2QI2A 1ZBXA 3PCOB 4X34A 2WSEE 5L8RE 4O2DA 2K5IA 1BBWA 3RUXA 1E24A 2ALYA 4C5GA 3QZ9B 3UT1A 2EQMA 2ZXFA 2J3MA 4C8QD 2OTJA 4C8QC 2RHSB 3CCSA 1SERA 4LVJA 1EVKA 1Q86U 5GAOp 1ADYA 3RKWA 1G5IA 2NS6A 3A8HB 4P3NA 4YRPA 3GPLA 5CR2A 1XOVA 4K86A 2LT1A 4N4IA 2PVGB 3L4GB 4NS5A 2RJFA 4DOVA 2EJ9A 4HWRA 4M75A 1N9WA 1QF6A 5J3BA 4M7DA 3RESA 3MEUA 2ZCFB 4KUDK 3VYGA 2ZIOA 4FM4B 3OYKA 3PNWC 1C0AA 1VQPT 4M75B 3HFVA 2QDYB 3VJPA 2ODRD 3QO5A 3DLMA 1OI1A 3N5BB 2IVWA 2VYTA 2X4WA 4O6JA 5C51B 4BY6C 4PJOB 3S6WA 1BI2A 1QVGA 4YRLA 5DY9A 4EX5A 3V7CA 3RERA 4N4GA 1KHIA 3X26B 2EFIA 2FYKA 3OYGA 3CMQA 4C92C 2I4OA 3CMAA 4EMHA 5HKCA 4TTVA 2GFAA 1NPRA 2DQ3A 1VQZA 2YHTA 3V7SA 3PZCA 4H2VA 4NCXA 3P8VA 5CQXA 5GAN3 3OYDA 1GXIE 2I4NA 2YRVA 2QQSA 2DZCA 4F7UB 4E51A 4BACA 4H2WA 3FIFA 4BE2A 3MEAA 2FB7A 1K73C 2KMTA 3CBPA 1JBMA 2YLBA 4H2SA 2DXUA 4Q15A 2DXCA 2DAQA 3H6ZA 2BIVA 1DJ7B 4E7LA 1VQ5T 3JAME 4QW2A 3OMCA 4E7HA 3T9NA 1Y96B 3OS2A 2X35A 3FC3A 1XQHA 3QBYA 3I56A 2R5MA 1VQLA 4M78A 5C6SA 2YLCA 4OGEA 1NYQA 1YI2A 1EIYA 1YJWA 5LL6S 5IT9E 3PIOA 2RK1A 3CCST 2LC4A 1M5Q1 3VQXA 3QKJA 5LJ3d 3L42A 2PUKB 1UGPB 1VQ7T 2CIMA 3QYHB 4H2TA 4HT4A 3LSQA 4EO4A 1AHJB 1K8AC 1NYRA 3BDUA 3P8BB 3ZBDA 1VQ4T 3J80E 2V8KA 2L3RA 3CXCA 3UWNA 3M4QA 5GMKl 2CZ0B 5A0GA 2ZT5A 1YB3A 4TVAB 3S3OA 2ARTA 4JRPA 3TREA 1EIYB 4P75C 4KBMB 2EQKA 4FL6A 1K8AU 3HRKA 4M78B 3HFZB 3HFZA 2CZ1B 5LJ3h 1BIBA 2OTLT 3L2ZA 1KG1A 3VYHB 4M7DD 2ZZGA 4C0FA 2O01E 4E7JA 3FLGA 2LT4A 3RACA 3Q1JA 2EYQA 4OLFA 4LVLA 3G6ET 3QZ5B 2KY9A 3OYJA 3GNFB 3HY1A 3HFNA 1H4VB 3QO3A 3MEYA 5GAN2 4C0GA 4WJ4A 1XTDA 4M7AA 4YRFA 1MGQA 1WGSA 5HGQA 1O9SA 4M77B 5GANg 1HC7A 2ARSA 2QQ9A 1NE8A 2DDZA 3C95A 2K4YA 1G3WA 3CC7T 1VIFA 2Q5IA 3C4SA 4YRMA 4EMKC 3HTZA 1M9SA 1M90C 2AKWA 2EIFA 2QQAA 1TH7A 3CC2T 4XTYA 3KBGA 4M7DG 2LCLA 3HY0A 1WJRA 3I55A 2NLUA 1BIAA 2XKOC 2M1HA 1RL2A 4M77E 1VQNT 4ZGEB 2ZZDA 2FL7A 3OW2A 4YREA 2DZ9A 2E65A 3IALA 2E41A 5J26A 4Q6GA 3A8GB 2DXBA 1VQ6T 3A7RA 3CCJT 1FYFA 3MO8A 1USYC 4E7KA 1W2BA 3GIBA 2LVMA 3P8TA 4CS4A 3CPWS 5GAN8 5ELOA 1UEBA 4P73C 3QO7A 3MHXA 3VQVA 3RMSA 2LX9A 4YRSA 4C0DB 3L4GA 3QXEB 2A3LA 3LH0A 1VQKT 3QJ6A 4H2UA 3HP9A 4LVIA 3BW1A 3HKSA 1N9RA 2GFUA 4R56A 4P3PA 3JB9G 4MZPA 3IKMB 4PJOD 2QQBA 2E3CA 4BE0A 2B8AA 4J83A 1BI3A 5CKHA 3A8OB 4PJOA 2QA4T 3NFCA 3CC7A 4P72A 4YRTA 4HCZA 3HRSA 3WVEB 3QSUA 3SWNA 3TEHB 3X28B 3QO8A 2D0QB 2E5QA 1H4QA 4J6WA 3PCOA 4J6YA 4VUBA 4XAXB 4M7AG 4DQ2A 4LD9K 4YRJA 4CH4A 2V8JA 1S72A 3A7UA 2ALYB 1QP2A 2LTOA 2G3RA 2F69A 3JB9D 1HXDA 4LVMA 4LD6A 2IY5A 2EKOA 4JUVA 1USYA 2E6NA 2DTHA 4F7UF 3UH0A 5CKEA 5I2MA 1L0WA 2VUBA 3VU3C 2CJ9A 4YRQA 4J6XA 3CD6T 4C92E 2JVVA 3CCMT 3BDLA 1VQ5A 2IG0A 4J7IA 1YFSA 3A74A 2AMCB 3X24B 3G71A 3OB9A 3HRUA 4RQFA 4H2XB 1PSFA 1RIQA 2I4LA 2EL9A 4KUIA 2RB6A 5DLOA 3X20B 2ZZFA 3L2VA 5GAN5 4P74C 4OF1A 3NELA 3JCMd 3MF1A 2RM4A 1H641 5CKFA 3CCLT 4HKEA 3M4PA 4A4EA 1VQLT 2RHQB 1VQ6A 3E9FA 3M59A 4E47A 3E9IA 2MAMA 3URGA 2RJDA 3V8JA 2ZT7A 3C12A 5FU7B 3VQYA 3I56T 3JCMc 4C8QE 1I5LA 1ZQ1A 2O4XB 2P0QA 3NTKA 1WJQA 2ZCEA 3QTCA 3R6OA 4PL6A 2PMEA 3L1AA 4TVWA 1KC8U 5CO7A 3OYYA 5C53B 1NNHA 1IZ6A 1Y07A 3QNEA 3SD4A 4HCBA 4OVAA 3M5AA 2HNIA 1G3TA 1N27A 3X25B 1X56A 2X4YA 4NOYA 4MDWA 1NJIC 4H2XA 1EVLA 2DJZA 3JRZA 4M75C 3V8KA 1Z7NA 2FHDA 3HXXA 2VV5A 3CCLA 2DD5A 4CI0C 4P73A 3CMAT 1B7YB 3G1ZA 4P3OA 3PMTA 2DXTA 2LQ8A 1J5WA 3OYFA 3M55A 4RG8A 4PLLA 3E19A 3M4GA 2HAXA 3REXA 1QVFA 4E7IA 3SB2A 4EMKB 3W3SA 4M78C 4H2YA 1VQ4A 5D6YA 1R8OB 5LJ5e 1YHQA 2DU5A 4C8QA 3WVDB 4XU2A 2ZTGA 4OB3B 4J8OA 4UP7A 3LYIA 5KCHA 2E70A 4XTXA 3H8ZA 3C94A 1Q82U 2DQ0A 3VKIA 3NEMA 4F7UA 4MZTA 3G4ST 2DPPB 4RQEA 3HXZA 2Y90A 1KOGA 1VQOT 2JOYA 3JCMV 2XDDA 4XTZA 4EMKA 2R57A 3VQWA 4IUVA 4TQDA 2DIQA 2DU7A 2OTJT 3E1SA 3RKXA 5FRMA 1I8FA 3R07A 4Y28E 1B76A 4P71A 1X75C 1X55A 2ZGWA 2RHQA 2JNGA 3OBYA 4M75G 3G4SA 3LC0A 4HVCA 2DD4A 5GMKj 4C92A 3OS5A 4DA4A 3TU4K 2XK0A 3JCMh 1V29B 4LDWA 2OAUA 1YHQT 3QJYA 1NJIU 2RI5A 5HY6A 3OMGA 1JJCA 1UGQB 4XU1A 4WI1A 4RMFA 3HL8A 4A4KA 5DLQE 1YJNT 4L87A 2VGMA 1E1TA 1B70A 2LRQA 4M7AD 4M7DC 2E10A 3A5ZA 1JJ2A 2QTXA 4JLIA 2KDSA 3KXTA 1M1KU 3FB9A 5LJ3e 1YITA 1D3BA 4M77C 2JZ2A 3CCET 3FDRA 4KR2A 5GAN7 2QQRA 5GANf 1WNLA 1N6AA 2Q7HA 2CZ6B 4FIBA 1NJ5A 1Y7XA 2LDMA 1MHNA 5M9OA 1KQ1A 1BI0A 3JB9H 2JN0A 4IURA 3RIRA 4HT8A 2XHCA 3QYGB 4QQ6A 4RDXA 3OYMA 3CCQA 1YFRA 3DSQA 3P8HA 3A5ZB 3O8VA 5GMKm 1B70B 5CK9A 3I55T 4HWTA 1W66A 4YRRA 4GY5A 1BI1A 4QQGA 2E12A 4YCVA 1H4SA 1BKBA 3QG1A 2IY5B 4IKFA 3ERRA 1KHCA 1ATIA 4DOWA 1WYDA 4BI8B 1K9MC 1PYSA 1M1FA 5CIUA 1SETA 4BDYA 4QQDA 4WF2A 1KC8C 4UP9A 4FU6A 1ASYA 1M1GA 5GAMh 3VUZA 4HWSA 3E9GA 1W4SA 3OD1A 2J3LA 4QVDA 2QA4A 1XNIA 1VQMA 5IAYA 4ELYC 5HK3A 2CJAA 3DB4A 5LJ5j 4C0ZA 3OYCA 4A53A 3PIPA 2F5KA 3CMET 4C92B 4LDYA 3LW5E 2VGNA 3IKLA 2K3YA 1QVGS 4MMKA 4WJ3M 3OYIA 1U8RA 4ZGDB 1M8VA 3A8LB 2M16A 4JRQA 5GAOm 4YRGA 4LDUA 1JRIA 4YDQA 4FT4A 1VQ9T 3ICAA 3JCMJ 4PHCA 4M77F 4M7AC 4PJOC 4M78E 1K73U 4F7UG 3VUBA 4M7DF 4IUQA 3QPHA 5GANh 1Q82C 4XQ3A 1X2HA 2XIDA 4P75A 3CPFA 2EJGA 1M90U 2R58A 3M56A 3OW2S 2QXFA 2P0PA 4C5HA 3REUA 2K5LA 4ZN3A 2VXEA 3A5YA 5GAMe 3JCMg 4MMLA 2PMFA 3CC2A 1LJOA 1OZ2A 4PLIA 1G51A 3JCMb 2CGHA 1NJ1A 2ZT8A 4C8QB 1H4TA 4BY6B 3LWIA 5LJ5f 3RL6A 1NJ8A 5LJ3g 3FEOA 3JCMf 4R55A 3PT9A 4KR3A 5DM7R 4G84A 4MDXA 1Y96A 2RJCA 5HK0A 4UC4A 4BI4A 1YCYA 3WXMB 5FU7C 4XEMA 2M9UA 1E1OA 4HA8A 4M78D 2KVQG 4PJOF 2MI6A 1YJ9A 2MWPA 4YPFA 4KT0E 2DIGA 3CCJA 4YRKA 2DO3A 2DTIA 3CPWA 4ZGJB 4B9XA 1YITT 1W2BS 4L5GA 4RMOA 4KULA 5GANd 2DVEA 5GAOq 4X5OA 4HWPA 2A8EA 1Q7YC 3G6EA 3QUIA 2HQXA 1VUBA 3TCJA 1G3YA 3HXUA 3LX7A 2EQUA 4ELZC 2Q7EA 1YGBA 4LNSA 1QVFS 2XI9A 3PTAA 1PSEA 4M78G 4A54A 2ZPGB 4P72C 4AH6A 2O4XA 1LYLA 1EIFA 4OGCA 2I4MA 4ATOA 2XD0A 3GF5A 2QHVA 2K2VA 2ZPFB 5GAMj 3G7ZA 3JB9F 2X4JA 1LNXA 1UGSB 5CAIA 4TVAA 1Q81C 2P5IA 2ZNJA 1VQPA 4M77A 4X9DA 1G5VA 2P0KA 5FROA 2EQJA 4OB0B 4XTUA 4M7AB 4RKUE 1WLEA 3M58A 5FU6B 1B34A 5CQYA 2Q5HA 3KFUA 1VQ9A 5I2SA 2EAYA 1YJWT 2R5AA 4XU3A 4M7AE 2A7YA 1QP3A 4EDUA 2CYZB 1Q81U 4CH5A 2RI3A 3M9QA 12ASA 1G3SA 3TUPA 5GAMd 2LCCA 4XU0A 3CMEA 3JCMQ 4J15A 5LJ3f 3MQZA 3UPUA 1X2GA 2BKDN 4C8QF 3GLXA 3OYHA 3RMQA 1VQKA 2E6ZA 1HK9A 4YRNA 3CXCS 4JJNK 2C8MA 4N0AC 2ZIMA 1KD1C 3OYAA 4PJOG 3GOXA 4HWOA 3OYBA 3DB3A 4B9WA 2MWOA 2XG8D 3M4YA 2KQWA 3M53A 2PQWA 4PJOE 4PNOA 1E22A 1YFTA 3LWHA 2KK4A 1X6OA 3FRNA 1M4ZA 4BD3A 2PVOB 4CH6A 3A31A 2CS7A 3SWNC 3CCEA 5C52B 3VV0A 4ME7A 4TVRA 4NL2A 4FT2A 4M75F 5GAOl 1YI2T 4YYEA 3SWNB 3NTIA 3TEHA 1SSFA 3V7RA 4K87A 2WSFE 3UDCA 1B34B 1YJNA 3MEVA 3RF1A 1O75A 4GLKA 3M54A 1ASZA 1WJSA 1VQ8T 2XDPA 1UGRB 4M77G 5CKDA 1KD1U 1SRYA 3VBBA 3AHUA 2XDBA 5CKBA 4C92F 3CCUT 5D6XA 4IUUA 3CCUA 5GAMg 2RO0A 3CCQT 1UB4A 5CVIA 1N8RC 4J7FA 4BI3A 2V8IA 4BB7A 1YIJA 3RGLA 1WQWA 3OQ5A 3QIIA 3I7FA 4YP0A 3HHTB 1G5HA 3IG2A 4M7DB 1Q7YU 2F5TX 1FXXA 2BUDA 5AYFA 2VXFA 3CCRA 2D6FA 3OSVA 2ZNIA 3L2RA 2MMPA 5KE3A 5GAMf 4TWAA 5FLXE 2EJFA 1EQRA 1H3ZA 1JJ2S 5K1XA 2C06A 1NJ2A 3A8MB 2D9TA 3E9HA 4CS2A 4K88A 4M77D 1EOVA 5EG2A 4YCUA 4RG2A 5E3IA 2RHUA 4N4HA 3CC4T 4LDVA 4ZIBA 2H3JA 2HBPA 4PKCC 3P8YA 3L2WA 2G4CA 3ME9A 2EWNA 3OS1A 5LJ5g 2ZPEB 3EFRA 3L2UA 2JTFA 4L6V5 2E5AA 2PUOB 4IUPA 4BDZA 3CBMA 4HCCA 5J39A 3BFMA 2DKGA 5A0LA 3UFGA 3FJPA 3GP8A 5C0MA 2DTOA 3MCAB 3OYLA 4P71C 2HD0A 3DKMA 3CCRT 4OMFB 1B7YA 1HTTA 4C5EA 1KQ2A 2DEQA 1SESA 4TQFA 1RI0A 1Y71A 4LVKA 3BJUA 4CS3A 1VQOA 2RK2A 3F70A 2Q7GA 4A4FA 3OBWA 2L8DA 1X01A 2ZT6A 3A32A 1QE0A 4H02A 3ZEHA 1ZHIA 2PU9B 5CCAA 1YJ9T 4YRIA 4A4GA 3QDRB 3BY7A 4X9CA 1YIJT 5GANj 2RHXA 3INZA 1I81A 2GQVA 3J7AF 11ASA 1Q86C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2L A;  4C92 C;  2I4O A;  3REU A;  4EMH A;  4TTV A;  3M4P A;  2RHQ B;  2VXE A;  2DQ3 A;  4JRK A;  3A5Y A;  5GAM e;  3JCM g;  1VQZ A;  1PYS B;  4MML A;  3E9I A;  2PMF A;  2YHT A;  3V7S A;  3PZC A;  4H2V A;  4NCX A;  3P8V A;  5GAO r;  2E1H A;  1LJO A;  5GAN 3;  2I4N A;  1G51 A;  3JCM b;  2CGH A;  3V8J A;  1NJ1 A;  2ZT8 A;  4C8Q B;  2ZT7 A;  1H4T A;  5LJ5 f;  3RL6 A;  2DZC A;  4F7U B;  3VQY A;  1NJ8 A;  5LJ3 g;  4E51 A;  4JRI A;  3JB9 I;  3JCM f;  4H2W A;  4KR3 A;  3JCM c;  4G84 A;  4C8Q E;  1I5L A;  3FIF A;  1Y96 A;  1YCY A;  2ZR3 A;  5KNN A;  2XGT A;  2ZCE A;  4XEM A;  3QTC A;  2PME A;  3L1A A;  4M7A F;  1E1O A;  4HA8 A;  4TVW A;  4M78 D;  4PJO F;  5GAN 4;  2FB7 A;  5C53 B;  4YPF A;  1NNH A;  2ZIN A;  4YRK A;  3HXW A;  1U1S A;  1WQ7 A;  2DTI A;  3QNE A;  1JBM A;  2YLB A;  4H2S A;  1D3B B;  2DXU A;  5GAN d;  4Q15 A;  2DVE A;  5GAO q;  4X5O A;  1ADJ A;  4HWP A;  1B8A A;  2HNI A;  5GAN e;  4DPG A;  1WPY A;  2K57 A;  1X56 A;  4NOY A;  4TVY A;  4H2X A;  1EVL A;  1Y96 B;  3HXY A;  4M75 D;  3A7A A;  2DJZ A;  3V8L A;  4M75 C;  3V8K A;  1Z7N A;  3QUI A;  4F7U E;  1JJC B;  3HXX A;  4M78 A;  3HXU A;  4P73 A;  3NEN A;  2YLC A;  4P3O A;  1B7Y B;  1NYQ A;  3G1Z A;  2ZR2 A;  2Q7E A;  2DXT A;  2QHU A;  1EIY A;  1YGB A;  4LNS A;  4V2S A;  1J5W A;  5GAO n;  4YRC A;  3M4G A;  4PG3 A;  4M78 G;  4A54 A;  3REX A;  4P72 C;  4AH6 A;  1M5Q 1;  3VQX A;  1LYL A;  2I4M A;  5LJ3 d;  4XTW A;  2QHV A;  3SB2 A;  4EMK B;  5GAM j;  4M78 C;  3W3S A;  3JB9 F;  4H2Y A;  2CIM A;  1LNX A;  3JB9 J;  5CAI A;  5LJ5 e;  2XTI A;  3JCM e;  4H2T A;  4C8Q A;  4TVA A;  2DU5 A;  4XU2 A;  2ZTG A;  2P5I A;  2ZNJ A;  3LSQ A;  4EO4 A;  4UP7 A;  4M77 A;  4X9D A;  3BDU A;  1NYR A;  4CH3 A;  4ZTZ B;  4XTX A;  3NEM A;  2DQ0 A;  5K1P A;  4XTU A;  4M7A B;  4F7U A;  1WLE A;  1B34 A;  3M4Q A;  5GMK l;  2Q5H A;  2ARU A;  4RQE A;  3HXZ A;  2Y90 A;  3KFU A;  1GGM A;  2ZT5 A;  1YB3 A;  4TVA B;  2ART A;  4M7D E;  2QHS A;  1KOG A;  1EIY B;  4P75 C;  2EAY A;  3JCM V;  4XU3 A;  4M7A E;  4XTZ A;  4EMK A;  2AMC A;  3JCM X;  3HRK A;  4M78 B;  3RKY A;  3HFZ B;  3PGG A;  3HFZ A;  3VQW A;  2RA2 A;  5LJ3 h;  4CH5 A;  1WU7 A;  4YCW A;  4TQD A;  3HSB A;  2CJB A;  12AS A;  1BIB A;  5LJ3 j;  4QVC A;  3TUP A;  2RD1 A;  3L2Z A;  5I21 A;  5GAM d;  1IL2 A;  4N0A A;  4XU0 A;  2ZZE A;  3JCM Q;  4J15 A;  5LJ3 f;  2DU7 A;  2RHS A;  3RKX A;  3WQZ A;  4M7D D;  2ZZG A;  1X2G A;  1I8F A;  1BBU A;  3R07 A;  4C8Q F;  3RAC A;  1B76 A;  1N9S A;  4P71 A;  1X55 A;  4OLF A;  2ZGW A;  2RHQ A;  1HK9 A;  4YRN A;  4M75 G;  3HY1 A;  1LOJ A;  3LC0 A;  4HVC A;  3HFN A;  1H4V B;  3JCM W;  3QO3 A;  2C8M A;  3MEY A;  5GAN 2;  4ZTU B;  4WJ4 A;  4N0A C;  2QHT A;  2ZIM A;  5GMK j;  4M7A A;  4PJO G;  4C92 A;  5GMK i;  4YRF A;  1MGQ A;  1Z7M A;  3HFO A;  4YRO A;  5HGQ A;  2C7I A;  4HWO A;  4M77 B;  5GAN g;  3JCM h;  4P74 A;  4J5Y A;  4RCC A;  1HC7 A;  2ARS A;  2AKW B;  2DDZ A;  4PJO E;  4PNO A;  1E22 A;  1YFT A;  1EFW A;  1KMN A;  2Q5I A;  2E64 A;  4YRM A;  4EMK C;  3HTZ A;  4UP8 A;  3JCM P;  3UGT A;  2AKW A;  3HXV A;  5LJ5 d;  1TH7 A;  1JJC A;  4CH6 A;  3A31 A;  4XTY A;  4XU1 A;  3SWN C;  4WI1 A;  5C52 B;  4G85 A;  4RMF A;  4M7D G;  3HY0 A;  4L87 A;  4NL2 A;  4M75 F;  1BIA A;  1E1T A;  4BWA A;  5GAO l;  4M77 E;  1B70 A;  4YYE A;  3SWN B;  3TEH A;  4M7A D;  3V7R A;  4M7D C;  4K87 A;  2E10 A;  1B34 B;  3A5Z A;  2QTX A;  4JLI A;  4C8Q G;  2ODR C;  5GAN 6;  3EFS A;  5GMK e;  3FB9 A;  5LJ3 e;  4YRE A;  3RF1 A;  2DZ9 A;  2E65 A;  1D3B A;  4M77 C;  3IAL A;  2E41 A;  4XEO A;  4Q6G A;  4Y91 A;  5GAN 7;  1ASZ A;  1I4K 1;  4KR2 A;  5GMK h;  4OP0 A;  3LSS A;  3A7R A;  1FYF A;  4XTV A;  1WNL A;  4M77 G;  5GAN f;  1SRY A;  3VBB A;  3AHU A;  2Q7H A;  4C92 F;  1USY C;  4BW9 A;  1NJ5 A;  5GAM g;  4C92 D;  3GIB A;  3P8T A;  2P0L A;  1KQ1 A;  4CS4 A;  4HT9 A;  5GAN 8;  3JB9 H;  2JN0 A;  5ELO A;  3RIR A;  3NET A;  3RGL A;  4NL3 A;  4HT8 A;  3MF2 A;  1WQW A;  3I7F A;  4RDX A;  4P73 C;  3QO7 A;  4YP0 A;  1YFR A;  3DSQ A;  4M78 F;  1G5H A;  4EMG A;  5GMK m;  3IG2 A;  4M7D B;  3VQV A;  4YRS A;  1B70 B;  3L4G A;  2VXF A;  3UGQ A;  4HWT A;  1W66 A;  1NJ6 A;  4YRR A;  2ZNI A;  4H2U A;  3BW1 A;  5GAM f;  1N9R A;  4TWA A;  4YCV A;  4RCB A;  2EJF A;  1EQR A;  1H4S A;  3QHS A;  2VC8 A;  4UPA A;  1X54 A;  4P3P A;  5K1X A;  5LJ5 h;  4M75 E;  4KQE A;  3JB9 G;  1NJ2 A;  3IKM B;  5F5W A;  2IY5 B;  3ERR A;  4PJO D;  3E9H A;  2E3C A;  1U1T A;  4CS2 A;  1KMM A;  4K88 A;  1EOV A;  4M77 D;  1ATI A;  4YCU A;  3HRI A;  1WYD A;  3TEG A;  5ELN A;  1PYS A;  5E3I A;  1SET A;  4C92 G;  4PJO A;  4WF2 A;  4P72 A;  3PCO B;  4YRT A;  4ZIB A;  4UP9 A;  1ASY A;  5GAM h;  3QSU A;  4O2D A;  3SWN A;  3TEH B;  1BBW A;  3P8Y A;  3RUX A;  1E24 A;  3QO8 A;  2ALY A;  2G4C A;  1H4Q A;  4J6W A;  3PCO A;  4HWS A;  4J6Y A;  3OD1 A;  2EWN A;  2J3L A;  4M7A G;  2ZXF A;  4DQ2 A;  4QVD A;  5LJ5 g;  2J3M A;  4YRJ A;  4C8Q D;  4CH4 A;  4C8Q C;  2RHS B;  3A7U A;  2ALY B;  3EFR A;  2E5A A;  1SER A;  1EVK A;  2CJA A;  5LJ5 j;  3JB9 D;  1HXD A;  5GAO p;  1ADY A;  4A53 A;  3RKW A;  2IY5 A;  4JUV A;  1G5I A;  1USY A;  3BFM A;  4P3N A;  2DKG A;  4YRP A;  2DTH A;  4F7U F;  3UFG A;  3FJP A;  3UH0 A;  4C92 B;  4K86 A;  1L0W A;  2DTO A;  3VU3 C;  2CJ9 A;  3IKL A;  4MMK A;  3L4G B;  4P71 C;  4YRQ A;  4WJ3 M;  4J6X A;  4C92 E;  1M8V A;  1B7Y A;  1HTT A;  1KQ2 A;  2EJ9 A;  2DEQ A;  4M75 A;  1N9W A;  4HWR A;  1QF6 A;  1SES A;  4TQF A;  4M7D A;  5GAO m;  4YRG A;  3RES A;  1JRI A;  3BJU A;  4YDQ A;  1YFS A;  3A74 A;  2AMC B;  4CS3 A;  2ZIO A;  2Q7G A;  3ICA A;  4RQF A;  4H2X B;  3JCM J;  4PHC A;  1C0A A;  4M77 F;  4M75 B;  4M7A C;  1RIQ A;  1X01 A;  2I4L A;  2ZT6 A;  3A32 A;  2EL9 A;  3HFV A;  4PJO C;  4M78 E;  1QE0 A;  4H02 A;  2ODR D;  2RB6 A;  4F7U G;  4M7D F;  3QO5 A;  5GAN h;  4YRI A;  2ZZF A;  5C51 B;  4XQ3 A;  4PJO B;  1X2H A;  3BY7 A;  4X9C A;  5GAN 5;  4P75 A;  4YRL A;  5DY9 A;  5GAN j;  4P74 C;  3V7C A;  4EX5 A;  3RER A;  3JCM d;  3NEL A;  3MF1 A;  2RM4 A;  2EJG A;  1I81 A;  3INZ A;  2FYK A;  11AS A;  3CMQ A;  1H64 1; 
#chains in the Genus database with same CATH topology
 2I2L A;  4JDS A;  4YTL A;  1NYG A;  5A0D A;  1M2O A;  4LDX A;  1J3T A;  3O5Z A;  1VQ8 A;  4JRK A;  4EPC A;  1PYS B;  2RJE A;  2RH2 A;  5A2Q E;  2RQR A;  2YRD A;  2E1H A;  5GAO r;  4IUT A;  3S3N A;  4MZM A;  4OB1 B;  4LXC A;  5KH6 A;  1D1C A;  4ZTJ A;  1JB0 E;  4BUG A;  1VQL Q;  3MP1 A;  2CSQ A;  2FVU A;  2FPE A;  3SDZ A;  3MP8 A;  4JRI A;  3JB9 I;  2V26 A;  2JJ9 A;  3LGL A;  4ZTF A;  1KQS A;  2ZR3 A;  5KNN A;  2XGT A;  3PMI A;  1IRE B;  4KH1 B;  8ATC B;  2KAF A;  2CUD A;  4M7A F;  2F1L A;  2KEA A;  1VQO Q;  3KUF A;  5GAN 4;  2RHY A;  1M1K R;  2ZIN A;  2YUN A;  2WAC A;  3OA6 A;  3M57 A;  2Y4Y A;  3HXW A;  4JZ3 A;  2D0N A;  2RHI A;  1BYM A;  1LPL A;  1U1S A;  2BZX A;  2NWM A;  1WQ7 A;  2AHJ B;  2RHZ A;  4F16 A;  1D3B B;  1UGV A;  2YSQ A;  2ESW A;  3HPW A;  1QQJ A;  3VS7 A;  1FWZ A;  3CBO A;  4XK8 E;  4DBQ A;  1ADJ A;  1B8A A;  3KFV A;  5GAN e;  3LLR A;  4DPG A;  1WPY A;  2K57 A;  3CD6 A;  4TVY A;  5HCK A;  3VS6 A;  3HXY A;  3CD6 Q;  2P4T A;  4M75 D;  3A7A A;  3V8L A;  3G71 T;  4L59 A;  2RQW A;  1K76 A;  4OB2 B;  2KI7 A;  3J81 E;  2X9H A;  2CP0 A;  4F7U E;  2KBT A;  3CME Q;  1JJC B;  1VQN A;  3NEN A;  1QWE A;  3CCM A;  1X2K A;  2ZPI B;  1YBY A;  1RAE B;  2ZR2 A;  2QHU A;  4V2S A;  1G2B A;  3MET A;  5GAO n;  4YRC A;  2JTM A;  5ECA A;  4K11 A;  4PG3 A;  1Q86 C;  1QW1 A;  3DLL A;  1VIE A;  2MF2 A;  1VQM T;  4Y92 A;  1S72 T;  4Z02 A;  4XTW A;  1QCN A;  3SHW A;  1K4U S;  1NZ9 A;  3CCV T;  3OY9 A;  3JB9 J;  2XTI A;  3TSW A;  3JCM e;  2Y4X A;  4JS5 A;  1TUD A;  3GNG A;  4CH3 A;  5IN1 A;  4ZTZ B;  1NLP C;  3CCV A;  3I35 A;  4PFO A;  4QVZ A;  5K1P A;  1CKA A;  1QVP A;  4PFZ A;  1KK7 A;  2CZ7 B;  3OSS C;  1K9M U;  1CKB A;  2PVD B;  1VQP Q;  2QA4 Q;  1UFF A;  2ARU A;  4OML A;  2KSS A;  1GGM A;  1PRL C;  4M7D E;  2QHS A;  5FWB A;  2L3Q A;  1BU1 A;  2AMC A;  4PFP A;  2DNU A;  3JCM X;  1ARK A;  3EAE A;  3OW2 P;  1W70 A;  3RKY A;  3PGG A;  2RA2 A;  3EFO A;  1WU7 A;  4P5N A;  1H3H A;  4FSX A;  4YCW A;  5KYN A;  1D0Y A;  3HSB A;  2CJB A;  3ASK A;  5LJ3 j;  4QVC A;  2RD1 A;  4DBH A;  1S72 Q;  3SFM A;  4HVW A;  2L5Q A;  5I21 A;  1IL2 A;  2XU8 A;  4N0A A;  1GCQ A;  1WXT A;  5IH2 A;  2ZZE A;  4CC7 A;  3OYE A;  1D0X A;  2RHS A;  3WQZ A;  4CC2 A;  1OZ3 A;  1BBU A;  1N9S A;  1FX7 A;  1N8R U;  4CRI A;  1LOJ A;  2JXB A;  3JCM W;  3G71 Q;  3CC4 A;  4O5V A;  4ZTU B;  5D7U A;  1VQ7 A;  2QHT A;  2JUF A;  2YUO A;  1V76 A;  2L89 A;  5GMK i;  2WSC E;  1WZO A;  2D1X A;  2K3X A;  1NPP A;  1Z7M A;  3HFO A;  4YRO A;  1SPK A;  2ZPB B;  2C7I A;  2FEI A;  3CCJ Q;  4P74 A;  4J5Y A;  4RCC A;  2AKW B;  2LQK A;  2DER A;  1M1K C;  1Q95 G;  1EFW A;  1KMN A;  2E64 A;  4J9H A;  3ZFJ A;  4UP8 A;  3JCM P;  2KE9 A;  3UGT A;  3HXV A;  5KE2 A;  4FCY A;  5LJ5 d;  2M0O A;  1OYX A;  1KQS S;  2QEX T;  3TEE A;  4RUG A;  1M3C A;  2ZPH B;  4OMN A;  1SSH A;  4G85 A;  3BE3 A;  3MP6 A;  2K5F A;  4BWA A;  4AG2 C;  3PFS A;  3L2Q A;  1AWJ A;  1I5O B;  2SEM A;  1MMA A;  2PTK A;  2NYS A;  2E5K A;  4II1 A;  5FU6 C;  4JS4 A;  4C8Q G;  2ODR C;  5GAN 6;  3EFS A;  1ZUY A;  5GMK e;  2GTO A;  4C0D C;  2QGG A;  2XIC A;  4XEO A;  1IXD A;  2KT1 A;  2QEX A;  3LGF A;  4Y91 A;  1I4K 1;  5GMK h;  2CKK A;  3OYN A;  4OP0 A;  3LSS A;  4J9D A;  2ROL A;  1JXM A;  4XTV A;  5FRN A;  1TTH B;  4A63 B;  4BW9 A;  1AOJ A;  1Q86 R;  5D6W A;  3HTR A;  4C92 D;  4ZN1 A;  2P0L A;  4HT9 A;  1W2B P;  3OS0 A;  3NTH A;  3NPF A;  3NET A;  3CEY A;  1QLY A;  4NL3 A;  2VB6 A;  3MF2 A;  4E7S A;  3U23 A;  1ABO A;  2DK3 A;  4M78 F;  5KCO A;  2X4X A;  4EMG A;  3HRT A;  3JSC A;  2JMC A;  1IHW A;  4PJL A;  4C5I A;  3UGQ A;  1NJ6 A;  4A4H A;  4JLG A;  4DEX A;  4BE1 A;  1P92 A;  2F2V A;  4RCB A;  2VAS A;  1X43 A;  2GCX A;  2VC8 A;  3QHS A;  4UPA A;  3MEW A;  1X54 A;  2HQE A;  5LJ5 h;  4M75 E;  4KQE A;  4LNP A;  4WTO B;  3ER0 A;  5F5W A;  1YIJ Q;  1KJW A;  4DEY A;  2ENM A;  3UF4 A;  2LNV A;  1U1T A;  3P8D A;  2OTL A;  1KMM A;  2GF7 A;  1T0H A;  4Q5W A;  4D6W A;  1FYN A;  3HRI A;  2O9V A;  2RI2 A;  5IXB A;  2J06 A;  5ELN A;  3TEG A;  2IPO B;  4C92 G;  2JM8 A;  2BZY A;  3S3M A;  2QI2 A;  1ZBX A;  3PCO B;  2ABL A;  2ED1 A;  4X34 A;  2WSE E;  5L8R E;  4O2D A;  2K5I A;  1BBW A;  2VKN A;  3RUX A;  1E24 A;  2DF6 A;  2ALY A;  4C5G A;  2VVK A;  3QZ9 B;  1H8K A;  1K1Z A;  3UT1 A;  2EQM A;  2ZXF A;  1UEC A;  2J3M A;  4C8Q D;  1RAD B;  2OTJ A;  4C8Q C;  1UJ0 A;  2RHS B;  3CCS A;  1SER A;  4LVJ A;  4KGZ B;  3EG9 A;  1EVK A;  1Q86 U;  5GAO p;  1ADY A;  3M0U A;  3RKW A;  2V1R A;  2HSP A;  2CDT A;  1G5I A;  1F1B B;  2NS6 A;  3A8H B;  4P3N A;  4YRP A;  3GPL A;  5CR2 A;  2GQI A;  1OU9 A;  1XOV A;  3AT1 B;  4K86 A;  2GGR A;  2LT1 A;  2J7I A;  4N4I A;  2PVG B;  1QKW A;  3L4G B;  4NS5 A;  2RJF A;  4DOV A;  1D1B A;  2EJ9 A;  1SEM A;  2DL5 A;  2FRY A;  4M75 A;  1N9W A;  4HWR A;  1QF6 A;  5J3B A;  4M7D A;  3RES A;  1M90 R;  3MEU A;  2ZCF B;  4KUD K;  2MCN A;  3VYG A;  5GJW B;  1YJ9 Q;  2ZIO A;  2AZV A;  4FM4 B;  4D8K A;  3OYK A;  3PNW C;  1C0A A;  1VQP T;  2DMO A;  4M75 B;  2FO0 A;  3EHR A;  4OMP A;  3HFV A;  2QDY B;  3VJP A;  5IHI A;  2ODR D;  3QO5 A;  3DLM A;  1OI1 A;  1B7T A;  3N5B B;  2IVW A;  2VYT A;  2X4W A;  2DYB A;  4AFQ C;  4O6J A;  5C51 B;  4BY6 C;  1QCO A;  4PJO B;  3S6W A;  1BI2 A;  3QWX X;  1QVG A;  2W0Z A;  5DY9 A;  4YRL A;  4EX5 A;  3V7C A;  3RER A;  4N4G A;  1KHI A;  2J05 A;  3X26 B;  1TXQ A;  2P84 A;  1FMK A;  1AEY A;  2EFI A;  2FYK A;  3IQL A;  3OYG A;  3CMQ A;  4C92 C;  2I4O A;  3CMA A;  4EMH A;  5FWC A;  5HKC A;  4TTV A;  2DL4 A;  2GFA A;  2C0T A;  1NPR A;  2DQ3 A;  1SHG A;  1VQZ A;  4J9F A;  2YHT A;  3V7S A;  2KRS A;  3PZC A;  4H2V A;  4NCX A;  1M2V B;  3P8V A;  5CQX A;  3UA6 A;  3CMA Q;  5GAN 3;  3OYD A;  1GXI E;  1YCS B;  2I4N A;  1WHM A;  2YRV A;  2QQS A;  1X69 A;  1C0M A;  1BB9 A;  4KH0 B;  2ATC B;  2DZC A;  4F7U B;  1UUE A;  4LUD A;  2EBP A;  4E51 A;  4BAC A;  1WHH A;  4H2W A;  1MUZ A;  2A37 A;  3FIF A;  4BE2 A;  1RUW A;  3EG1 A;  2RQV A;  3VRY A;  4FSS A;  3MEA A;  1ZBJ A;  1VQ6 Q;  3EHQ A;  2QTV A;  2FB7 A;  1K73 C;  2J6F A;  2KMT A;  3CBP A;  4WCI A;  2BE9 B;  1E6H A;  1AVZ C;  1JEG A;  1WXU A;  1JBM A;  2YLB A;  4H2S A;  2CRE A;  5AT1 B;  1KD1 R;  2DXU A;  1C1A A;  4Q15 A;  2DXC A;  2DAQ A;  3H6Z A;  2BIV A;  2K7A A;  2FPF A;  1DJ7 B;  3VS0 A;  4E7L A;  1VQ5 T;  2L0A A;  2DFU A;  4JJB A;  3I5S A;  3EGD B;  3JAM E;  4QW2 A;  3OMC A;  4ANJ A;  4E7H A;  2C0O A;  3T9N A;  1Y96 B;  3I56 Q;  2DL3 A;  3OS2 A;  1YWP A;  2X35 A;  3CC7 Q;  3FC3 A;  1XQH A;  1UG1 A;  3QBY A;  3I56 A;  2R5M A;  1D1A A;  1HJD A;  2YT6 A;  1VQL A;  4M78 A;  2FZC B;  5C6S A;  2YLC A;  4OGE A;  1NYQ A;  5I22 A;  1YI2 A;  1B3Q A;  1EIY A;  1YJW A;  1PRM C;  3RDV A;  5LL6 S;  3TQ7 P;  1ACM B;  3A1P A;  3VS3 A;  2QK0 A;  5IT9 E;  1GFD A;  3PIO A;  2RK1 A;  3CCS T;  1M5Q 1;  2LC4 A;  3VQX A;  3QKJ A;  5LJ3 d;  3L42 A;  1G83 A;  2PUK B;  1UGP B;  1VQ7 T;  2CIM A;  5EC7 A;  3QYH B;  4H2T A;  1TWB A;  1QKX A;  4HT4 A;  1QVG P;  2FZG B;  2KRM A;  1VQ8 Q;  3LSQ A;  4EO4 A;  2L2P A;  1AHJ B;  1K8A C;  1NYR A;  3BDU A;  3P8B B;  1WFW A;  2LQN A;  2CP5 A;  3ZBD A;  1VQ4 T;  4PK4 A;  3J80 E;  2V8K A;  3H9N A;  2L3R A;  4Z88 A;  7AT1 B;  3CXC A;  3UWN A;  3M4Q A;  5GMK l;  2D8H A;  2CZ0 B;  5A0G A;  2ZT5 A;  2RQT A;  1YB3 A;  4TVA B;  3S3O A;  2ART A;  4JRP A;  1VQ4 Q;  1RAF B;  3TRE A;  2LQW A;  1EIY B;  4P75 C;  1UTI A;  4KBM B;  2EQK A;  2LX7 A;  4FL6 A;  1K8A U;  3HRK A;  1QCF A;  1CSK A;  3QDF A;  4M78 B;  3HFZ B;  3HFZ A;  2CZ1 B;  5LJ3 h;  1KSW A;  2K79 A;  1GL5 A;  1BIB A;  2OI3 A;  2OTL T;  2HKQ B;  3L2Z A;  1KG1 A;  2HQH A;  3VYH B;  2DA9 A;  4AFU C;  4M7D D;  2ZZG A;  2LMJ A;  4C0F A;  2AKK A;  2O01 E;  4E7J A;  3FLG A;  1QWF A;  2LT4 A;  3RAC A;  3Q1J A;  1JQQ A;  2EYQ A;  1T3S A;  4OLF A;  4LVL A;  3G6E T;  3QZ5 B;  1Q7Y R;  2KY9 A;  2KYB A;  3OYJ A;  3GNF B;  2RNA A;  3HY1 A;  1OV3 A;  2H3E B;  3HFN A;  1H4V B;  3QO3 A;  3MEY A;  1SRM A;  4AMC A;  5GAN 2;  4C0G A;  4WJ4 A;  2FRW A;  1XTD A;  4M7A A;  4YRF A;  1MGQ A;  1WGS A;  2CP7 A;  2A36 A;  3G1J A;  4J9C A;  5HGQ A;  1OX9 A;  1O9S A;  4M77 B;  5IHK A;  5GAN g;  2I0N A;  1HC7 A;  2ARS A;  2QQ9 A;  1NE8 A;  2DDZ A;  3C95 A;  2PNI A;  1E7O A;  2EW3 A;  1YIT Q;  2K4Y A;  1G3W A;  4KGX B;  3CC7 T;  1VIF A;  4KRT A;  2Q5I A;  3C4S A;  4YRM A;  4EMK C;  3HTZ A;  1M9S A;  1UHC A;  1M90 C;  1AWO A;  2AKW A;  2EIF A;  2QQA A;  1TH7 A;  1M30 A;  1FMV A;  4AFZ C;  3CC2 T;  4XTY A;  3MKD A;  2O2O A;  3KBG A;  4M7D G;  2LCL A;  3HY0 A;  1WJR A;  3I55 A;  2NLU A;  1BIA A;  2XKO C;  2M1H A;  1RL2 A;  4M77 E;  2DL8 A;  2KYM A;  2HSE B;  1VQN T;  4ZGE B;  2ZZD A;  1IRX A;  2FL7 A;  1YWO A;  3OW2 A;  2KRO A;  1M2V A;  1MND A;  4YRE A;  2DZ9 A;  2E65 A;  3IAL A;  2E41 A;  5J26 A;  4Q6G A;  1VYU A;  2DXB A;  3A8G B;  2AIR B;  3I55 Q;  1VQ6 T;  3CCJ T;  1FYF A;  3A7R A;  3MO8 A;  1K0X A;  1USY C;  2FPD A;  1BK2 A;  3NMZ C;  4E7K A;  1W2B A;  3GIB A;  2LVM A;  1PM3 A;  3P8T A;  4CS4 A;  2B86 A;  3CPW S;  5GAN 8;  2QG9 B;  1MV0 B;  5ELO A;  1UEB A;  3RR6 A;  3CCU Q;  1FMW A;  1TOV A;  3QO7 A;  4P73 C;  1ZSZ A;  3MHX A;  2JT4 A;  4JJC A;  3VQV A;  3RMS A;  2LX9 A;  4YRS A;  4RTT A;  4C0D B;  3L4G A;  3EGX A;  3QXE B;  1AZG B;  2A3L A;  3LH0 A;  1VQK T;  1I1J A;  3QJ6 A;  4H2U A;  1JO8 A;  3HP9 A;  4LVI A;  3BW1 A;  2K3B A;  3HKS A;  1N9R A;  2GFU A;  2LJ3 A;  2O9S A;  4R56 A;  4PJJ A;  1MMG A;  3EGX B;  4P3P A;  3JB9 G;  1U5S A;  4MZP A;  3IKM B;  4PJO D;  2QQB A;  2E3C A;  2IIM A;  4BE0 A;  2JS2 A;  2MIO A;  1WIE A;  2B8A A;  1VYT A;  2K2M A;  4J83 A;  3H0I A;  1Z9Z A;  1BI3 A;  5CKH A;  1SRL A;  3A8O B;  4PJO A;  2QA4 T;  3NFC A;  2EGA A;  3CC7 A;  1KQS P;  1PD1 A;  4P72 A;  4YRT A;  4HCZ A;  3HRS A;  3WVE B;  3QSU A;  3SWN A;  3TEH B;  1YP5 A;  3X28 B;  2M51 A;  1YFN A;  3QO8 A;  2D0Q B;  4ZNX A;  5KYU A;  2E5Q A;  1H4Q A;  4J6W A;  3PCO A;  4J6Y A;  2YXY A;  1K73 R;  2P4R A;  4VUB A;  4XAX B;  3UAT A;  4M7A G;  4DQ2 A;  4LD9 K;  3H41 A;  1R0C B;  2KXD A;  4F17 A;  4YRJ A;  4CH4 A;  2V8J A;  1YN8 A;  1S72 A;  1RAB B;  2ALY B;  3A7U A;  1QP2 A;  2LTO A;  2SRC A;  2G3R A;  1RI9 A;  2F69 A;  1GCQ C;  3JB9 D;  1HXD A;  5KYW A;  4LVM A;  4LD6 A;  2IY5 A;  2EKO A;  2DL7 A;  4JUV A;  1USY A;  2E6N A;  1W1F A;  2DTH A;  2QAZ A;  1K9M R;  4F7U F;  1WXB A;  3UH0 A;  5CKE A;  5I2M A;  1EX4 A;  1L0W A;  2VUB A;  1OU8 A;  3VU3 C;  2CJ9 A;  2CSI A;  4YRQ A;  4J6X A;  3EG2 A;  4C92 E;  3CD6 T;  2JVV A;  3CCM T;  3BDL A;  1VQ5 A;  2IG0 A;  1YJW Q;  1T0J A;  4J7I A;  2JMA A;  1WA7 A;  1YFS A;  3A74 A;  2AMC B;  1NEG A;  1U06 A;  2DRM A;  1M8M A;  3X24 B;  3G71 A;  3OB9 A;  3HRU A;  1AWX A;  4RQF A;  4H2X B;  1PSF A;  1NG2 A;  2HL3 A;  1RIQ A;  2I4L A;  2EL9 A;  1X27 A;  4KUI A;  2RB6 A;  2O88 A;  2E3H A;  5DLO A;  3X20 B;  2OJ2 A;  1VQ9 Q;  3CPW P;  2ZZF A;  3L2V A;  5GAN 5;  4P74 C;  4OF1 A;  3JCM d;  3M0T A;  3NEL A;  3MF1 A;  2RM4 A;  3I9Q A;  3VRZ A;  1H64 1;  5CKF A;  2KNB B;  2PZ1 A;  3CCL T;  2YUQ A;  4HKE A;  3M4P A;  2ECZ A;  2EVR A;  4A4E A;  1VQL T;  2RHQ B;  1VQ6 A;  3E9F A;  3M59 A;  4E47 A;  3E9I A;  2DBK A;  2MAM A;  2HBW A;  1NM7 A;  2FZK B;  3URG A;  2RMO A;  1TS9 A;  1VA7 A;  2RJD A;  3V8J A;  2ZT7 A;  3C12 A;  5FU7 B;  3VQY A;  3QWY A;  3I56 T;  3JCM c;  4C8Q E;  1I5L A;  1H92 A;  1ZQ1 A;  1ZSG A;  1ZUK A;  3CXC P;  2O4X B;  2P0Q A;  3NTK A;  1WJQ A;  2EPD A;  2ZCE A;  3QTC A;  3R6O A;  2CH4 A;  4PL6 A;  1LCK A;  1HSQ A;  3L1A A;  3VS4 A;  4E2F B;  2PME A;  3EGU A;  4TVW A;  1KC8 U;  5CO7 A;  2NUZ A;  3OYY A;  5C53 B;  1NNH A;  1IZ6 A;  1N5Z A;  1Y07 A;  1UE9 A;  3QNE A;  4KGV B;  3SD4 A;  4HCB A;  1YJN Q;  2BZ8 A;  4OVA A;  3M5A A;  2HNI A;  1G3T A;  1N27 A;  3X25 B;  1X56 A;  2X4Y A;  4NOY A;  4MDW A;  1NJI C;  4H2X A;  1EVL A;  2DJZ A;  3JRZ A;  4M75 C;  3V8K A;  1Z7N A;  1PC0 A;  1K0S A;  2XMF A;  2FHD A;  2AT1 B;  3HXX A;  2VV5 A;  4IIM A;  2NUP A;  4LN2 A;  3CCL A;  2DD5 A;  4CI0 C;  4P73 A;  2YRC A;  3CMA T;  1B7Y B;  3G1Z A;  4P3O A;  3PMT A;  2DXT A;  2LQ8 A;  1J5W A;  3OYF A;  3M55 A;  4RG8 A;  4PLL A;  3E19 A;  4FYY B;  4FYX B;  1KIK A;  1Y0M A;  3M4G A;  2HAX A;  4AT1 B;  1BBZ A;  1NYF A;  2CP2 A;  2NUP B;  3REX A;  4GBQ A;  1QVF A;  4E7I A;  1AT1 B;  3SB2 A;  4EMK B;  3W3S A;  4M78 C;  4H2Y A;  2CH4 W;  2O31 A;  1VQ4 A;  5D6Y A;  3D7S B;  2J6K A;  1R8O B;  5LJ5 e;  1YHQ A;  2DU5 A;  4C8Q A;  3WVD B;  4XU2 A;  2ZTG A;  2MK5 A;  3TVT A;  4OB3 B;  4J8O A;  4UP7 A;  3LYI A;  2AKL A;  5KCH A;  2E70 A;  1WLP B;  2EQI A;  4XTX A;  3H8Z A;  3C94 A;  1IGU A;  1Q82 U;  3VKI A;  2DQ0 A;  3NEM A;  4F7U A;  2JM9 A;  4MZT A;  3G4S T;  3VS2 A;  4IIO A;  2DPP B;  3CQT A;  4RQE A;  3HXZ A;  1IB8 A;  1AWW A;  2Y90 A;  2COZ A;  1KOG A;  1VQO T;  1WYX A;  2JOY A;  3JCM V;  2XDD A;  3PE0 A;  4XTZ A;  4EMK A;  1A0N B;  1WX6 A;  2R57 A;  5L23 A;  2NUT B;  3VQW A;  4IUV A;  2Z0W A;  3CCR Q;  4TQD A;  4OMQ A;  2DIQ A;  2ED0 A;  5FW9 A;  2MYS A;  2K6D A;  4FW2 A;  1M3A A;  2DIL A;  2DU7 A;  2OTJ T;  3E1S A;  3RKX A;  5FRM A;  1I8F A;  1HYO A;  3R07 A;  4Y28 E;  1B76 A;  4P71 A;  1X75 C;  1X55 A;  1GBQ A;  2OAW A;  1NJI R;  2ZGW A;  2RHQ A;  4LE9 A;  2JNG A;  3OBY A;  4M75 G;  1VQM Q;  3G4S A;  3LC0 A;  4HVC A;  2DD4 A;  2KRN A;  5GMK j;  3VS1 A;  1JJ2 P;  4C92 A;  3OS5 A;  4DA4 A;  3TU4 K;  2OTJ Q;  2XK0 A;  3JCM h;  1V29 B;  4LDW A;  2OAU A;  1YHQ T;  1NLO C;  2X51 A;  3QJY A;  3CC4 Q;  4B6M A;  1NJI U;  2RI5 A;  5HY6 A;  4RTV A;  3OMG A;  1JJC A;  4HXJ A;  4JJD A;  1UGQ B;  2L3S A;  2AK5 A;  2COY A;  4XU1 A;  4WI1 A;  1MNE A;  4RMF A;  1NBE B;  3HL8 A;  4A4K A;  5DLQ E;  1YJN T;  4L87 A;  2QEX Q;  1G8X A;  2VGM A;  1E1T A;  1B70 A;  1BCO A;  2LRQ A;  4M7A D;  4E7Z A;  2FG0 A;  4M7D C;  2E10 A;  3A5Z A;  1JJ2 A;  2QTX A;  4JLI A;  2KDS A;  3KXT A;  1M1K U;  3FB9 A;  5LJ3 e;  1YIT A;  1D3B A;  4M77 C;  2JZ2 A;  3CCE T;  4D8D A;  2JS0 A;  3FDR A;  4KR2 A;  5GAN 7;  9ATC B;  1ZLM A;  2QQR A;  3PVQ A;  5GAN f;  1WNL A;  2A08 A;  1N6A A;  4PJM A;  2Q7H A;  2CZ6 B;  1GBR A;  2EYY A;  4FIB A;  1NJ5 A;  1Y7X A;  5IHN A;  2LDM A;  1MHN A;  4J9E A;  5M9O A;  1KQ1 A;  1BI0 A;  3JB9 H;  2JN0 A;  3REA B;  4IUR A;  3RIR A;  3H0F A;  4HT8 A;  2HMA A;  1EFN A;  2XHC A;  3QYG B;  4QQ6 A;  4RDX A;  3OYM A;  1PWT A;  1D0Z A;  4M4Z A;  3CCQ A;  1YFR A;  3DSQ A;  1X6B A;  3P8H A;  3A5Z B;  3O8V A;  5GMK m;  4J9I A;  1B70 B;  3CCE Q;  5CK9 A;  3I55 T;  4HWT A;  1W66 A;  4X1V A;  4YRR A;  1UDL A;  4GY5 A;  1BI1 A;  4QQG A;  2E12 A;  4YCV A;  2KGT A;  2EYW A;  1H4S A;  4RTY A;  1BKB A;  3QG1 A;  1PKT A;  2IY5 B;  4QKU A;  4IKF A;  3ERR A;  1KHC A;  2X3X D;  1ATI A;  4DOW A;  1WYD A;  3CCM Q;  4BI8 B;  1K9M C;  1PYS A;  1M1F A;  1WHL A;  5CIU A;  1SET A;  4BDY A;  4QQD A;  4WF2 A;  2KXC A;  1KC8 C;  1VQK Q;  4UP9 A;  3VS5 A;  4FU6 A;  1ASY A;  1M1G A;  5GAM h;  2OX7 A;  3VUZ A;  8AT1 B;  4HWS A;  3E9G A;  1JXO A;  1W4S A;  3OD1 A;  2J3L A;  2EKH A;  4QVD A;  2QA4 A;  1WHJ A;  2C0I A;  1XNI A;  1NEB A;  1VQM A;  3TSZ A;  5IAY A;  5KYU B;  4ORZ A;  4ELY C;  5HK3 A;  1PCX A;  3EH2 A;  2DYI A;  2CJA A;  2E4H A;  3DB4 A;  5LJ5 j;  4C0Z A;  3OYC A;  4F04 B;  4A53 A;  2H8H A;  3PIP A;  2YUP A;  2F5K A;  3CME T;  4C92 B;  4LDY A;  3LW5 E;  2QYZ A;  2OTL Q;  2LP5 A;  2VGN A;  5KYW B;  3IKL A;  2K3Y A;  1QVG S;  1TSF A;  4MMK A;  2ZAE A;  4WJ3 M;  3OYI A;  1U8R A;  4ZGD B;  1M8V A;  3A8L B;  2LZ6 B;  2M16 A;  4JRQ A;  5GAO m;  1YNZ A;  4YRG A;  4LDU A;  1JRI A;  4YDQ A;  1VQ5 Q;  4FT4 A;  1VQ9 T;  1R77 A;  2RPN A;  3ICA A;  3JCM J;  4PHC A;  4M77 F;  5KYY B;  4M7A C;  4PJO C;  4M78 E;  1K73 U;  1M27 C;  4F7U G;  4LUE A;  2J6O A;  3VUB A;  4M7D F;  4IUQ A;  1RAC B;  3QPH A;  5GAN h;  1Q82 C;  3EFO B;  4XQ3 A;  2LJ0 A;  1X2H A;  2MPX C;  2XID A;  4P75 A;  3EH1 A;  3CPF A;  1JU5 C;  3CCV Q;  3LH5 A;  2EJG A;  2L3P A;  1M90 U;  2R58 A;  2QAS A;  3M56 A;  1RLQ C;  3OW2 S;  2QXF A;  2P0P A;  4C5H A;  3GBQ A;  3REU A;  1SF9 A;  3PVL A;  2CP6 A;  2K5L A;  4ZN3 A;  2VXE A;  2NUT A;  3A5Y A;  1ZA2 B;  3FJ5 A;  3JCM g;  5GAM e;  3G6E Q;  4MML A;  2PMF A;  1SG5 A;  3CC2 A;  3I5R A;  3JV3 A;  2DRK A;  1LJO A;  1OZ2 A;  4PLI A;  2EYX A;  3E2U A;  1G51 A;  3CCL Q;  1LVK A;  3JCM b;  2CGH A;  1NJ1 A;  2ZT8 A;  4C8Q B;  1AD5 A;  1H4T A;  4BY6 B;  3LWI A;  5LJ5 f;  3RL6 A;  1UJY A;  1NJ8 A;  5LJ3 g;  2CT4 A;  3CCQ Q;  3FEO A;  3JCM f;  4R55 A;  3PT9 A;  1VQN Q;  4KR3 A;  5DM7 R;  4G84 A;  4MDX A;  1Y96 A;  2RJC A;  5HK0 A;  4UC4 A;  4BI4 A;  1YCY A;  3WXM B;  1S1N A;  1ABQ A;  5FU7 C;  2YDL A;  4XEM A;  2M9U A;  3EGD A;  1E1O A;  1BCM A;  4HA8 A;  1K9A A;  4M78 D;  2KVQ G;  1ZUU A;  2MI6 A;  4PJO F;  1YJ9 A;  4OMO A;  1Z9Q A;  2MWP A;  4YPF A;  1ZA1 B;  4KT0 E;  2DIG A;  3CCJ A;  2G6F X;  4YRK A;  1PNJ A;  2DO3 A;  1QVF P;  2BE7 D;  2DTI A;  2DX1 A;  3CPW A;  1YI2 Q;  4ZGJ B;  1Q81 R;  4B9X A;  1YIT T;  1W2B S;  4L5G A;  2HKN A;  4RMO A;  4KUL A;  5GAN d;  2DVE A;  5GAO q;  2HEQ A;  4X5O A;  4HWP A;  3CC2 Q;  3MJX A;  2A8E A;  2A0F B;  1Q7Y C;  2E3I A;  4FYV B;  1RAA B;  2JTE A;  3G6E A;  3R6N A;  1R0B G;  2DM1 A;  3QUI A;  2HQX A;  1VUB A;  3TCJ A;  1G3Y A;  4HCK A;  3HXU A;  1EZZ B;  3LX7 A;  2EQU A;  4ELZ C;  3CCS Q;  1WHK A;  2Q7E A;  1YGB A;  1MMN A;  4LNS A;  1QVF S;  2XI9 A;  3PTA A;  4RTW A;  1PSE A;  4EIK A;  2HDA A;  4M78 G;  4A54 A;  2ZPG B;  4P72 C;  4AH6 A;  2O4X A;  1V1C A;  1LYL A;  1EIF A;  4OGC A;  4ATO A;  2I4M A;  2XD0 A;  3GF5 A;  2HL5 C;  3NHN A;  1RAG B;  1ZX6 A;  2QHV A;  2K2V A;  2ZPF B;  5GAM j;  2QDL A;  3G7Z A;  3JB9 F;  1AZE A;  2X4J A;  1IO6 A;  1LNX A;  1UGS B;  2F2W A;  3EG9 B;  5CAI A;  3M0P A;  4TVA A;  1Q81 C;  2P5I A;  2ZNJ A;  1OPK A;  1ZSZ C;  4FW1 A;  1VQP A;  1UHF A;  4M77 A;  3ZL7 C;  4X9D A;  1N8R R;  1G5V A;  2P0K A;  2EGC A;  5FRO A;  2EQJ A;  4OB0 B;  4XTU A;  4M7A B;  4RKU E;  2M02 A;  1WLE A;  3M58 A;  5FU6 B;  1B34 A;  5CQY A;  2CT3 A;  4RTU A;  2Q5H A;  2DE0 X;  3KFU A;  5KYY A;  1VQ9 A;  5I2S A;  2EAY A;  1YJW T;  2R5A A;  4XU3 A;  4M7A E;  4Z8A A;  2HCK A;  2A7Y A;  1X6G A;  4E6R A;  1QP3 A;  4GLM A;  4EDU A;  3M0Q A;  2CYZ B;  1Q81 U;  4CH5 A;  2RI3 A;  4AFS C;  1OUL A;  3M9Q A;  12AS A;  1G3S A;  4PJN A;  3TUP A;  4DBR A;  3RBB B;  5GAM d;  1PG5 B;  2LCC A;  2RN8 A;  4XU0 A;  3CME A;  1TUC A;  3JCM Q;  4J15 A;  5LJ3 f;  3MQZ A;  4HVU A;  3UPU A;  1X2G A;  2DBM A;  2BKD N;  4C8Q F;  3GLX A;  3OYH A;  3RMQ A;  1IHV A;  2COW A;  1U3O A;  1PKS A;  1VQK A;  2E6Z A;  1K8A R;  1HK9 A;  2ROT A;  4YRN A;  1Y57 A;  5KYX A;  4HVV A;  3CXC S;  4JJN K;  2C8M A;  1E6G A;  1Q82 R;  1OOT A;  4N0A C;  1I0C A;  1PD0 A;  2ZIM A;  1KD1 C;  3OYA A;  4PJO G;  4RTZ A;  5IXF A;  2RQU A;  2QGF B;  3GOX A;  2DLP A;  2A28 A;  1W6X A;  4HWO A;  3OYB A;  3DB3 A;  4B9W A;  1PHT A;  2XG8 D;  3M4Y A;  2GBQ A;  2KQW A;  3M53 A;  2PQW A;  4PJO E;  1OX8 A;  4PNO A;  1E22 A;  1GCP A;  1YFT A;  3LWH A;  2KK4 A;  4OMM A;  1X6O A;  3FRN A;  1M4Z A;  3THK A;  2W10 A;  4BD3 A;  2PVO B;  4CH6 A;  1OPL A;  3A31 A;  2CS7 A;  3SWN C;  3CCE A;  5C52 B;  4QT7 A;  3VV0 A;  4F14 A;  1XJW B;  4ME7 A;  4TVR A;  3RNJ A;  4NL2 A;  1RAI B;  2LJ1 A;  4FT2 A;  4M75 F;  1B07 A;  5GAO l;  4ESR A;  1YI2 T;  4YYE A;  3SWN B;  3NTI A;  3TEH A;  1SSF A;  3V7R A;  4K87 A;  2WSF E;  3UDC A;  1B34 B;  1WHG A;  2EGE A;  6AT1 B;  2RF0 A;  2CUB A;  1YJN A;  3MEV A;  3RF1 A;  1O75 A;  4GLK A;  3M54 A;  1ASZ A;  1WJS A;  2MOX A;  1VQ8 T;  2HZY A;  1UGR B;  2XDP A;  4M77 G;  5CKD A;  1KD1 U;  1SRY A;  3EG3 A;  3AHU A;  3VBB A;  3C0C A;  2XDB A;  5CKB A;  4C92 F;  3CCU T;  2KR3 A;  5D6X A;  4IUU A;  3CCU A;  5GAM g;  2RO0 A;  3CCQ T;  1UB4 A;  1C6V X;  1WDX A;  2DJQ A;  1VQ7 Q;  5CVI A;  1T3L A;  2D8J A;  1N8R C;  4J7F A;  4BI3 A;  2V8I A;  4BB7 A;  1QMC A;  1YIJ A;  3RGL A;  1WQW A;  3OQ5 A;  3QII A;  3I7F A;  4YP0 A;  3HHT B;  1KC8 R;  1G5H A;  3IG2 A;  2YWW A;  1HD3 A;  4M7D B;  1Q7Y U;  2F5T X;  1M3B A;  3M0S A;  1FXX A;  2BUD A;  5AYF A;  2VXF A;  3CCR A;  2D6F A;  3OSV A;  2ZNI A;  1ZSZ B;  3L2R A;  2MMP A;  3UA7 A;  5KE3 A;  5GAM f;  4FYW B;  1D09 B;  1KFZ A;  4TWA A;  2KT8 A;  5FLX E;  3REB B;  2EJF A;  1EQR A;  3A98 A;  1H3Z A;  1JJ2 S;  5K1X A;  2C06 A;  2AZS A;  1NJ2 A;  3A8M B;  2D9T A;  3E9H A;  1TUG B;  4CS2 A;  3H0H A;  4K88 A;  4M77 D;  1EOV A;  5EG2 A;  4YCU A;  2M0Y A;  4J9B A;  4RG2 A;  3ULR B;  2RHU A;  5E3I A;  1I07 A;  4N4H A;  4R0K A;  3G4S Q;  2DET A;  3CC4 T;  4LDV A;  4ZIB A;  2H3J A;  1YHQ Q;  4Z89 A;  3EG0 A;  2HBP A;  2DVJ A;  4PKC C;  3P8Y A;  3L2W A;  1MMD A;  4J9G A;  1GFC A;  2G4C A;  1GRI A;  3ME9 A;  2LNH B;  2EWN A;  4DBF A;  3OS1 A;  5LJ5 g;  2X3W D;  2ZPE B;  1OEB A;  1RAH B;  2LCS A;  1WI7 A;  3EFR A;  3L2U A;  2JTF A;  4L6V 5;  4RTX A;  2E5A A;  3MPU B;  2PUO B;  2V1Q A;  5GJV B;  1VOM A;  3SEM A;  4IUP A;  4BDZ A;  3CBM A;  4HCC A;  5I11 A;  5J39 A;  3BFM A;  2DKG A;  1TG0 A;  1IGQ A;  1MV3 A;  5A0L A;  2JW4 A;  3UFG A;  3FJP A;  3GP8 A;  2EYZ A;  5C0M A;  2CP3 A;  1OQK A;  2DTO A;  4JPB W;  2F2X A;  3MCA B;  3OYL A;  4P71 C;  2HD0 A;  3DKM A;  3M0R A;  3CCR T;  4OMF B;  4CC4 B;  1B7Y A;  1HTT A;  4C5E A;  4CC3 A;  1KQ2 A;  2BTT A;  2DEQ A;  1SES A;  1X2Q A;  4TQF A;  1RI0 A;  1Y71 A;  1VYV A;  4LVK A;  3BJU A;  2VWF A;  4CS3 A;  1VQO A;  2DEU A;  2RK2 A;  3F70 A;  2Q7G A;  4A4F A;  3OBW A;  2L8D A;  1X01 A;  2ZT6 A;  3A32 A;  5KYX B;  1QE0 A;  4H02 A;  1SKU B;  3ZEH A;  4JZ4 A;  1ZHI A;  2PU9 B;  5CCA A;  1YJ9 T;  1RLP C;  4YRI A;  4A4G A;  2GTJ A;  3QDR B;  3BY7 A;  4X9C A;  2K9G A;  1YIJ T;  5GAN j;  1SHF A;  3NGP A;  2RHX A;  2GNC A;  3INZ A;  1I81 A;  2GQV A;  4AG1 C;  3J7A F;  11AS A;  1TU0 B;  2MWO A; 
#chains in the Genus database with same CATH homology
 2I2L A;  4JDS A;  4YTL A;  5A0D A;  4LDX A;  1VQ8 A;  4JRK A;  4EPC A;  1PYS B;  2RJE A;  2RH2 A;  5A2Q E;  5GAO r;  2E1H A;  4IUT A;  3S3N A;  4MZM A;  4OB1 B;  5KH6 A;  4ZTJ A;  1JB0 E;  4BUG A;  3MP1 A;  2FVU A;  3SDZ A;  3MP8 A;  4JRI A;  3JB9 I;  3LGL A;  4ZTF A;  1KQS A;  2ZR3 A;  5KNN A;  2XGT A;  3PMI A;  1IRE B;  2KAF A;  4M7A F;  3KUF A;  5GAN 4;  2RHY A;  2ZIN A;  2WAC A;  3OA6 A;  3M57 A;  2Y4Y A;  3HXW A;  2RHI A;  1BYM A;  1U1S A;  1WQ7 A;  2AHJ B;  2RHZ A;  1D3B B;  3HPW A;  1FWZ A;  3CBO A;  4XK8 E;  1ADJ A;  1B8A A;  5GAN e;  3LLR A;  4DPG A;  1WPY A;  2K57 A;  3CD6 A;  4TVY A;  3HXY A;  2P4T A;  4M75 D;  3A7A A;  3V8L A;  3G71 T;  4L59 A;  4OB2 B;  3J81 E;  4F7U E;  1JJC B;  1VQN A;  3NEN A;  3CCM A;  2ZR2 A;  2ZPI B;  1YBY A;  2QHU A;  4V2S A;  3MET A;  5GAO n;  4YRC A;  2JTM A;  4PG3 A;  1QW1 A;  3DLL A;  2MF2 A;  1VIE A;  1VQM T;  1S72 T;  4Z02 A;  4XTW A;  1NZ9 A;  3CCV T;  3OY9 A;  3JB9 J;  2XTI A;  3JCM e;  2Y4X A;  4JS5 A;  3GNG A;  4CH3 A;  5IN1 A;  4ZTZ B;  3CCV A;  4QVZ A;  5K1P A;  1QVP A;  2CZ7 B;  3OSS C;  1K9M U;  2PVD B;  2ARU A;  2KSS A;  1GGM A;  4M7D E;  2QHS A;  2AMC A;  3JCM X;  3EAE A;  3RKY A;  3PGG A;  2RA2 A;  1WU7 A;  4P5N A;  4YCW A;  4FSX A;  3HSB A;  2CJB A;  3ASK A;  5LJ3 j;  4QVC A;  2RD1 A;  3SFM A;  2L5Q A;  5I21 A;  1IL2 A;  2XU8 A;  4N0A A;  2ZZE A;  3OYE A;  2RHS A;  3WQZ A;  1OZ3 A;  1BBU A;  1N9S A;  1FX7 A;  1N8R U;  4CRI A;  1LOJ A;  3JCM W;  3CC4 A;  4O5V A;  4ZTU B;  1VQ7 A;  2QHT A;  2JUF A;  2L89 A;  5GMK i;  2WSC E;  2K3X A;  1Z7M A;  1NPP A;  3HFO A;  4YRO A;  2ZPB B;  2C7I A;  4P74 A;  4J5Y A;  4RCC A;  2AKW B;  2LQK A;  1M1K C;  1EFW A;  1KMN A;  2E64 A;  3ZFJ A;  4UP8 A;  3JCM P;  3UGT A;  3HXV A;  5KE2 A;  5LJ5 d;  2M0O A;  1OYX A;  1KQS S;  2QEX T;  3TEE A;  2ZPH B;  4G85 A;  3MP6 A;  2K5F A;  4BWA A;  3PFS A;  3L2Q A;  4II1 A;  5FU6 C;  4JS4 A;  4C8Q G;  2ODR C;  5GAN 6;  3EFS A;  5GMK e;  4C0D C;  2XIC A;  4XEO A;  2QEX A;  3LGF A;  4Y91 A;  1I4K 1;  5GMK h;  2CKK A;  3OYN A;  4OP0 A;  3LSS A;  4XTV A;  5FRN A;  4BW9 A;  5D6W A;  4C92 D;  2P0L A;  4ZN1 A;  4HT9 A;  3OS0 A;  3NTH A;  3NET A;  3CEY A;  4NL3 A;  3MF2 A;  2DK3 A;  4M78 F;  5KCO A;  2X4X A;  4EMG A;  3HRT A;  3JSC A;  4C5I A;  3UGQ A;  1NJ6 A;  4A4H A;  4JLG A;  4BE1 A;  1P92 A;  4RCB A;  2GCX A;  2VC8 A;  3QHS A;  4UPA A;  3MEW A;  1X54 A;  2HQE A;  5LJ5 h;  4M75 E;  4KQE A;  3ER0 A;  5F5W A;  2LNV A;  1U1T A;  3P8D A;  2OTL A;  1KMM A;  2GF7 A;  4Q5W A;  4D6W A;  3HRI A;  2RI2 A;  3TEG A;  5ELN A;  4C92 G;  3S3M A;  2QI2 A;  1ZBX A;  3PCO B;  4X34 A;  2WSE E;  5L8R E;  4O2D A;  2K5I A;  1BBW A;  3RUX A;  1E24 A;  2ALY A;  4C5G A;  3QZ9 B;  3UT1 A;  2EQM A;  2ZXF A;  2J3M A;  4C8Q D;  2OTJ A;  4C8Q C;  2RHS B;  3CCS A;  1SER A;  4LVJ A;  1EVK A;  1Q86 U;  5GAO p;  1ADY A;  3RKW A;  1G5I A;  2NS6 A;  3A8H B;  4P3N A;  4YRP A;  3GPL A;  5CR2 A;  1XOV A;  4K86 A;  2LT1 A;  4N4I A;  2PVG B;  3L4G B;  4NS5 A;  2RJF A;  4DOV A;  2EJ9 A;  4HWR A;  4M75 A;  1N9W A;  1QF6 A;  5J3B A;  4M7D A;  3RES A;  3MEU A;  2ZCF B;  4KUD K;  3VYG A;  2ZIO A;  4FM4 B;  3OYK A;  3PNW C;  1C0A A;  1VQP T;  4M75 B;  3HFV A;  2QDY B;  3VJP A;  2ODR D;  3QO5 A;  3DLM A;  1OI1 A;  3N5B B;  2IVW A;  2VYT A;  2X4W A;  4O6J A;  5C51 B;  4BY6 C;  4PJO B;  3S6W A;  1BI2 A;  1QVG A;  4YRL A;  5DY9 A;  4EX5 A;  3V7C A;  3RER A;  4N4G A;  1KHI A;  3X26 B;  2EFI A;  2FYK A;  3OYG A;  3CMQ A;  4C92 C;  2I4O A;  3CMA A;  4EMH A;  5HKC A;  4TTV A;  2GFA A;  1NPR A;  2DQ3 A;  1VQZ A;  2YHT A;  3V7S A;  3PZC A;  4H2V A;  4NCX A;  3P8V A;  5CQX A;  5GAN 3;  3OYD A;  1GXI E;  2I4N A;  2YRV A;  2QQS A;  2DZC A;  4F7U B;  4E51 A;  4BAC A;  4H2W A;  3FIF A;  4BE2 A;  3MEA A;  2FB7 A;  1K73 C;  2KMT A;  3CBP A;  1JBM A;  2YLB A;  4H2S A;  2DXU A;  4Q15 A;  2DXC A;  2DAQ A;  3H6Z A;  2BIV A;  1DJ7 B;  4E7L A;  1VQ5 T;  3JAM E;  4QW2 A;  3OMC A;  4E7H A;  3T9N A;  1Y96 B;  3OS2 A;  2X35 A;  3FC3 A;  1XQH A;  3QBY A;  3I56 A;  2R5M A;  1VQL A;  4M78 A;  5C6S A;  2YLC A;  4OGE A;  1NYQ A;  1YI2 A;  1EIY A;  1YJW A;  5LL6 S;  5IT9 E;  3PIO A;  2RK1 A;  3CCS T;  2LC4 A;  1M5Q 1;  3VQX A;  3QKJ A;  5LJ3 d;  3L42 A;  2PUK B;  1UGP B;  1VQ7 T;  2CIM A;  3QYH B;  4H2T A;  4HT4 A;  3LSQ A;  4EO4 A;  1AHJ B;  1K8A C;  1NYR A;  3BDU A;  3P8B B;  3ZBD A;  1VQ4 T;  3J80 E;  2V8K A;  2L3R A;  3CXC A;  3UWN A;  3M4Q A;  5GMK l;  2CZ0 B;  5A0G A;  2ZT5 A;  1YB3 A;  4TVA B;  3S3O A;  2ART A;  4JRP A;  3TRE A;  1EIY B;  4P75 C;  4KBM B;  2EQK A;  4FL6 A;  1K8A U;  3HRK A;  4M78 B;  3HFZ B;  3HFZ A;  2CZ1 B;  5LJ3 h;  1BIB A;  2OTL T;  3L2Z A;  1KG1 A;  3VYH B;  4M7D D;  2ZZG A;  4C0F A;  2O01 E;  4E7J A;  3FLG A;  2LT4 A;  3RAC A;  3Q1J A;  2EYQ A;  4OLF A;  4LVL A;  3G6E T;  3QZ5 B;  2KY9 A;  3OYJ A;  3GNF B;  3HY1 A;  3HFN A;  1H4V B;  3QO3 A;  3MEY A;  5GAN 2;  4C0G A;  4WJ4 A;  1XTD A;  4M7A A;  4YRF A;  1MGQ A;  1WGS A;  5HGQ A;  1O9S A;  4M77 B;  5GAN g;  1HC7 A;  2ARS A;  2QQ9 A;  1NE8 A;  2DDZ A;  3C95 A;  2K4Y A;  1G3W A;  3CC7 T;  1VIF A;  2Q5I A;  3C4S A;  4YRM A;  4EMK C;  3HTZ A;  1M9S A;  1M90 C;  2AKW A;  2EIF A;  2QQA A;  1TH7 A;  3CC2 T;  4XTY A;  3KBG A;  4M7D G;  2LCL A;  3HY0 A;  1WJR A;  3I55 A;  2NLU A;  1BIA A;  2XKO C;  2M1H A;  1RL2 A;  4M77 E;  1VQN T;  4ZGE B;  2ZZD A;  2FL7 A;  3OW2 A;  4YRE A;  2DZ9 A;  2E65 A;  3IAL A;  2E41 A;  5J26 A;  4Q6G A;  3A8G B;  2DXB A;  1VQ6 T;  3A7R A;  3CCJ T;  1FYF A;  3MO8 A;  1USY C;  4E7K A;  1W2B A;  3GIB A;  2LVM A;  3P8T A;  4CS4 A;  3CPW S;  5GAN 8;  5ELO A;  1UEB A;  4P73 C;  3QO7 A;  3MHX A;  3VQV A;  3RMS A;  2LX9 A;  4YRS A;  4C0D B;  3L4G A;  3QXE B;  2A3L A;  3LH0 A;  1VQK T;  3QJ6 A;  4H2U A;  3HP9 A;  4LVI A;  3BW1 A;  3HKS A;  1N9R A;  2GFU A;  4R56 A;  4P3P A;  3JB9 G;  4MZP A;  3IKM B;  4PJO D;  2QQB A;  2E3C A;  4BE0 A;  2B8A A;  4J83 A;  1BI3 A;  5CKH A;  3A8O B;  4PJO A;  2QA4 T;  3NFC A;  3CC7 A;  4P72 A;  4YRT A;  4HCZ A;  3HRS A;  3WVE B;  3QSU A;  3SWN A;  3TEH B;  3X28 B;  3QO8 A;  2D0Q B;  2E5Q A;  1H4Q A;  4J6W A;  3PCO A;  4J6Y A;  4VUB A;  4XAX B;  4M7A G;  4DQ2 A;  4LD9 K;  4YRJ A;  4CH4 A;  2V8J A;  1S72 A;  3A7U A;  2ALY B;  1QP2 A;  2LTO A;  2G3R A;  2F69 A;  3JB9 D;  1HXD A;  4LVM A;  4LD6 A;  2IY5 A;  2EKO A;  4JUV A;  1USY A;  2E6N A;  2DTH A;  4F7U F;  3UH0 A;  5CKE A;  5I2M A;  1L0W A;  2VUB A;  3VU3 C;  2CJ9 A;  4YRQ A;  4J6X A;  3CD6 T;  4C92 E;  2JVV A;  3CCM T;  3BDL A;  1VQ5 A;  2IG0 A;  4J7I A;  1YFS A;  3A74 A;  2AMC B;  3X24 B;  3G71 A;  3OB9 A;  3HRU A;  4RQF A;  4H2X B;  1PSF A;  1RIQ A;  2I4L A;  2EL9 A;  4KUI A;  2RB6 A;  5DLO A;  3X20 B;  2ZZF A;  3L2V A;  5GAN 5;  4P74 C;  4OF1 A;  3NEL A;  3JCM d;  3MF1 A;  2RM4 A;  1H64 1;  5CKF A;  3CCL T;  4HKE A;  3M4P A;  4A4E A;  1VQL T;  2RHQ B;  1VQ6 A;  3E9F A;  3M59 A;  4E47 A;  3E9I A;  2MAM A;  3URG A;  2RJD A;  3V8J A;  2ZT7 A;  3C12 A;  5FU7 B;  3VQY A;  3I56 T;  3JCM c;  4C8Q E;  1I5L A;  1ZQ1 A;  2O4X B;  2P0Q A;  3NTK A;  1WJQ A;  2ZCE A;  3QTC A;  3R6O A;  4PL6 A;  2PME A;  3L1A A;  4TVW A;  1KC8 U;  5CO7 A;  3OYY A;  5C53 B;  1NNH A;  1IZ6 A;  1Y07 A;  3QNE A;  3SD4 A;  4HCB A;  4OVA A;  3M5A A;  2HNI A;  1G3T A;  1N27 A;  3X25 B;  1X56 A;  2X4Y A;  4NOY A;  4MDW A;  1NJI C;  4H2X A;  1EVL A;  2DJZ A;  3JRZ A;  4M75 C;  3V8K A;  1Z7N A;  2FHD A;  3HXX A;  2VV5 A;  3CCL A;  2DD5 A;  4CI0 C;  4P73 A;  3CMA T;  1B7Y B;  3G1Z A;  4P3O A;  3PMT A;  2DXT A;  2LQ8 A;  1J5W A;  3OYF A;  3M55 A;  4RG8 A;  4PLL A;  3E19 A;  3M4G A;  2HAX A;  3REX A;  1QVF A;  4E7I A;  3SB2 A;  4EMK B;  3W3S A;  4M78 C;  4H2Y A;  1VQ4 A;  5D6Y A;  1R8O B;  5LJ5 e;  1YHQ A;  2DU5 A;  4C8Q A;  3WVD B;  4XU2 A;  2ZTG A;  4OB3 B;  4J8O A;  4UP7 A;  3LYI A;  5KCH A;  2E70 A;  4XTX A;  3H8Z A;  3C94 A;  1Q82 U;  2DQ0 A;  3VKI A;  3NEM A;  4F7U A;  4MZT A;  3G4S T;  2DPP B;  4RQE A;  3HXZ A;  2Y90 A;  1KOG A;  1VQO T;  2JOY A;  3JCM V;  2XDD A;  4XTZ A;  4EMK A;  2R57 A;  3VQW A;  4IUV A;  4TQD A;  2DIQ A;  2DU7 A;  2OTJ T;  3E1S A;  3RKX A;  5FRM A;  1I8F A;  3R07 A;  4Y28 E;  1B76 A;  4P71 A;  1X75 C;  1X55 A;  2ZGW A;  2RHQ A;  2JNG A;  3OBY A;  4M75 G;  3G4S A;  3LC0 A;  4HVC A;  2DD4 A;  5GMK j;  4C92 A;  3OS5 A;  4DA4 A;  3TU4 K;  2XK0 A;  3JCM h;  1V29 B;  4LDW A;  2OAU A;  1YHQ T;  3QJY A;  1NJI U;  2RI5 A;  5HY6 A;  3OMG A;  1JJC A;  1UGQ B;  4XU1 A;  4WI1 A;  4RMF A;  3HL8 A;  4A4K A;  5DLQ E;  1YJN T;  4L87 A;  2VGM A;  1E1T A;  1B70 A;  2LRQ A;  4M7A D;  4M7D C;  2E10 A;  3A5Z A;  1JJ2 A;  2QTX A;  4JLI A;  2KDS A;  3KXT A;  1M1K U;  3FB9 A;  5LJ3 e;  1YIT A;  1D3B A;  4M77 C;  2JZ2 A;  3CCE T;  3FDR A;  4KR2 A;  5GAN 7;  2QQR A;  5GAN f;  1WNL A;  1N6A A;  2Q7H A;  2CZ6 B;  4FIB A;  1NJ5 A;  1Y7X A;  2LDM A;  1MHN A;  5M9O A;  1KQ1 A;  1BI0 A;  3JB9 H;  2JN0 A;  4IUR A;  3RIR A;  4HT8 A;  2XHC A;  3QYG B;  4QQ6 A;  4RDX A;  3OYM A;  3CCQ A;  1YFR A;  3DSQ A;  3P8H A;  3A5Z B;  3O8V A;  5GMK m;  1B70 B;  5CK9 A;  3I55 T;  4HWT A;  1W66 A;  4YRR A;  4GY5 A;  1BI1 A;  4QQG A;  2E12 A;  4YCV A;  1H4S A;  1BKB A;  3QG1 A;  2IY5 B;  4IKF A;  3ERR A;  1KHC A;  1ATI A;  4DOW A;  1WYD A;  4BI8 B;  1K9M C;  1PYS A;  1M1F A;  5CIU A;  1SET A;  4BDY A;  4QQD A;  4WF2 A;  1KC8 C;  4UP9 A;  4FU6 A;  1ASY A;  1M1G A;  5GAM h;  3VUZ A;  4HWS A;  3E9G A;  1W4S A;  3OD1 A;  2J3L A;  4QVD A;  2QA4 A;  1XNI A;  1VQM A;  5IAY A;  4ELY C;  5HK3 A;  2CJA A;  3DB4 A;  5LJ5 j;  4C0Z A;  3OYC A;  4A53 A;  3PIP A;  2F5K A;  3CME T;  4C92 B;  4LDY A;  3LW5 E;  2VGN A;  3IKL A;  2K3Y A;  1QVG S;  4MMK A;  4WJ3 M;  3OYI A;  1U8R A;  4ZGD B;  1M8V A;  3A8L B;  2M16 A;  4JRQ A;  5GAO m;  4YRG A;  4LDU A;  1JRI A;  4YDQ A;  4FT4 A;  1VQ9 T;  3ICA A;  3JCM J;  4PHC A;  4M77 F;  4M7A C;  4PJO C;  4M78 E;  1K73 U;  4F7U G;  3VUB A;  4M7D F;  4IUQ A;  3QPH A;  5GAN h;  1Q82 C;  4XQ3 A;  1X2H A;  2XID A;  4P75 A;  3CPF A;  2EJG A;  1M90 U;  2R58 A;  3M56 A;  3OW2 S;  2QXF A;  2P0P A;  4C5H A;  3REU A;  2K5L A;  4ZN3 A;  2VXE A;  3A5Y A;  5GAM e;  3JCM g;  4MML A;  2PMF A;  3CC2 A;  1LJO A;  1OZ2 A;  4PLI A;  1G51 A;  3JCM b;  2CGH A;  1NJ1 A;  2ZT8 A;  4C8Q B;  1H4T A;  4BY6 B;  3LWI A;  5LJ5 f;  3RL6 A;  1NJ8 A;  5LJ3 g;  3FEO A;  3JCM f;  4R55 A;  3PT9 A;  4KR3 A;  5DM7 R;  4G84 A;  4MDX A;  1Y96 A;  2RJC A;  5HK0 A;  4UC4 A;  4BI4 A;  1YCY A;  3WXM B;  5FU7 C;  4XEM A;  2M9U A;  1E1O A;  4HA8 A;  4M78 D;  2KVQ G;  4PJO F;  2MI6 A;  1YJ9 A;  2MWP A;  4YPF A;  4KT0 E;  2DIG A;  3CCJ A;  4YRK A;  2DO3 A;  2DTI A;  3CPW A;  4ZGJ B;  4B9X A;  1YIT T;  1W2B S;  4L5G A;  4RMO A;  4KUL A;  5GAN d;  2DVE A;  5GAO q;  4X5O A;  4HWP A;  2A8E A;  1Q7Y C;  3G6E A;  3QUI A;  2HQX A;  1VUB A;  3TCJ A;  1G3Y A;  3HXU A;  3LX7 A;  2EQU A;  4ELZ C;  2Q7E A;  1YGB A;  4LNS A;  1QVF S;  2XI9 A;  3PTA A;  1PSE A;  4M78 G;  4A54 A;  2ZPG B;  4P72 C;  4AH6 A;  2O4X A;  1LYL A;  1EIF A;  4OGC A;  2I4M A;  4ATO A;  2XD0 A;  3GF5 A;  2QHV A;  2K2V A;  2ZPF B;  5GAM j;  3G7Z A;  3JB9 F;  2X4J A;  1LNX A;  1UGS B;  5CAI A;  4TVA A;  1Q81 C;  2P5I A;  2ZNJ A;  1VQP A;  4M77 A;  4X9D A;  1G5V A;  2P0K A;  5FRO A;  2EQJ A;  4OB0 B;  4XTU A;  4M7A B;  4RKU E;  1WLE A;  3M58 A;  5FU6 B;  1B34 A;  5CQY A;  2Q5H A;  3KFU A;  1VQ9 A;  5I2S A;  2EAY A;  1YJW T;  2R5A A;  4XU3 A;  4M7A E;  2A7Y A;  1QP3 A;  4EDU A;  2CYZ B;  1Q81 U;  4CH5 A;  2RI3 A;  3M9Q A;  12AS A;  1G3S A;  3TUP A;  5GAM d;  2LCC A;  4XU0 A;  3CME A;  3JCM Q;  4J15 A;  5LJ3 f;  3MQZ A;  3UPU A;  1X2G A;  2BKD N;  4C8Q F;  3GLX A;  3OYH A;  3RMQ A;  1VQK A;  2E6Z A;  1HK9 A;  4YRN A;  3CXC S;  4JJN K;  2C8M A;  4N0A C;  2ZIM A;  1KD1 C;  3OYA A;  4PJO G;  3GOX A;  4HWO A;  3OYB A;  3DB3 A;  4B9W A;  2MWO A;  2XG8 D;  3M4Y A;  2KQW A;  3M53 A;  2PQW A;  4PJO E;  4PNO A;  1E22 A;  1YFT A;  3LWH A;  2KK4 A;  1X6O A;  3FRN A;  1M4Z A;  4BD3 A;  2PVO B;  4CH6 A;  3A31 A;  2CS7 A;  3SWN C;  3CCE A;  5C52 B;  3VV0 A;  4ME7 A;  4TVR A;  4NL2 A;  4FT2 A;  4M75 F;  5GAO l;  1YI2 T;  4YYE A;  3SWN B;  3NTI A;  3TEH A;  1SSF A;  3V7R A;  4K87 A;  2WSF E;  3UDC A;  1B34 B;  1YJN A;  3MEV A;  3RF1 A;  1O75 A;  4GLK A;  3M54 A;  1ASZ A;  1WJS A;  1VQ8 T;  2XDP A;  1UGR B;  4M77 G;  5CKD A;  1KD1 U;  1SRY A;  3VBB A;  3AHU A;  2XDB A;  5CKB A;  4C92 F;  3CCU T;  5D6X A;  4IUU A;  3CCU A;  5GAM g;  2RO0 A;  3CCQ T;  1UB4 A;  5CVI A;  1N8R C;  4J7F A;  4BI3 A;  2V8I A;  4BB7 A;  1YIJ A;  3RGL A;  1WQW A;  3OQ5 A;  3QII A;  3I7F A;  4YP0 A;  3HHT B;  1G5H A;  3IG2 A;  4M7D B;  1Q7Y U;  2F5T X;  1FXX A;  2BUD A;  5AYF A;  2VXF A;  3CCR A;  2D6F A;  3OSV A;  2ZNI A;  3L2R A;  2MMP A;  5KE3 A;  5GAM f;  4TWA A;  5FLX E;  2EJF A;  1EQR A;  1H3Z A;  1JJ2 S;  5K1X A;  2C06 A;  1NJ2 A;  3A8M B;  2D9T A;  3E9H A;  4CS2 A;  4K88 A;  4M77 D;  1EOV A;  5EG2 A;  4YCU A;  4RG2 A;  5E3I A;  2RHU A;  4N4H A;  3CC4 T;  4LDV A;  4ZIB A;  2H3J A;  2HBP A;  4PKC C;  3P8Y A;  3L2W A;  2G4C A;  3ME9 A;  2EWN A;  3OS1 A;  5LJ5 g;  2ZPE B;  3EFR A;  3L2U A;  2JTF A;  4L6V 5;  2E5A A;  2PUO B;  4IUP A;  4BDZ A;  3CBM A;  4HCC A;  5J39 A;  3BFM A;  2DKG A;  5A0L A;  3UFG A;  3FJP A;  3GP8 A;  5C0M A;  2DTO A;  3MCA B;  3OYL A;  4P71 C;  2HD0 A;  3DKM A;  3CCR T;  4OMF B;  1B7Y A;  1HTT A;  4C5E A;  1KQ2 A;  2DEQ A;  1SES A;  4TQF A;  1RI0 A;  1Y71 A;  4LVK A;  3BJU A;  4CS3 A;  1VQO A;  2RK2 A;  3F70 A;  2Q7G A;  4A4F A;  3OBW A;  2L8D A;  1X01 A;  2ZT6 A;  3A32 A;  1QE0 A;  4H02 A;  3ZEH A;  1ZHI A;  2PU9 B;  5CCA A;  1YJ9 T;  4YRI A;  4A4G A;  3QDR B;  3BY7 A;  4X9C A;  1YIJ T;  5GAN j;  2RHX A;  3INZ A;  1I81 A;  2GQV A;  3J7A F;  11AS A;  1Q86 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...