2FYKA

Crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with adp and biotin
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
235
structure length
235
Chain Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGLWLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGKGDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILNLVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords biotin--protein ligase
publication title Ligand Structures Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3
rcsb
source organism Pyrococcus horikoshii
total genus 68
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2fykA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 2fykA01
3UH0A 4M75E 3TEHA 3VBBA 4TQDA 1WLEA 4N0AA 5E3IA 1IL2A 3BFMA 4M78D 1B70B 2ARTA 2E65A 3V7SA 1MGQA 3I7FA 3L2ZA 5GAN5 1L0WA 4EO4A 2HNIA 2DEQA 3NELA 5GANd 2ZZFA 4EMHA 4M7DA 4M7AE 2XTIA 1U1SA 4C92C 5GAOq 4AH6A 1LYLA 5GANh 1JJCA 3GIBA 4P3NA 5GMKe 4YRJA 5GMKj 3W3SA 4P73C 5GAOn 4UP9A 4M75A 5K1XA 3L1AA 1B7YB 3A7RA 4M77A 2I4NA 1WYDA 3M4PA 4BW9A 4XTVA 1C0AA 4CS4A 3V8JA 2P0LA 1NYQA 4M75D 1HC7A 5HGQA 3MF1A 3E9IA 5LJ5e 5GMKl 4J6YA 3SWNC 3FIFA 4RQFA 3E9HA 3A32A 4HVCA 4H2UA 5GAMf 3QO3A 4EMKC 5C52B 2DVEA 4P72A 1EVLA 4M7AD 4C8QF 2ALYA 4UPAA 3JCMP 4HWPA 4YRMA 4QVCA 5LJ3f 2FYKA 2ZT7A 2G4CA 4WI1A 4YRQA 1YFSA 3REUA 2VXFA 2VC8A 3HSBA 4A54A 4KR2A 4XU3A 4E51A 4M78B 1B70A 3AHUA 3JB9H 4CS3A 2I4LA 2AMCB 3TUPA 5C51B 2DTOA 3JCMW 1B76A 5F5WA 4QVDA 3QO7A 1H4QA 3HFVA 4H2XB 5KNNA 4YRKA 2RB6A 3JCMV 5GANf 2J3LA 4C92G 4JRKA 3A5ZA 4ZIBA 4YRSA 3REXA 4M7DF 4MMKA 5GAMj 4F7UG 3JCMe 1X2GA 2P5IA 2YLBA 1B7YA 3UGQA 3HRIA 4RCBA 1GGMA 3RACA 4RMFA 1EFWA 2CJBA 3V7CA 2EAYA 3IKMB 2ZT8A 1WQWA 2DZCA 2RHSB 5LJ3e 4H2SA 2JN0A 4M77F 3A7AA 3RL6A 2QHSA 4P75A 3LSQA 4CS2A 4WF2A 3HXUA 1H4TA 1NJ8A 5GAMg 4C8QC 1JRIA 2ODRD 3MF2A 3FJPA 4C92B 3UGTA 3HTZA 3G1ZA 4YRGA 5GAOm 1Z7NA 3WQZA 2ZZEA 1SESA 5LJ3g 1USYC 3CMQA 4YROA 3R07A 4OLFA 1EIYB 4EMGA 3JB9F 1NJ5A 4NCXA 4ZTUB 2DQ3A 3NETA 3INZA 2K57A 5GANe 4YCVA 5GANj 1JBMA 4M78A 2ZNIA 1H4VB 4YRIA 4Q15A 3PZCA 3SWNB 4N0AC 1B34A 1HK9A 1ADYA 1ATIA 3EFSA 4YRCA 4TTVA 1D3BB 4JLIA 4NL3A 3BJUA 4H2YA 4EX5A 2Q7GA 4H2XA 2DDZA 4YCWA 5GANg 2E10A 1E1TA 3MEYA 2YHTA 4M7DC 1B8AA 4P74A 3PCOB 4C92E 4HWSA 3HY0A 4X5OA 12ASA 5GAN2 5GAN4 1SETA 4XTZA 4F7UE 3HXVA 3HXWA 2RD1A 4RQEA 4Y91A 4M77C 5DY9A 1E1OA 3BW1A 2RHSA 4HWOA 2AKWB 1U1TA 2EJ9A 4LNSA 1X55A 1N9SA 3L4GB 3RKYA 4NOYA 4XU0A 2CGHA 3HXZA 2XGTA 4CH6A 4M7AA 4C8QG 2ZNJA 4G84A 4XU2A 4BWAA 3NENA 2QHVA 3QHSA 1KMMA 3ICAA 4P73A 4C92D 1BBWA 1NJ6A 4V2SA 1LOJA 4YRLA 3A31A 5GMKm 2EWNA 2DU5A 2PMEA 2E64A 1KOGA 2I4OA 2E41A 3HFZB 1HXDA 4PJOF 3QUIA 2ZTGA 4HT8A 4CH3A 3SWNA 2J3MA 2ZR2A 4O2DA 4M78F 4WJ3M 1D3BA 1HTTA 3A5YA 4TVAB 2ZT5A 2ZGWA 4HA8A 3QO5A 4J5YA 3HXYA 2IY5B 4H2WA 2Q5HA 3VU3C 3PCOA 2YLCA 4K87A 4M7DG 2DXTA 3A74A 4P3PA 1KQ2A 5GAMe 1YGBA 2I2LA 5LJ5h 2EL9A 4YRRA 1TH7A 2QTXA 2DTIA 2E3CA 4PG3A 3BDUA 4M77G 2DKGA 2DTHA 1M5Q1 2ARSA 3VQVA 3NEMA 4M75F 3VQWA 3L4GA 1X2HA 1WPYA 3P8VA 1NJ2A 4YP0A 2E5AA 4H2TA 1YCYA 4YRPA 2C7IA 4YRFA 2RHQB 1FYFA 4C8QE 5I21A 4G85A 1H4SA 1PYSB 3JCMc 1EOVA 1QF6A 4X9CA 4J6WA 4YREA 2EJGA 4M7AF 3JB9G 1YB3A 4F7UB 1ASZA 4PJOC 3HFOA 3HFZA 4P3OA 4M77B 2Q7HA 3BY7A 1I4K1 2VXEA 4PHCA 3RKXA 4M78C 4JUVA 1EQRA 3EFRA 1G51A 4TVAA 1QE0A 2AMCA 3JCMd 2ZXFA 1NJ1A 2Y90A 4PNOA 2IY5A 1KQ1A 3JCMh 5C53B 4DQ2A 4C8QD 4TVWA 4EMKB 2RA2A 1G5IA 1YFTA 1N9RA 4OP0A 3A7UA 1BBUA 4M7DE 2QHUA 4ZTZB 3JCMb 2E1HA 2CJ9A 5LJ3h 3IG2A 4P71A 3QTCA 5LJ5f 2ZIOA 5GAOp 4XTWA 4RDXA 3LSSA 3LC0A 4M77E 3V7RA 3JCMX 4M75C 4H02A 3P8TA 5GAN6 1E22A 1ASYA 2PMFA 3RIRA 4X9DA 2I4MA 1SRYA 4NL2A 1I8FA 1Z7MA 2RHQA 1VQZA 4DPGA 2DU7A 5ELOA 4Q6GA 4XEOA 2CIMA 4YRTA 1ADJA 2ZIMA 4XTXA 1PYSA 4M7AC 3ERRA 3IALA 2DXUA 4YCUA 4C92A 2EJFA 3RF1A 4H2VA 4MMLA 1WQ7A 3P8YA 4M7DD 4F7UA 4UP8A 4P72C 3IKLA 2ZCEA 4YRNA 1NYRA 4CH4A 1EIYA 3QNEA 4PJOG 1WNLA 4A53A 1BIBA 1NNHA 3UFGA 1I5LA 5ELNA 4UP7A 1Y96B 4M77D 1WU7A 3RKWA 1J5WA 5K1PA 3KFUA 4M78G 3DSQA 5LJ5j 4XTUA 3QSUA 3V8KA 3TEGA 1SERA 3M4GA 4XTYA 2C8MA 3HFNA 3JCMf 3RUXA 4C8QB 4TVYA 2Q7EA 4EMKA 5GMKh 4HT9A 3JCMJ 4K86A 1KMNA 3RGLA 3VQYA 1RIQA 4WJ4A 3JB9D 5LJ5g 4PJOB 1X01A 2ARUA 5LJ5d 3JCMQ 1LJOA 1X56A 2Q5IA 4HWTA 4XEMA 3VQXA 1G5HA 1N9WA 1I81A 4M75G 4YPFA 3TEHB 2AKWA 3RERA 1B34B 4TWAA 3RESA 3HXXA 1YFRA 4J6XA 2ODRC 2DQ0A 4YDQA 4P75C 2DZ9A 3FB9A 3V8LA 5CAIA 4M7AG 2ZR3A 3PGGA 1EVKA 1W66A 2DJZA 4M7DB 2FB7A 4KR3A 4HWRA 4JRIA 4K88A 2RM4A 11ASA 5GAOr 1JJCB 3HRKA 1M8VA 4J15A 4C92F 2CJAA 3JB9I 4CH5A 4KQEA 4PJOE 1Y96A 4F7UF 4M75B 4XU1A 2QHTA 3SB2A 5LJ3j 3OD1A 1LNXA 5GAOl 4YYEA 4M78E 3M4QA 3QO8A 3JB9J 5GAMd 3JCMg 4C8QA 5GAN8 4M7AB 5GAMh 5GMKi 5GAN3 1BIAA 2ALYB 5LJ3d 4PJOA 1USYA 2ZZGA 1X54A 4P74C 4XQ3A 1E24A 5GAN7 4P71C 1H641 2ZT6A 2ZINA 4PJOD 4RCCA 4L87A 4TQFA 3HY1A
chains in the Genus database with same CATH superfamily
3VBBA 2GBQA 1WLEA 4N0AA 2O31A 2JXBA 1KQSA 3MKDA 2ARTA 4GY5A 1YJ9T 2ROLA 2K3XA 2VB6A 1KSWA 4GLMA 2F2XA 3CBOA 2AZSA 2NYSA 1MGQA 1PHTA 2DEQA 2KRNA 3META 2MF2A 4A4KA 3VS6A 5GANh 1YBYA 1JJCA 3S6WA 3GIBA 3H6ZA 1UGRB 4P73C 5GAOn 4M75A 2QI2A 4LDWA 3A7RA 4LE9A 3CPWS 2ED1A 1NYQA 5HGQA 3MF1A 3GF5A 5FU7C 2MYSA 3E9IA 1X6OA 5FRNA 4J6YA 4RQFA 4CC7A 3OSVA 3E9HA 3EH1A 3CCMT 1EIFA 2F2WA 3QO3A 3C95A 4EMKC 2EBPA 4FSSA 1EVLA 1M2OA 3M58A 3GP8A 1VQ6A 2O9VA 3CCJT 4C0DB 4UPAA 4HWPA 4YRMA 2AHJB 4PKCC 2M16A 4QVCA 4J9GA 5LJ3f 2G4CA 2K3BA 1OX9A 2VC8A 2LNVA 2QDLA 2P0QA 4XU3A 1YJNT 4A4EA 2DA9A 2BE9B 4M78B 4Z89A 2RHIA 4KH1B 2I4LA 2AMCB 3JCMW 3CQTA 4BI4A 2SEMA 1RUWA 3M54A 4QVDA 1H4QA 2PVGB 4JJCA 3NTKA 2RB6A 3CCJQ 3JCMV 1I07A 2KYMA 4JRKA 1QCFA 4OMNA 1DJ7B 2ZPEB 3M0QA 1VQ8A 3OQ5A 4F7UG 2OI3A 1B7YA 4JRPA 3HRIA 4RCBA 2C0IA 1GGMA 3RACA 2CS7A 3V7CA 2CT4A 3IKMB 2ZT8A 1NE8A 2DZCA 4H2SA 3M0UA 2JN0A 1W4SA 2MIOA 2M1HA 3HXUA 1UFFA 1YWPA 5HY6A 1W2BP 3MEVA 4F04B 4D6WA 3FJPA 1M2VA 2EYXA 4A4HA 1ZSGA 4FSXA 3CCRA 3UATA 1VQ6Q 5LJ3g 1USYC 4YROA 2DL4A 3EG1A 4OLFA 4EPCA 1EIYB 4HCKA 3JB9F 2KGTA 3CPWP 4ZTUB 2DRMA 1W1FA 2K6DA 3INZA 3NETA 4J9HA 1UJYA 1JBMA 2J6FA 4FCYA 2ZNIA 2XI9A 4J83A 3RBBB 4N0AC 4PK4A 4BI3A 3EFSA 1GBRA 4TTVA 2KVQG 3M0SA 3OBWA 3BJUA 4H2YA 3MEWA 4H2XA 2DEUA 4VUBA 2DDZA 4N4GA 1K73C 1E1TA 2QEXA 4X5OA 12ASA 2EVRA 4LNPA 2D1XA 3VRZA 1GL5A 3TSZA 3E2UA 1VQ8Q 2KXCA 3HXWA 4LD9K 4FYXB 4AMCA 1E1OA 2DETA 4HWOA 2RPNA 4L6V5 2ED0A 4HT4A 1U1TA 2EJ9A 2DXCA 1K0XA 1GRIA 5A0LA 4RTZA 2ZNJA 1KC8R 1GFDA 4XU2A 1B7TA 2E5KA 2NUPA 1VQOT 1C0MA 1RAEB 2JMCA 2QAZA 4ESRA 1K9MU 1KMMA 2DERA 1M1KU 9ATCB 3I9QA 1IHVA 1ABQA 4YRLA 3CMEA 3EGDA 2E64A 1KOGA 2HQHA 1AWJA 2KYBA 3CC4A 1K8AC 2ZTGA 1VQ5Q 4CH3A 5CVIA 4Z8AA 5EC7A 4O2DA 3A5YA 2GTOA 3S3MA 1C6VX 4J5YA 3MP1A 2IY5B 4MZPA 3URGA 4K87A 2BZ8A 3I55A 2QEXQ 3UT1A 4IUQA 1K9MC 1X75C 3X26B 3TCJA 2FZKB 2I2LA 1WJSA 1M1KC 1Q86U 4CI0C 3MP8A 4M77G 3ZEHA 3NEMA 2B8AA 1VQ9T 4JZ4A 2E5AA 4BDZA 2C7IA 1BKBA 2E70A 4C8QE 4G85A 4HCCA 2LX7A 4LDXA 2M9UA 2YXYA 3EG9A 5IHKA 4BE1A 3LGLA 4J6WA 5I2MA 2X4XA 1VQMT 4F7UB 1VIEA 1ASZA 2I0NA 3HFOA 2VXEA 1Q86C 2COZA 1EQRA 4FT2A 1VQ9Q 1WJRA 2OTLA 4TVAA 1BU1A 4OGEA 1KG1A 4UC4A 1BI3A 2Y90A 4MZMA 1MMDA 2JVVA 2K5LA 4F17A 4C8QD 2KE9A 4M7DE 1SG5A 1QVGA 2CJ9A 2D0QB 2KSSA 3LWIA 2ROTA 2RQRA 2CSIA 4RTWA 2FG0A 1M3BA 5IHNA 1E22A 2L3SA 5FU6C 1I8FA 4LUDA 1QVFA 1TG0A 2A0FB 2DU7A 4XEOA 2HEQA 2YUQA 5I22A 2K5IA 2CIMA 4YRTA 2PVOB 4WTOB 1PYSA 4YCUA 1O75A 2DXUA 2IG0A 3HTRA 1Q82U 4C92A 3OYHA 2RQWA 4E7IA 1GFCA 4M7DD 3P8YA 4UP8A 4ZNXA 2MI6A 3IKLA 1X43A 2V1QA 3OYGA 2EKHA 4PJOG 1BIBA 2KRSA 4UP7A 1FYNA 2MWOA 1J5WA 2JMAA 1Y0MA 1YI2Q 4OMLA 1SERA 2DRKA 3M4GA 2AT1B 1V76A 5IH2A 2C8MA 3HFNA 1QWEA 3RUXA 4TVYA 1OPKA 2KNBB 1ACMB 3X24B 3JCMJ 1R8OB 1H8KA 2JM9A 2HL3A 2MMPA 3OYIA 1FMKA 1X56A 2RJFA 2Q5IA 4HWTA 3Q1JA 1N9WA 1NPRA 2GQVA 3QKJA 4OB2B 4JLGA 1QLYA 2E5QA 2W10A 2PZ1A 4AT1B 4JPBW 1N8RU 2AKWA 1UHCA 3RERA 4TWAA 2DE0X 2O01E 1OZ2A 3CC2A 4J6XA 3I56A 2DQ0A 1N6AA 3HPWA 2DZ9A 4Z02A 5AYFA 3LW5E 2ZR3A 1EVKA 2BE7D 2HZYA 2VVKA 4KUIA 3RMSA 4JRIA 1H3ZA 1WHMA 2LP5A 3EHQA 4C92F 1NJIU 4BDYA 3JB9I 2X3XD 2XMFA 4KQEA 3EGUA 4CH5A 4II1A 1Y96A 1YHQT 2PTKA 2QHTA 2NUTB 5A0GA 2HQXA 3OS2A 2FZCB 1ZSZA 3JAME 1KQSS 5IXFA 1BK2A 3FLGA 1VQ4A 5GAMd 1N8RC 2XKOC 2QQBA 1WXTA 3DLMA 2RHXA 3L2RA 1UGPB 1G3TA 1VUBA 3MP6A 2ALYB 4PJOA 2COYA 3G6EA 5KYWA 3GOXA 3A8OB 2YRCA 2BZYA 1WHKA 1H641 3M4YA 5CKEA 2YUOA 2ZINA 1NJIC 2JS2A 5KE3A 4JDSA 4TQFA 3UH0A 1YJWT 2DIGA 4HVUA 1YITA 3REBB 1B70B 1ZUKA 3JRZA 2OJ2A 1BI1A 3VRYA 4ZGDB 3V7SA 1IB8A 2M0YA 3CC2Q 3I7FA 4EO4A 3I56Q 3OMCA 3NELA 3OS0A 1BCMA 2XTIA 1U1SA 4C92C 5GAOq 1WHLA 1ZBXA 1AWXA 1IZ6A 1MMNA 1RAIB 5GMKe 4XAXB 4YRJA 1PCXA 5L8RE 3REAB 3QWYA 1Y57A 1NEBA 3VJPA 3L1AA 1OEBA 1VQNA 2I4NA 1XJWB 1YJWQ 2LC4A 3M4PA 4ZTJA 4BW9A 4XTVA 4AFSC 5KYYB 1HC7A 2SRCA 1G3WA 1D1CA 5GMKl 2CP6A 3SWNC 3A32A 1LPLA 1VQ4Q 1PC0A 3QJYA 4HVCA 4H2UA 5GAMf 3CCVT 5J26A 2RO0A 1MMGA 1NLPC 4FYYB 1KHCA 4P72A 2EYWA 1ZUYA 5CKDA 1OV3A 3G6EQ 1PKSA 4ORZA 1YFSA 3REUA 4IUUA 1GXIE 3H41A 2J6OA 2FEIA 4RTTA 1KQSP 2L5QA 4KR2A 2EIFA 4L59A 3VV0A 4E51A 1YITQ 4OMMA 4J7FA 3TUPA 2COWA 1GCQA 2Y4YA 4AFQC 1V29B 4QT7A 1SKUB 5IXBA 2J7IA 3HFVA 4GBQA 4ANJA 3EH2A 4MZTA 2HAXA 4LVLA 3QZ5B 2CUDA 4YRSA 2LX9A 3F70A 5GAMj 3TU4K 3PE0A 1VQNQ 2ZPBB 6AT1B 3J80E 3SD4A 4DEYA 2RHSB 1ZSZC 2BUDA 1IO6A 2G3RA 1I0CA 5DM7R 3A7AA 1ZA1B 1YJ9A 1WYXA 1PRMC 4BUGA 4CS2A 3E9FA 4WCIA 1NJ8A 5GAMg 1RAFB 4PFPA 1FXXA 1JRIA 3CC7T 2R57A 3NHNA 3G1ZA 4OB0B 3WQZA 1N5ZA 3FC3A 1JJ2A 2JOYA 4NCXA 2VASA 4AFZC 2FRYA 1SF9A 4M78A 3FRNA 5FU7B 2EQMA 2H3EB 4Q15A 3PZCA 1B34A 2EPDA 1UGSB 1JXMA 3CCMA 1OX8A 4JLIA 1AEYA 4JJBA 4YCWA 3LX7A 3T9NA 2ZPIB 2RH2A 5D7UA 3PCOB 4P74A 4HWSA 3CCJA 3ZFJA 2DNUA 2K2VA 3OSSC 3QJ6A 1SETA 1S72T 4XTZA 2LJ1A 5LL6S 2LQ8A 1Q7YR 2A37A 3HXVA 2RD1A 1VYVA 4Y91A 1P92A 1RI0A 4PLLA 2D0NA 2QTVA 1A0NB 3QZ9B 1MV3A 4R55A 1YJ9Q 4QQDA 1SEMA 3L4GB 3LH5A 4NOYA 4XU0A 4M7AA 3CXCA 4C8QG 5FWBA 1K0SA 4BWAA 1EFNA 1WHGA 1Z9ZA 3ICAA 1BBWA 2CT3A 1LOJA 3NFCA 4LDYA 3A31A 4FW1A 1E6HA 2VYTA 3C0CA 4O5VA 4J8OA 3M5AA 4J9IA 1QCNA 1K76A 3OYJA 1GCQC 4M78F 4WJ3M 1EZZB 1Q81R 1ZX6A 3CCMQ 3QO5A 3OBYA 4OMPA 2QYZA 4H2WA 5KE2A 3AT1B 3ZBDA 3VU3C 3OA6A 2CP7A 4M7DG 3CCLT 4YRRA 5GAMe 3SEMA 3FEOA 1T3SA 2JS0A 1TH7A 4PG3A 4D8KA 2DKGA 1RAAB 1YJNQ 2ARSA 4RMOA 3VQVA 2VWFA 4Y92A 3EFOB 1NG2A 4M75F 1X2HA 3H0IA 1YCYA 4F16A 3OYKA 3L2VA 4DOWA 5I21A 1UUEA 1K73U 2BZXA 1H4SA 1QVGS 1EOVA 3CCLQ 2RK2A 4M7AF 3PFSA 3LWHA 5CR2A 5ECAA 1VQKT 3WVEB 1KIKA 1YWOA 2DL5A 1I4K1 4QQ6A 1QWFA 2RQVA 4PHCA 4FYWB 3RKXA 2YWWA 4M78C 4JUVA 1VQ5A 4B9XA 1OQKA 4J9EA 4PJNA 4LDUA 3EFRA 1QVFS 2WSEE 3PMIA 3JCMd 3HP9A 1NJ1A 1FMWA 4PNOA 2L2PA 1KD1C 2IY5A 8ATCB 4DQ2A 1VQOA 2EFIA 4CC2A 1N9RA 4OP0A 2KT8A 2QHUA 4ZTZB 2HSEB 1VQKQ 2HSPA 3QG1A 3IG2A 2CZ6B 5LJ5f 1OU9A 4XTWA 1K8AU 2A08A 4H02A 4M75C 1LVKA 1AZGB 3OYEA 1OPLA 2EYYA 3GLXA 5GAN6 3OYMA 2PMFA 3H0HA 2QQAA 3QWXX 2I4MA 3G4ST 1Z7MA 4DPGA 3GPLA 2QXFA 2IIMA 2XDBA 1ADJA 4XTXA 2EW3A 4M7AC 2GNCA 3CCRT 3VKIA 1X6BA 3OYFA 4H2VA 1YP5A 4HVVA 4F7UA 2PUKB 2RI2A 4M4ZA 1YCSB 4YRNA 5HK0A 4CH4A 2G6FX 3QNEA 4A53A 1NNHA 5ELNA 2CREA 2EQJA 3L2QA 2X3WD 1SHFA 3G1JA 1NPPA 3GBQA 3PNWC 3KFUA 1YN8A 2V8JA 5LJ5j 3G4SQ 1VQ9A 2E12A 5CQXA 3QSUA 4FT4A 2J6KA 3OYCA 3BE3A 3JCMf 4C8QB 1W2BA 1M90R 3OYAA 2YRDA 1QVGP 4IIOA 5KH6A 4K86A 1VQOQ 3CCUT 5KYXB 1SHGA 1HSQA 1JXOA 2VKNA 2XK0A 3RGLA 3VQYA 2LDMA 3JB9D 5LJ5g 2ARUA 2FVUA 4J7IA 2HKQB 2DBKA 4Z88A 2RMOA 2IVWA 2LMJA 3VQXA 1G5HA 5CQYA 4OF1A 3CCST 2QDYB 3A98A 3TEHB 4F14A 3HXXA 2LCLA 2YUNA 1NYGA 2ODRC 4AG2C 4YDQA 3V8LA 3HKSA 2K3YA 1W66A 4M7DB 1QVPA 2C0TA 4K88A 2RM4A 5GAOr 3ME9A 1M8VA 1BBZA 1UECA 3PVQA 1UGQB 4F7UF 3A8MB 1UE9A 3THKA 5IN1A 5GAOl 2DPPB 3M4QA 3S3NA 2RI5A 5FU6B 1WIEA 1YI2A 2KAFA 1K9AA 3JCMg 1MV0B 1MUZA 3J7AF 3TSWA 5GAMh 2DJQA 2NUPB 3PVLA 3OW2A 4OMQA 3OS1A 2NUZA 2PUOB 3VYGA 2EQUA 2QGGA 1VQMQ 3E19A 3VS3A 1X54A 4D8DA 1E24A 5GAN7 3EGXB 2ATCB 2ZT6A 4RCCA 4R56A 3SFMA 2H3JA 2DLPA 3CMAT 4TQDA 3R6OA 3CCET 5E3IA 2LRQA 2E65A 4IKFA 2WSCE 4RKUE 3L2ZA 2FL7A 2A3LA 2L3PA 4PJLA 1GBQA 5FLXE 2L3QA 2ZZFA 1H92A 2O9SA 4CRIA 2EQIA 4BY6C 4AH6A 4C5IA 2X35A 1G83A 3OS5A 4P3NA 3A5ZB 1Y07A 2V26A 5GMKj 4C5GA 1UG1A 3NPFA 3CCQT 2Z0WA 5K1XA 4M77A 2NUTA 4BB7A 1TU0B 4CS4A 3V8JA 3CCEQ 2ZPGB 2YSQA 4DA4A 5J39A 2X9HA 2CP3A 2ZPHB 5LJ5e 2D6FA 3GNGA 3FIFA 1HJDA 4PL6A 1UB4A 1UGVA 2HCKA 2CZ7B 1W6XA 3PIOA 5C52B 1Q7YC 2ALYA 2DILA 1XQHA 1BI0A 1AWWA 3JCMP 3CCQQ 2ZT7A 3DB3A 4YRQA 2JT4A 1AZEA 1ZHIA 2VXFA 2XD0A 1QMCA 1SRLA 1ZBJA 1PRLC 3VS7A 4XK8E 1B70A 1Y7XA 3JB9H 1T3LA 2RF0A 2AKKA 3RDVA 4CS3A 2KMTA 5C51B 2DTOA 5CIUA 4PJMA 1VQLT 2DVJA 5F5WA 3LYIA 1WZOA 2MAMA 1ZA2B 5HCKA 1OI1A 2WACA 5KNNA 3VS1A 2J3LA 1JJ2S 3OYDA 2GCXA 4ZIBA 3REXA 1IREB 1EX4A 4MMKA 3JCMe 4LD6A 2P5IA 3UGQA 1EFWA 3QIIA 3TEEA 2CJBA 2DL8A 5KYYA 1YJWA 1Q81C 1WQWA 2YDLA 2GQIA 4LXCA 5KCHA 1QW1A 4M77F 1VQPT 3MJXA 1VQLQ 4P75A 3L2WA 2HL5C 4RG2A 4WF2A 1NYFA 4KULA 1UEBA 3MEUA 2FHDA 1H3HA 3MF2A 1KFZA 4C92B 2FO0A 2EKOA 2W0ZA 1TOVA 4E7LA 2EYQA 3DB4A 4YRGA 2ZZEA 3HL8A 4B6MA 4PFOA 1U3OA 4B9WA 2HDAA 2FZGB 2DQ3A 2K57A 4C5HA 5GANe 1YHQQ 1TTHB 1OU8A 4ZGEB 3OYNA 3UPUA 2JZ2A 4Y28E 1H4VB 2X4JA 4YRIA 2A8EA 3SWNB 4E6RA 1HK9A 1ADYA 1ATIA 1VYTA 4YRCA 5FWCA 3HRSA 3CXCS 1D3BB 4EX5A 4EIKA 2Q7GA 1S1NA 4HKEA 1B8AA 4C92E 2KQWA 2EGAA 3HY0A 4DOVA 3HY1A 1J3TA 1AWOA 4AFUC 1D0XA 4IURA 2KK4A 4RQEA 3P8BB 1ABOA 5KYUB 4M77C 3O5ZA 5DY9A 5IT9E 3A8HB 4CC4B 2RHSA 1KC8U 1N27A 2RQUA 2AKWB 2QQRA 5GJVB 1UHFA 4DBRA 3HXZA 2KDSA 5D6XA 3J81E 4CH6A 2O2OA 1TXQA 4G84A 4DBHA 2F69A 5I2SA 2NS6A 3QHSA 1QQJA 4N4IA 1MNDA 4P73A 1KHIA 4C92D 1X2KA 2OX7A 5GMKm 4QQGA 4E7HA 1WXUA 3HFZB 3A8LB 1TWBA 2DYIA 3QYGB 5C0MA 1K9MR 1HXDA 4PJOF 3QUIA 1U06A 4HT8A 3CEYA 1M1KR 1TUDA 1Z9QA 2P4TA 1RLQC 2ZR2A 1PKTA 3C12A 3MHXA 1KC8C 1BYMA 4RTXA 4IUVA 1HTTA 1X2QA 1X6GA 3P8DA 2ZGWA 4KGVB 3CCVQ 1GCPA 2Q5HA 4E47A 2QA4T 2XG8D 3PCOA 3ZL7C 5DLOA 3CD6T 1IGUA 1B07A 3NGPA 3A74A 5CKBA 4P3PA 1M3AA 3M0TA 1KQ2A 1YGBA 2EL9A 5LJ5h 1VYUA 4E7JA 1NM7A 2QTXA 4J9CA 1Q95G 2QQ9A 1M5Q1 1MHNA 1PD1A 1RADB 3I5RA 3VQWA 3L4GA 2DD4A 1WPYA 3P8VA 1Q86R 1NJ2A 2M51A 1PWTA 3X28B 4A63B 4H2TA 3L2UA 4FM4B 4YRFA 1M3CA 2RHQB 1TSFA 1FYFA 2K9GA 2ESWA 2A36A 4OMFB 1YIJT 2CP5A 4J9BA 1D09B 4FYVB 5J3BA 1QF6A 2JUFA 4X9CA 5A2QE 2RHUA 3JB9G 1S72A 2BTTA 2JTMA 2CDTA 1VQ7T 2KI7A 4PJOC 2ZPFB 3WXMB 3OYYA 2PVDB 1M1GA 1QP2A 2M0OA 3M57A 2VV5A 4RTYA 1G51A 2AMCA 2ZXFA 4P5NA 2C0OA 1M27C 3JCMh 5C53B 4FW2A 3CC7Q 2V8KA 4EMKB 3PIPA 3RR6A 4KT0E 1AOJA 1VOMA 2JJ9A 3TQ7P 2WSFE 3I5SA 3OY9A 1JU5C 2OTJT 1SSHA 1AHJB 1NZ9A 3LSSA 3PMTA 3JCMX 2PU9B 2DL3A 4Q5WA 2A7YA 5HK3A 2KR3A 3EFOA 1ASYA 1RI9A 1YJNA 4DBQA 3G71T 5A0DA 4OB1B 1SRYA 4NL2A 1W2BS 5L23A 2LCSA 1VQZA 2JM8A 3SHWA 4EDUA 4Q6GA 2JTEA 2ZIMA 5HKCA 3RF1A 1E7OA 1YNZA 1QKXA 3X25B 3CCLA 2RJCA 1G3YA 3S3OA 1PM3A 2CP0A 4P72C 2OTJQ 2DD5A 2E4HA 1S72Q 2CYZB 1EIYA 2KXDA 3QDRB 1Q82R 2H8HA 3NMZC 4DBFA 1CKAA 3EG0A 3RKWA 3G71Q 1QP3A 2CH4A 2RN8A 2BIVA 2O4XB 3C94A 4PLIA 2DBMA 2P84A 2V1RA 3UA7A 5GMKh 2DF6A 4HT9A 3PTAA 1KMNA 4E7ZA 4KH0B 1RIQA 4WJ4A 3QPHA 1VQKA 2DM1A 2LTOA 5LJ5d 1LJOA 1NBEB 4XEMA 2JTFA 4QW2A 2BKDN 1I81A 4E7KA 4YP0A 2VUBA 2QASA 2DK3A 1B34B 5CKHA 1OOTA 2F2VA 3NTHA 3L42A 1O9SA 1KD1U 2XU8A 1IXDA 1MNEA 1R0CB 3UWNA 4BE2A 4A4FA 3OW2S 3FB9A 1N8RR 5GJWB 2DJZA 4HCBA 1VQ6T 4HWRA 1I5OB 2KT1A 1JJCB 4J15A 2CJAA 4C0DC 1UTIA 1NEGA 4O6JA 1WXBA 3JSCA 3N5BB 2E3IA 3VS2A 4M75B 4NS5A 2K2MA 3SB2A 1WFWA 5LJ3j 2L0AA 3OD1A 2R58A 4YYEA 1M4ZA 4M78E 1NJIR 3HRTA 4BD3A 3G4SA 2YT6A 3R6NA 4IUPA 4C8QA 3MPUB 5I11A 4IUTA 4M7AB 2E6NA 3A8GB 3OB9A 2L89A 3QBYA 4K11A 5GMKi 5KYXA 5GAN3 2CUBA 2K4YA 2MWPA 1BB9A 3H8ZA 4P74C 2LNHB 2QK0A 4XQ3A 5CKFA 1VQ8T 5M9OA 3VUZA 1NLOC 1PSEA 4CC3A 4L87A 1C0AA 1E6GA 4M75E 3TEHA 4HXJA 2FPFA 1IL2A 3BFMA 4M78D 1FMVA 2RQTA 2AK5A 4ME7A 5GAN5 1L0WA 2HNIA 4OVAA 5GANd 4KGXB 4EMHA 4M7DA 4M7AE 3CCUA 2NLUA 1LYLA 2CZ0B 1UDLA 4RTVA 3W3SA 1PD0A 4X1VA 4UP9A 4OB3B 1G2BA 1B7YB 2RJDA 3U23A 1WYDA 5FROA 4C0FA 3ASKA 4JS5A 1VQ5T 2P0LA 3CCSA 1G5VA 1TUCA 4M75D 3LGFA 4JRQA 4BACA 3OW2P 4MDXA 1PG5B 2FPDA 5KCOA 2R5AA 2DVEA 4YTLA 3CCRQ 4M7AD 1M2VB 4C8QF 2QEXT 5CCAA 1RAHB 5CK9A 3EGXA 2FYKA 1VQMA 4WI1A 3TREA 3MQZA 3HSBA 4A54A 2KY9A 3CPWA 1AD5A 3AHUA 2P0KA 3WVDB 2RJEA 1QVFP 1FX7A 4E7SA 2DYBA 1B76A 2AKLA 4KRTA 1TS9A 1AVZC 2IPOB 3QO7A 1WDXA 4H2XB 4YRKA 2C06A 5GANf 2F5KA 4C92G 3CCUQ 3A5ZA 2CSQA 3E9GA 4M7DF 1X2GA 2YLBA 3UA6A 3CMET 2RHYA 4J9FA 2LJ3A 4RMFA 3A1PA 7AT1B 2EAYA 4DEXA 3CC4T 3TVTA 2EGCA 3CMAA 2LCCA 3C4SA 5LJ3e 3CCEA 3CCSQ 3OYLA 2KROA 5IAYA 1FWZA 3RL6A 1CSKA 2QHSA 4LVMA 3LSQA 4LVJA 3PT9A 1H4TA 2LT4A 5EG2A 2X51A 1CKBA 4C8QC 2ODRD 1V1CA 2HKNA 2D8HA 2DFUA 1M9SA 4LVKA 4BY6B 3UGTA 3HTZA 3RNJA 2CH4W 5GAOm 3I55T 1Z7NA 1SESA 1OYXA 1G8XA 3CMQA 3CMEQ 3R07A 5FW9A 4EMGA 3CCQA 1NJ5A 3UDCA 4YCVA 3EGDB 3CC4Q 2GGRA 5GANj 1IGQA 1OULA 3CBMA 1JQQA 1W70A 1SPKA 4N4HA 5AT1B 2FPEA 3LH0A 1UJ0A 4QVZA 2MK5A 3KUFA 2EQKA 2XDPA 4NL3A 2J06A 4ELZC 1YFNA 1Q7YU 1C1AA 5GANg 2E10A 3HRUA 3MEYA 4JZ3A 2QG9B 2YHTA 3I55Q 1HYOA 4M7DC 5GAN2 2MOXA 2GF7A 4AG1C 2RK1A 4ZN1A 4LDVA 5GAN4 1JO8A 4F7UE 4KBMB 1XTDA 2RNAA 3QDFA 4ELYC 2HD0A 1TUGB 2P0PA 1SRMA 3BW1A 1MMAA 3JV3A 2D8JA 3CMAQ 2ZCFB 1YI2T 4KGZB 4LNSA 1X55A 4JS4A 2ZAEA 1N9SA 2OTLT 2GFAA 5D6WA 3SDZA 1VQLA 1R0BG 2HBWA 3RKYA 4HVWA 3QXEB 1U8RA 1BI2A 2CGHA 2XGTA 2XHCA 1PSFA 1B3QA 3NENA 3EG3A 2QHVA 3LLRA 2AIRB 3EG9B 1X27A 4MDWA 1NJ6A 4V2SA 2EWNA 2DU5A 2PMEA 4C0GA 2L3RA 2I4OA 2E41A 3M56A 1Q81U 1YHQA 2E6ZA 2DIQA 2E3HA 3D7SB 4R0KA 3SWNA 1VQPA 2J3MA 2OTLQ 1WI7A 4ATOA 2Y4XA 2DL7A 2QQSA 1IHWA 1WHHA 1D3BA 4TVAB 4RG8A 1WX6A 4E2FB 2ZT5A 4HA8A 3HXYA 1WJQA 5CO7A 2YLCA 1Q82C 3ULRB 2DXTA 2LQKA 2A28A 3CBPA 4FIBA 4LVIA 4FU6A 1JEGA 3P8HA 1SSFA 2DAQA 5KYUA 3KFVA 5FRMA 5D6YA 2E3CA 1VIFA 2DTIA 1R77A 3DLLA 3BDUA 3X20B 4OMOA 2DTHA 1D0ZA 1AT1B 2K79A 1F1BB 3QYHB 2MCNA 1KK7A 4BE0A 2YRVA 4BI8B 2DO3A 4YRPA 2EGEA 2CZ1B 3VS0A 3VUBA 1Y71A 1PYSB 1WLPB 2JNGA 3EG2A 3JCMc 3KBGA 1KD1R 1G3SA 2MPXC 4YREA 2EJGA 1YB3A 1WHJA 4ZGJB 3HFZA 4P3OA 1K73R 2QGFB 4M77B 4X34A 2Q7HA 3BY7A 2KEAA 2CP2A 4KUDK 3M0RA 1D1BA 1ARKA 2OAUA 3H9NA 1VQPQ 2F5TX 1QE0A 3KXTA 2EYZA 3CC2T 3I56T 1KQ1A 3CPFA 4TVWA 3MO8A 3CCVA 2RA2A 1LCKA 1G5IA 1X69A 1YFTA 3A7UA 1JB0E 1BBUA 2VGMA 3I35A 3JCMb 1ZQ1A 2E1HA 3O8VA 5LJ3h 2J05A 4P71A 2KBTA 3QTCA 2LQNA 4QKUA 1D1AA 2ZIOA 5GAOp 2B86A 2CKKA 2KRMA 3M59A 5DLQE 4RDXA 3LC0A 2K7AA 4M77E 3V7RA 3FJ5A 3P8TA 1PNJA 2AZVA 2DX1A 4JJNK 3RIRA 3E1SA 2NWMA 4X9DA 2ECZA 2F1LA 2PQWA 3BDLA 1VQ4T 1K8AR 2RHQA 5ELOA 4HCZA 2LVMA 3ERRA 2JW4A 3IALA 2QA4A 2X4WA 2EJFA 2XIDA 4MMLA 3CD6A 1VA7A 1WQ7A 3MEAA 2HMAA 1JJ2P 3ER0A 2ZCEA 3G6ET 3H0FA 1NYRA 3HHTB 2X4YA 3G7ZA 1WNLA 4LN2A 1OZ3A 2HQEA 2GTJA 1I5LA 4GLKA 3UFGA 1Y96B 2V8IA 1M90U 3VS5A 4M77D 2LQWA 4ZTFA 1WU7A 3M53A 5K1PA 1YITT 1ZSZB 4M78G 4RUGA 3DSQA 4XTUA 3V8KA 3TEGA 4PJJA 2GFUA 4XTYA 1IRXA 3RMQA 4L5GA 2LT1A 2Q7EA 4EMKA 1YIJA 2K5FA 1D0YA 2ZZDA 3CC7A 2ENMA 2LZ6B 2XICA 4PFZA 1RLPC 3M55A 1WA7A 1RL2A 3VS4A 4PJOB 1VQ7A 1ZUUA 1X01A 5KYWB 4LUEA 3JCMQ 2R5MA 2O88A 1I1JA 1VQNT 5C6SA 1XOVA 2ABLA 2HBPA 3FDRA 4M75G 4YPFA 3MCAB 1M90C 3UF4A 3EAEA 3RESA 1RACB 1YFRA 8AT1B 3CXCP 2M02A 4OGCA 1M1FA 1RABB 4P75C 1KJWA 1QKWA 5CAIA 4M7AG 1M30A 3OMGA 3PGGA 2QA4Q 3EHRA 1M8MA 2FB7A 4KR3A 3CD6Q 1QCOA 4JJDA 3OYBA 11ASA 2RI3A 3M0PA 3HRKA 3VYHB 2VGNA 1T0HA 1U5SA 2OTJA 2D9TA 1HD3A 4PJOE 1K4US 4XU1A 1BCOA 3NTIA 4J9DA 2OAWA 2LJ0A 1LNXA 4RTUA 1RAGB 3QO8A 3IQLA 2FRWA 3JB9J 2L8DA 4FL6A 2O4XA 1XNIA 3G71A 4C0ZA 2P4RA 1K1ZA 5IHIA 4C5EA 5KYNA 5GAN8 4A4GA 1YIJQ 3M9QA 2XDDA 1BIAA 4TVRA 2RHZA 5LJ3d 1USYA 2YUPA 2ZZGA 2DXBA 1T0JA 1VQ7Q 2DMOA 4P71C 1ZLMA 1WGSA 4IIMA 4PJOD 4ZN3A 2PNIA 3DKMA 3GNFB
chains in the Genus database with same CATH topology
3VBBA 1WLEA 4N0AA 1KQSA 2ARTA 4GY5A 1YJ9T 2K3XA 3CBOA 1MGQA 2DEQA 3META 2MF2A 4A4KA 5GANh 1YBYA 1JJCA 3S6WA 3GIBA 3H6ZA 1UGRB 4P73C 5GAOn 4M75A 2QI2A 4LDWA 3A7RA 3CPWS 1NYQA 5HGQA 3MF1A 3GF5A 5FU7C 3E9IA 1X6OA 5FRNA 4J6YA 4RQFA 3OSVA 3E9HA 3CCMT 1EIFA 3QO3A 3C95A 4EMKC 1EVLA 3M58A 3GP8A 1VQ6A 3CCJT 4C0DB 4UPAA 4HWPA 4YRMA 2AHJB 4PKCC 2M16A 4QVCA 5LJ3f 2G4CA 2VC8A 2LNVA 2P0QA 4XU3A 1YJNT 4A4EA 4M78B 2RHIA 2I4LA 2AMCB 3JCMW 4BI4A 3M54A 4QVDA 1H4QA 2PVGB 3NTKA 2RB6A 3JCMV 4JRKA 1DJ7B 2ZPEB 1VQ8A 3OQ5A 4F7UG 1B7YA 4JRPA 3HRIA 4RCBA 1GGMA 3RACA 2CS7A 3V7CA 3IKMB 2ZT8A 1NE8A 2DZCA 4H2SA 2JN0A 1W4SA 2M1HA 3HXUA 5HY6A 3MEVA 4D6WA 3FJPA 4A4HA 4FSXA 3CCRA 5LJ3g 1USYC 4YROA 4OLFA 1EIYB 4EPCA 3JB9F 4ZTUB 3NETA 3INZA 1JBMA 2ZNIA 2XI9A 4J83A 4N0AC 4BI3A 3EFSA 4TTVA 2KVQG 3OBWA 3BJUA 4H2YA 3MEWA 4H2XA 4VUBA 2DDZA 4N4GA 1K73C 1E1TA 2QEXA 4X5OA 12ASA 3HXWA 4LD9K 1E1OA 4HWOA 4L6V5 4HT4A 1U1TA 2EJ9A 2DXCA 5A0LA 2ZNJA 4XU2A 1VQOT 1K9MU 1KMMA 1M1KU 4YRLA 3CMEA 2E64A 1KOGA 3CC4A 1K8AC 2ZTGA 4CH3A 5CVIA 4O2DA 3A5YA 3S3MA 4J5YA 3MP1A 2IY5B 4MZPA 3URGA 4K87A 3I55A 3UT1A 4IUQA 1K9MC 1X75C 3X26B 3TCJA 2I2LA 1WJSA 1M1KC 1Q86U 4CI0C 3MP8A 4M77G 3ZEHA 3NEMA 2B8AA 1VQ9T 2E5AA 4BDZA 2C7IA 1BKBA 2E70A 4C8QE 4G85A 4HCCA 4LDXA 2M9UA 4BE1A 3LGLA 4J6WA 5I2MA 2X4XA 1VQMT 4F7UB 1VIEA 1ASZA 3HFOA 2VXEA 1Q86C 1EQRA 4FT2A 1WJRA 2OTLA 4TVAA 4OGEA 1KG1A 4UC4A 1BI3A 2Y90A 4MZMA 2JVVA 2K5LA 4C8QD 4M7DE 1QVGA 2CJ9A 2D0QB 2KSSA 3LWIA 1E22A 5FU6C 1I8FA 1QVFA 2DU7A 4XEOA 2CIMA 2K5IA 4YRTA 2PVOB 1PYSA 4YCUA 1O75A 2DXUA 2IG0A 1Q82U 4C92A 3OYHA 4E7IA 4M7DD 3P8YA 4UP8A 2MI6A 3IKLA 3OYGA 4PJOG 1BIBA 4UP7A 2MWOA 1J5WA 1SERA 3M4GA 2C8MA 3HFNA 3RUXA 4TVYA 3X24B 3JCMJ 1R8OB 2MMPA 3OYIA 1X56A 2RJFA 2Q5IA 4HWTA 3Q1JA 1N9WA 1NPRA 2GQVA 3QKJA 4JLGA 4OB2B 2E5QA 1N8RU 2AKWA 3RERA 4TWAA 2O01E 1OZ2A 3CC2A 4J6XA 3I56A 2DQ0A 1N6AA 3HPWA 2DZ9A 4Z02A 5AYFA 3LW5E 2ZR3A 1EVKA 4KUIA 3RMSA 4JRIA 1H3ZA 4C92F 1NJIU 4BDYA 3JB9I 4CH5A 4KQEA 4II1A 1Y96A 1YHQT 2QHTA 5A0GA 2HQXA 3OS2A 3JAME 1KQSS 3FLGA 1VQ4A 5GAMd 1N8RC 2XKOC 2QQBA 3DLMA 2RHXA 3L2RA 1UGPB 1G3TA 1VUBA 3MP6A 2ALYB 4PJOA 3G6EA 3GOXA 3A8OB 1H641 3M4YA 5CKEA 2ZINA 1NJIC 5KE3A 4TQFA 4JDSA 3UH0A 1YJWT 2DIGA 1YITA 1B70B 3JRZA 1BI1A 4ZGDB 3V7SA 3I7FA 4EO4A 3OMCA 3NELA 3OS0A 2XTIA 1U1SA 4C92C 5GAOq 1ZBXA 1IZ6A 5GMKe 4XAXB 4YRJA 5L8RE 3VJPA 3L1AA 1VQNA 2I4NA 2LC4A 3M4PA 4ZTJA 4BW9A 4XTVA 1HC7A 1G3WA 5GMKl 3SWNC 3A32A 3QJYA 4HVCA 4H2UA 5GAMf 3CCVT 5J26A 2RO0A 1KHCA 4P72A 5CKDA 1YFSA 3REUA 4IUUA 1GXIE 2L5QA 4KR2A 2EIFA 4L59A 3VV0A 4E51A 4J7FA 3TUPA 2Y4YA 1V29B 3HFVA 4MZTA 2HAXA 4LVLA 3QZ5B 4YRSA 2LX9A 3F70A 5GAMj 3TU4K 2ZPBB 3J80E 3SD4A 2RHSB 2BUDA 2G3RA 3A7AA 5DM7R 1YJ9A 4BUGA 4CS2A 3E9FA 1NJ8A 5GAMg 1FXXA 1JRIA 3CC7T 2R57A 3G1ZA 4OB0B 3WQZA 3FC3A 1JJ2A 2JOYA 4NCXA 4M78A 3FRNA 5FU7B 2EQMA 4Q15A 3PZCA 1B34A 1UGSB 3CCMA 4JLIA 4YCWA 3LX7A 3T9NA 2ZPIB 2RH2A 4P74A 3PCOB 4HWSA 3CCJA 3ZFJA 2K2VA 3QJ6A 3OSSC 1SETA 1S72T 4XTZA 5LL6S 2LQ8A 3HXVA 2RD1A 4Y91A 1P92A 1RI0A 4PLLA 3QZ9B 4R55A 4QQDA 3L4GB 4NOYA 4XU0A 4M7AA 3CXCA 4C8QG 4BWAA 3ICAA 1BBWA 1LOJA 3NFCA 4LDYA 3A31A 2VYTA 4O5VA 4J8OA 3M5AA 3OYJA 4M78F 4WJ3M 3QO5A 3OBYA 4H2WA 5KE2A 3ZBDA 3VU3C 3OA6A 4M7DG 3CCLT 4YRRA 5GAMe 3FEOA 1TH7A 4PG3A 2DKGA 2ARSA 4RMOA 3VQVA 4M75F 1X2HA 1YCYA 3OYKA 3L2VA 4DOWA 5I21A 1K73U 1H4SA 1QVGS 1EOVA 2RK2A 4M7AF 3PFSA 3LWHA 5CR2A 1VQKT 3WVEB 1I4K1 4QQ6A 4PHCA 3RKXA 4M78C 4JUVA 1VQ5A 4B9XA 4LDUA 3EFRA 1QVFS 2WSEE 3PMIA 3JCMd 3HP9A 1NJ1A 4PNOA 1KD1C 2IY5A 4DQ2A 1VQOA 2EFIA 1N9RA 4OP0A 2QHUA 4ZTZB 3IG2A 3QG1A 2CZ6B 5LJ5f 4XTWA 1K8AU 4H02A 4M75C 3OYEA 3GLXA 5GAN6 3OYMA 2PMFA 2QQAA 2I4MA 3G4ST 1Z7MA 4DPGA 3GPLA 2QXFA 2XDBA 1ADJA 4XTXA 4M7AC 3CCRT 3VKIA 3OYFA 4H2VA 4F7UA 2PUKB 2RI2A 4YRNA 5HK0A 4CH4A 3QNEA 4A53A 1NNHA 5ELNA 2EQJA 3L2QA 1NPPA 3PNWC 3KFUA 2V8JA 5LJ5j 1VQ9A 2E12A 5CQXA 3QSUA 4FT4A 3OYCA 3JCMf 4C8QB 1W2BA 3OYAA 5KH6A 4K86A 3CCUT 2XK0A 3RGLA 3VQYA 2LDMA 3JB9D 5LJ5g 2ARUA 2FVUA 4J7IA 2IVWA 3VQXA 1G5HA 5CQYA 4OF1A 3CCST 2QDYB 3TEHB 3HXXA 2LCLA 2ODRC 4YDQA 3V8LA 3HKSA 2K3YA 1W66A 4M7DB 1QVPA 4K88A 2RM4A 5GAOr 3ME9A 1M8VA 1UGQB 4F7UF 3A8MB 5IN1A 5GAOl 2DPPB 3M4QA 3S3NA 2RI5A 5FU6B 1YI2A 2KAFA 3JCMg 3J7AF 5GAMh 3OW2A 3OS1A 2PUOB 3VYGA 2EQUA 3E19A 1X54A 1E24A 5GAN7 2ZT6A 4RCCA 4R56A 3SFMA 2H3JA 3CMAT 4TQDA 3R6OA 3CCET 5E3IA 2LRQA 2E65A 4IKFA 2WSCE 4RKUE 3L2ZA 2FL7A 2A3LA 5FLXE 2ZZFA 4CRIA 4BY6C 4AH6A 4C5IA 2X35A 3OS5A 4P3NA 3A5ZB 1Y07A 5GMKj 4C5GA 3CCQT 5K1XA 4M77A 4BB7A 4CS4A 3V8JA 2ZPGB 4DA4A 5J39A 2ZPHB 5LJ5e 2D6FA 3GNGA 3FIFA 4PL6A 1UB4A 2CZ7B 3PIOA 5C52B 1Q7YC 2ALYA 1XQHA 1BI0A 3JCMP 2ZT7A 3DB3A 4YRQA 1ZHIA 2VXFA 2XD0A 4XK8E 1B70A 1Y7XA 3JB9H 4CS3A 2KMTA 5C51B 2DTOA 5CIUA 1VQLT 5F5WA 3LYIA 2MAMA 1OI1A 2WACA 5KNNA 2J3LA 1JJ2S 3OYDA 2GCXA 4ZIBA 3REXA 1IREB 4MMKA 3JCMe 4LD6A 2P5IA 3UGQA 1EFWA 3QIIA 3TEEA 2CJBA 1YJWA 1Q81C 1WQWA 5KCHA 1QW1A 4M77F 1VQPT 4P75A 3L2WA 4RG2A 4WF2A 4KULA 1UEBA 3MEUA 2FHDA 3MF2A 4C92B 2EKOA 4E7LA 2EYQA 3DB4A 4YRGA 2ZZEA 3HL8A 4B9WA 2DQ3A 2K57A 4C5HA 5GANe 4ZGEB 3OYNA 3UPUA 2JZ2A 4Y28E 1H4VB 2X4JA 4YRIA 2A8EA 3SWNB 1HK9A 1ADYA 1ATIA 4YRCA 3HRSA 3CXCS 1D3BB 4EX5A 2Q7GA 4HKEA 1B8AA 4C92E 2KQWA 3HY0A 4DOVA 4IURA 2KK4A 4RQEA 3P8BB 4M77C 5DY9A 5IT9E 3A8HB 2RHSA 1KC8U 1N27A 2AKWB 2QQRA 3HXZA 2KDSA 5D6XA 3J81E 4CH6A 4G84A 2F69A 5I2SA 2NS6A 3QHSA 4N4IA 4P73A 1KHIA 4C92D 5GMKm 4QQGA 4E7HA 3HFZB 3A8LB 3QYGB 5C0MA 1HXDA 4PJOF 3QUIA 4HT8A 3CEYA 2P4TA 2ZR2A 3C12A 3MHXA 1KC8C 1BYMA 4IUVA 1HTTA 3P8DA 2ZGWA 2Q5HA 4E47A 2QA4T 2XG8D 3PCOA 5DLOA 3CD6T 3A74A 5CKBA 4P3PA 1KQ2A 1YGBA 2EL9A 5LJ5h 4E7JA 2QTXA 2QQ9A 1M5Q1 1MHNA 3VQWA 3L4GA 2DD4A 1WPYA 3P8VA 1NJ2A 4YP0A 3X28B 4H2TA 3L2UA 4FM4B 4YRFA 2RHQB 1FYFA 4OMFB 1YIJT 5J3BA 1QF6A 2JUFA 4X9CA 5A2QE 2RHUA 3JB9G 1S72A 2JTMA 1VQ7T 4PJOC 2ZPFB 3WXMB 3OYYA 2PVDB 1M1GA 1QP2A 2M0OA 3M57A 2VV5A 1G51A 2AMCA 2ZXFA 4P5NA 3JCMh 5C53B 2V8KA 4EMKB 3PIPA 4KT0E 2WSFE 3OY9A 2OTJT 1AHJB 1NZ9A 3LSSA 3PMTA 3JCMX 2PU9B 4Q5WA 2A7YA 5HK3A 1ASYA 1YJNA 3G71T 5A0DA 4OB1B 1SRYA 4NL2A 1W2BS 1VQZA 4Q6GA 4EDUA 2ZIMA 5HKCA 3RF1A 3X25B 3CCLA 2RJCA 1G3YA 3S3OA 4P72C 2DD5A 2CYZB 1EIYA 3QDRB 3RKWA 1QP3A 2BIVA 2O4XB 3C94A 4PLIA 5GMKh 4HT9A 3PTAA 1KMNA 1RIQA 4WJ4A 3QPHA 1VQKA 2LTOA 5LJ5d 1LJOA 4XEMA 2JTFA 4QW2A 2BKDN 1I81A 4E7KA 2VUBA 2DK3A 1B34B 5CKHA 3NTHA 3L42A 1O9SA 1KD1U 2XU8A 4BE2A 3UWNA 4A4FA 3OW2S 3FB9A 2DJZA 4HCBA 1VQ6T 4HWRA 1JJCB 4J15A 2CJAA 4C0DC 4O6JA 3JSCA 3N5BB 4M75B 4NS5A 3SB2A 5LJ3j 3OD1A 2R58A 4YYEA 1M4ZA 4M78E 3HRTA 4BD3A 3G4SA 4IUPA 4C8QA 4IUTA 4M7AB 2E6NA 3A8GB 3OB9A 2L89A 3QBYA 5GMKi 5GAN3 2K4YA 2MWPA 3H8ZA 4P74C 5CKFA 4XQ3A 1VQ8T 5M9OA 3VUZA 1PSEA 4L87A 1C0AA 4M75E 3TEHA 1IL2A 3BFMA 4M78D 4ME7A 5GAN5 1L0WA 2HNIA 4OVAA 5GANd 4EMHA 4M7DA 4M7AE 3CCUA 2NLUA 1LYLA 2CZ0B 3W3SA 4UP9A 4OB3B 1B7YB 2RJDA 1WYDA 5FROA 4C0FA 3ASKA 4JS5A 1VQ5T 2P0LA 3CCSA 1G5VA 4M75D 3LGFA 4JRQA 4BACA 4MDXA 5KCOA 2R5AA 2DVEA 4YTLA 4M7AD 4C8QF 2QEXT 5CCAA 5CK9A 2FYKA 1VQMA 4WI1A 3TREA 3MQZA 3HSBA 4A54A 2KY9A 3CPWA 3AHUA 2P0KA 3WVDB 2RJEA 1FX7A 1B76A 3QO7A 4H2XB 4YRKA 2C06A 5GANf 2F5KA 4C92G 3A5ZA 3E9GA 4M7DF 1X2GA 2YLBA 3CMET 2RHYA 4RMFA 2EAYA 3CC4T 3CMAA 2LCCA 3C4SA 5LJ3e 3CCEA 3OYLA 5IAYA 1FWZA 3RL6A 2QHSA 4LVMA 3LSQA 4LVJA 3PT9A 1H4TA 2LT4A 5EG2A 4C8QC 2ODRD 1M9SA 4LVKA 4BY6B 3UGTA 3HTZA 5GAOm 3I55T 1Z7NA 1SESA 1OYXA 3CMQA 3R07A 4EMGA 3CCQA 1NJ5A 3UDCA 4YCVA 5GANj 3CBMA 4N4HA 3LH0A 4QVZA 3KUFA 2EQKA 2XDPA 4NL3A 4ELZC 1Q7YU 5GANg 2E10A 3HRUA 3MEYA 2YHTA 4M7DC 5GAN2 2GF7A 4ZN1A 2RK1A 5GAN4 4LDVA 4F7UE 4KBMB 1XTDA 4ELYC 2HD0A 2P0PA 3BW1A 2ZCFB 1YI2T 4LNSA 1X55A 4JS4A 1N9SA 2OTLT 2GFAA 5D6WA 3SDZA 1VQLA 3RKYA 3QXEB 1U8RA 1BI2A 2CGHA 2XGTA 2XHCA 1PSFA 3NENA 2QHVA 3LLRA 4MDWA 1NJ6A 4V2SA 2EWNA 2DU5A 2PMEA 4C0GA 2L3RA 2I4OA 2E41A 3M56A 1Q81U 1YHQA 2E6ZA 2DIQA 3SWNA 1VQPA 2J3MA 4ATOA 2Y4XA 2QQSA 1D3BA 4TVAB 4RG8A 2ZT5A 4HA8A 3HXYA 1WJQA 5CO7A 2YLCA 1Q82C 2DXTA 2LQKA 3CBPA 4LVIA 4FIBA 4FU6A 3P8HA 1SSFA 2DAQA 5FRMA 5D6YA 2E3CA 1VIFA 2DTIA 3DLLA 3BDUA 3X20B 2DTHA 3QYHB 4BE0A 2YRVA 4BI8B 2DO3A 4YRPA 2CZ1B 3VUBA 1Y71A 1PYSB 2JNGA 3JCMc 3KBGA 1G3SA 4YREA 2EJGA 1YB3A 4ZGJB 3HFZA 4P3OA 4M77B 4X34A 2Q7HA 3BY7A 4KUDK 2OAUA 2F5TX 1QE0A 3KXTA 3CC2T 3I56T 1KQ1A 3CPFA 4TVWA 3MO8A 3CCVA 2RA2A 1G5IA 1YFTA 3A7UA 1JB0E 1BBUA 2VGMA 3JCMb 1ZQ1A 2E1HA 3O8VA 5LJ3h 4P71A 3QTCA 2ZIOA 5GAOp 2CKKA 3M59A 5DLQE 4RDXA 3LC0A 4M77E 3V7RA 3P8TA 4JJNK 3RIRA 3E1SA 4X9DA 2PQWA 3BDLA 1VQ4T 2RHQA 5ELOA 4HCZA 2LVMA 3ERRA 3IALA 2QA4A 2X4WA 2EJFA 2XIDA 4MMLA 3CD6A 1WQ7A 3MEAA 3ER0A 2ZCEA 3G6ET 1NYRA 3HHTB 2X4YA 3G7ZA 1WNLA 1OZ3A 2HQEA 1I5LA 3UFGA 4GLKA 1Y96B 2V8IA 1M90U 4M77D 4ZTFA 1WU7A 3M53A 5K1PA 1YITT 4M78G 3DSQA 4XTUA 3V8KA 3TEGA 2GFUA 4XTYA 3RMQA 4L5GA 2LT1A 2Q7EA 4EMKA 1YIJA 2K5FA 2ZZDA 3CC7A 2XICA 3M55A 1RL2A 4PJOB 1VQ7A 1X01A 3JCMQ 2R5MA 1VQNT 5C6SA 1XOVA 2HBPA 3FDRA 4M75G 4YPFA 3MCAB 1M90C 3EAEA 3RESA 1YFRA 4OGCA 1M1FA 4P75C 5CAIA 4M7AG 3OMGA 3PGGA 4KR3A 2FB7A 3OYBA 11ASA 2RI3A 3HRKA 3VYHB 2VGNA 2OTJA 2D9TA 4PJOE 4XU1A 3NTIA 1LNXA 3QO8A 3JB9J 2L8DA 4FL6A 2O4XA 1XNIA 3G71A 4C0ZA 4C5EA 5GAN8 4A4GA 3M9QA 2XDDA 1BIAA 4TVRA 2RHZA 5LJ3d 1USYA 2ZZGA 2DXBA 4P71C 1WGSA 4PJOD 4ZN3A 3HY1A 3DKMA 3GNFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UH0 A;  4M75 E;  3TEH A;  3VBB A;  4TQD A;  1WLE A;  4N0A A;  5E3I A;  1IL2 A;  3BFM A;  4M78 D;  1B70 B;  2ART A;  2E65 A;  3V7S A;  1MGQ A;  3I7F A;  3L2Z A;  5GAN 5;  1L0W A;  4EO4 A;  2HNI A;  2DEQ A;  3NEL A;  5GAN d;  2ZZF A;  4EMH A;  4M7D A;  4M7A E;  2XTI A;  1U1S A;  4C92 C;  5GAO q;  4AH6 A;  1LYL A;  5GAN h;  1JJC A;  3GIB A;  4P3N A;  5GMK e;  4YRJ A;  5GMK j;  3W3S A;  4P73 C;  5GAO n;  4UP9 A;  4M75 A;  5K1X A;  3L1A A;  1B7Y B;  3A7R A;  4M77 A;  2I4N A;  1WYD A;  3M4P A;  4BW9 A;  4XTV A;  1C0A A;  4CS4 A;  3V8J A;  2P0L A;  1NYQ A;  4M75 D;  1HC7 A;  5HGQ A;  3MF1 A;  3E9I A;  5LJ5 e;  5GMK l;  4J6Y A;  3SWN C;  3FIF A;  4RQF A;  3E9H A;  3A32 A;  4HVC A;  4H2U A;  5GAM f;  3QO3 A;  4EMK C;  5C52 B;  2DVE A;  4P72 A;  1EVL A;  4M7A D;  4C8Q F;  2ALY A;  4UPA A;  3JCM P;  4HWP A;  4YRM A;  4QVC A;  5LJ3 f;  2FYK A;  2ZT7 A;  2G4C A;  4WI1 A;  4YRQ A;  1YFS A;  3REU A;  2VXF A;  2VC8 A;  3HSB A;  4A54 A;  4KR2 A;  4XU3 A;  4E51 A;  4M78 B;  1B70 A;  3AHU A;  3JB9 H;  4CS3 A;  2I4L A;  2AMC B;  3TUP A;  5C51 B;  2DTO A;  3JCM W;  1B76 A;  5F5W A;  4QVD A;  3QO7 A;  1H4Q A;  3HFV A;  4H2X B;  5KNN A;  4YRK A;  2RB6 A;  3JCM V;  5GAN f;  2J3L A;  4C92 G;  4JRK A;  3A5Z A;  4ZIB A;  4YRS A;  3REX A;  4M7D F;  4MMK A;  5GAM j;  4F7U G;  3JCM e;  1X2G A;  2P5I A;  2YLB A;  1B7Y A;  3UGQ A;  3HRI A;  4RCB A;  1GGM A;  3RAC A;  4RMF A;  1EFW A;  2CJB A;  3V7C A;  2EAY A;  3IKM B;  2ZT8 A;  1WQW A;  2DZC A;  2RHS B;  5LJ3 e;  4H2S A;  2JN0 A;  4M77 F;  3A7A A;  3RL6 A;  2QHS A;  4P75 A;  3LSQ A;  4CS2 A;  4WF2 A;  3HXU A;  1H4T A;  1NJ8 A;  5GAM g;  4C8Q C;  1JRI A;  2ODR D;  3MF2 A;  3FJP A;  4C92 B;  3UGT A;  3HTZ A;  3G1Z A;  4YRG A;  5GAO m;  1Z7N A;  3WQZ A;  2ZZE A;  1SES A;  5LJ3 g;  1USY C;  3CMQ A;  4YRO A;  3R07 A;  4OLF A;  1EIY B;  4EMG A;  3JB9 F;  1NJ5 A;  4NCX A;  4ZTU B;  2DQ3 A;  3NET A;  3INZ A;  2K57 A;  5GAN e;  4YCV A;  5GAN j;  1JBM A;  4M78 A;  2ZNI A;  1H4V B;  4YRI A;  4Q15 A;  3PZC A;  3SWN B;  4N0A C;  1B34 A;  1HK9 A;  1ADY A;  1ATI A;  3EFS A;  4YRC A;  4TTV A;  1D3B B;  4JLI A;  4NL3 A;  3BJU A;  4H2Y A;  4EX5 A;  2Q7G A;  4H2X A;  2DDZ A;  4YCW A;  5GAN g;  2E10 A;  1E1T A;  3MEY A;  2YHT A;  4M7D C;  1B8A A;  4P74 A;  3PCO B;  4C92 E;  4HWS A;  3HY0 A;  4X5O A;  12AS A;  5GAN 2;  5GAN 4;  1SET A;  4XTZ A;  4F7U E;  3HXV A;  3HXW A;  2RD1 A;  4RQE A;  4Y91 A;  4M77 C;  5DY9 A;  1E1O A;  3BW1 A;  2RHS A;  4HWO A;  2AKW B;  1U1T A;  2EJ9 A;  4LNS A;  1X55 A;  1N9S A;  3L4G B;  3RKY A;  4NOY A;  4XU0 A;  2CGH A;  3HXZ A;  2XGT A;  4CH6 A;  4M7A A;  4C8Q G;  2ZNJ A;  4G84 A;  4XU2 A;  4BWA A;  3NEN A;  2QHV A;  3QHS A;  1KMM A;  3ICA A;  4P73 A;  4C92 D;  1BBW A;  1NJ6 A;  4V2S A;  1LOJ A;  4YRL A;  3A31 A;  5GMK m;  2EWN A;  2DU5 A;  2PME A;  2E64 A;  1KOG A;  2I4O A;  2E41 A;  3HFZ B;  1HXD A;  4PJO F;  3QUI A;  2ZTG A;  4HT8 A;  4CH3 A;  3SWN A;  2J3M A;  2ZR2 A;  4O2D A;  4M78 F;  4WJ3 M;  1D3B A;  1HTT A;  3A5Y A;  4TVA B;  2ZT5 A;  2ZGW A;  4HA8 A;  3QO5 A;  4J5Y A;  3HXY A;  2IY5 B;  4H2W A;  2Q5H A;  3VU3 C;  3PCO A;  2YLC A;  4K87 A;  4M7D G;  2DXT A;  3A74 A;  4P3P A;  1KQ2 A;  5GAM e;  1YGB A;  2I2L A;  5LJ5 h;  2EL9 A;  4YRR A;  1TH7 A;  2QTX A;  2DTI A;  2E3C A;  4PG3 A;  3BDU A;  4M77 G;  2DKG A;  2DTH A;  1M5Q 1;  2ARS A;  3VQV A;  3NEM A;  4M75 F;  3VQW A;  3L4G A;  1X2H A;  1WPY A;  3P8V A;  1NJ2 A;  4YP0 A;  2E5A A;  4H2T A;  1YCY A;  4YRP A;  2C7I A;  4YRF A;  2RHQ B;  1FYF A;  4C8Q E;  5I21 A;  4G85 A;  1H4S A;  1PYS B;  3JCM c;  1EOV A;  1QF6 A;  4X9C A;  4J6W A;  4YRE A;  2EJG A;  4M7A F;  3JB9 G;  1YB3 A;  4F7U B;  1ASZ A;  4PJO C;  3HFO A;  3HFZ A;  4P3O A;  4M77 B;  2Q7H A;  3BY7 A;  1I4K 1;  2VXE A;  4PHC A;  3RKX A;  4M78 C;  4JUV A;  1EQR A;  3EFR A;  1G51 A;  4TVA A;  1QE0 A;  2AMC A;  3JCM d;  2ZXF A;  1NJ1 A;  2Y90 A;  4PNO A;  2IY5 A;  1KQ1 A;  3JCM h;  5C53 B;  4DQ2 A;  4C8Q D;  4TVW A;  4EMK B;  2RA2 A;  1G5I A;  1YFT A;  1N9R A;  4OP0 A;  3A7U A;  1BBU A;  4M7D E;  2QHU A;  4ZTZ B;  3JCM b;  2E1H A;  2CJ9 A;  5LJ3 h;  3IG2 A;  4P71 A;  3QTC A;  5LJ5 f;  2ZIO A;  5GAO p;  4XTW A;  4RDX A;  3LSS A;  3LC0 A;  4M77 E;  3V7R A;  3JCM X;  4M75 C;  4H02 A;  3P8T A;  5GAN 6;  1E22 A;  1ASY A;  2PMF A;  3RIR A;  4X9D A;  2I4M A;  1SRY A;  4NL2 A;  1I8F A;  1Z7M A;  2RHQ A;  1VQZ A;  4DPG A;  2DU7 A;  5ELO A;  4Q6G A;  4XEO A;  2CIM A;  4YRT A;  1ADJ A;  2ZIM A;  4XTX A;  1PYS A;  4M7A C;  3ERR A;  3IAL A;  2DXU A;  4YCU A;  4C92 A;  2EJF A;  3RF1 A;  4H2V A;  4MML A;  1WQ7 A;  3P8Y A;  4M7D D;  4F7U A;  4UP8 A;  4P72 C;  3IKL A;  2ZCE A;  4YRN A;  1NYR A;  4CH4 A;  1EIY A;  3QNE A;  4PJO G;  1WNL A;  4A53 A;  1BIB A;  1NNH A;  3UFG A;  1I5L A;  5ELN A;  4UP7 A;  1Y96 B;  4M77 D;  1WU7 A;  3RKW A;  1J5W A;  5K1P A;  3KFU A;  4M78 G;  3DSQ A;  5LJ5 j;  4XTU A;  3QSU A;  3V8K A;  3TEG A;  1SER A;  3M4G A;  4XTY A;  2C8M A;  3HFN A;  3JCM f;  3RUX A;  4C8Q B;  4TVY A;  2Q7E A;  4EMK A;  5GMK h;  4HT9 A;  3JCM J;  4K86 A;  1KMN A;  3RGL A;  3VQY A;  1RIQ A;  4WJ4 A;  3JB9 D;  5LJ5 g;  4PJO B;  1X01 A;  2ARU A;  5LJ5 d;  3JCM Q;  1LJO A;  1X56 A;  2Q5I A;  4HWT A;  4XEM A;  3VQX A;  1G5H A;  1N9W A;  1I81 A;  4M75 G;  4YPF A;  3TEH B;  2AKW A;  3RER A;  1B34 B;  4TWA A;  3RES A;  3HXX A;  1YFR A;  4J6X A;  2ODR C;  2DQ0 A;  4YDQ A;  4P75 C;  2DZ9 A;  3FB9 A;  3V8L A;  5CAI A;  4M7A G;  2ZR3 A;  3PGG A;  1EVK A;  1W66 A;  2DJZ A;  4M7D B;  2FB7 A;  4KR3 A;  4HWR A;  4JRI A;  4K88 A;  2RM4 A;  11AS A;  5GAO r;  1JJC B;  3HRK A;  1M8V A;  4J15 A;  4C92 F;  2CJA A;  3JB9 I;  4CH5 A;  4KQE A;  4PJO E;  1Y96 A;  4F7U F;  4M75 B;  4XU1 A;  2QHT A;  3SB2 A;  5LJ3 j;  3OD1 A;  1LNX A;  5GAO l;  4YYE A;  4M78 E;  3M4Q A;  3QO8 A;  3JB9 J;  5GAM d;  3JCM g;  4C8Q A;  5GAN 8;  4M7A B;  5GAM h;  5GMK i;  5GAN 3;  1BIA A;  2ALY B;  5LJ3 d;  4PJO A;  1USY A;  2ZZG A;  1X54 A;  4P74 C;  4XQ3 A;  1E24 A;  5GAN 7;  4P71 C;  1H64 1;  2ZT6 A;  2ZIN A;  4PJO D;  4RCC A;  4L87 A;  4TQF A;  3HY1 A; 
#chains in the Genus database with same CATH topology
 3VBB A;  2GBQ A;  1WLE A;  4N0A A;  2O31 A;  2JXB A;  1KQS A;  3MKD A;  2ART A;  4GY5 A;  1YJ9 T;  2ROL A;  2K3X A;  2VB6 A;  1KSW A;  4GLM A;  2F2X A;  3CBO A;  2AZS A;  2NYS A;  1MGQ A;  1PHT A;  2DEQ A;  2KRN A;  3MET A;  2MF2 A;  4A4K A;  3VS6 A;  5GAN h;  1YBY A;  1JJC A;  3S6W A;  3GIB A;  3H6Z A;  1UGR B;  4P73 C;  5GAO n;  4M75 A;  2QI2 A;  4LDW A;  3A7R A;  4LE9 A;  3CPW S;  2ED1 A;  1NYQ A;  5HGQ A;  3MF1 A;  3GF5 A;  5FU7 C;  2MYS A;  3E9I A;  1X6O A;  5FRN A;  4J6Y A;  4RQF A;  4CC7 A;  3OSV A;  3E9H A;  3EH1 A;  3CCM T;  1EIF A;  2F2W A;  3QO3 A;  3C95 A;  4EMK C;  2EBP A;  4FSS A;  1EVL A;  1M2O A;  3M58 A;  3GP8 A;  1VQ6 A;  2O9V A;  3CCJ T;  4C0D B;  4UPA A;  4HWP A;  4YRM A;  2AHJ B;  4PKC C;  2M16 A;  4QVC A;  4J9G A;  5LJ3 f;  2G4C A;  2K3B A;  1OX9 A;  2VC8 A;  2LNV A;  2QDL A;  2P0Q A;  4XU3 A;  1YJN T;  4A4E A;  2DA9 A;  2BE9 B;  4M78 B;  4Z89 A;  2RHI A;  4KH1 B;  2I4L A;  2AMC B;  3JCM W;  3CQT A;  4BI4 A;  2SEM A;  1RUW A;  3M54 A;  4QVD A;  1H4Q A;  2PVG B;  4JJC A;  3NTK A;  2RB6 A;  3CCJ Q;  3JCM V;  1I07 A;  2KYM A;  4JRK A;  1QCF A;  4OMN A;  1DJ7 B;  2ZPE B;  3M0Q A;  1VQ8 A;  3OQ5 A;  4F7U G;  2OI3 A;  1B7Y A;  4JRP A;  3HRI A;  4RCB A;  2C0I A;  1GGM A;  3RAC A;  2CS7 A;  3V7C A;  2CT4 A;  3IKM B;  2ZT8 A;  1NE8 A;  2DZC A;  4H2S A;  3M0U A;  2JN0 A;  1W4S A;  2MIO A;  2M1H A;  3HXU A;  1UFF A;  1YWP A;  5HY6 A;  1W2B P;  3MEV A;  4F04 B;  4D6W A;  3FJP A;  1M2V A;  2EYX A;  4A4H A;  1ZSG A;  4FSX A;  3CCR A;  3UAT A;  1VQ6 Q;  5LJ3 g;  1USY C;  4YRO A;  2DL4 A;  3EG1 A;  4OLF A;  4EPC A;  1EIY B;  4HCK A;  3JB9 F;  2KGT A;  3CPW P;  4ZTU B;  2DRM A;  1W1F A;  2K6D A;  3INZ A;  3NET A;  4J9H A;  1UJY A;  1JBM A;  2J6F A;  4FCY A;  2ZNI A;  2XI9 A;  4J83 A;  3RBB B;  4N0A C;  4PK4 A;  4BI3 A;  3EFS A;  1GBR A;  4TTV A;  2KVQ G;  3M0S A;  3OBW A;  3BJU A;  4H2Y A;  3MEW A;  4H2X A;  2DEU A;  4VUB A;  2DDZ A;  4N4G A;  1K73 C;  1E1T A;  2QEX A;  4X5O A;  12AS A;  2EVR A;  4LNP A;  2D1X A;  3VRZ A;  1GL5 A;  3TSZ A;  3E2U A;  1VQ8 Q;  2KXC A;  3HXW A;  4LD9 K;  4FYX B;  4AMC A;  1E1O A;  2DET A;  4HWO A;  2RPN A;  4L6V 5;  2ED0 A;  4HT4 A;  1U1T A;  2EJ9 A;  2DXC A;  1K0X A;  1GRI A;  5A0L A;  4RTZ A;  2ZNJ A;  1KC8 R;  1GFD A;  4XU2 A;  1B7T A;  2E5K A;  2NUP A;  1VQO T;  1C0M A;  1RAE B;  2JMC A;  2QAZ A;  4ESR A;  1K9M U;  1KMM A;  2DER A;  1M1K U;  9ATC B;  3I9Q A;  1IHV A;  1ABQ A;  4YRL A;  3CME A;  3EGD A;  2E64 A;  1KOG A;  2HQH A;  1AWJ A;  2KYB A;  3CC4 A;  1K8A C;  2ZTG A;  1VQ5 Q;  4CH3 A;  5CVI A;  4Z8A A;  5EC7 A;  4O2D A;  3A5Y A;  2GTO A;  3S3M A;  1C6V X;  4J5Y A;  3MP1 A;  2IY5 B;  4MZP A;  3URG A;  4K87 A;  2BZ8 A;  3I55 A;  2QEX Q;  3UT1 A;  4IUQ A;  1K9M C;  1X75 C;  3X26 B;  3TCJ A;  2FZK B;  2I2L A;  1WJS A;  1M1K C;  1Q86 U;  4CI0 C;  3MP8 A;  4M77 G;  3ZEH A;  3NEM A;  2B8A A;  1VQ9 T;  4JZ4 A;  2E5A A;  4BDZ A;  2C7I A;  1BKB A;  2E70 A;  4C8Q E;  4G85 A;  4HCC A;  2LX7 A;  4LDX A;  2M9U A;  2YXY A;  3EG9 A;  5IHK A;  4BE1 A;  3LGL A;  4J6W A;  5I2M A;  2X4X A;  1VQM T;  4F7U B;  1VIE A;  1ASZ A;  2I0N A;  3HFO A;  2VXE A;  1Q86 C;  2COZ A;  1EQR A;  4FT2 A;  1VQ9 Q;  1WJR A;  2OTL A;  4TVA A;  1BU1 A;  4OGE A;  1KG1 A;  4UC4 A;  1BI3 A;  2Y90 A;  4MZM A;  1MMD A;  2JVV A;  2K5L A;  4F17 A;  4C8Q D;  2KE9 A;  4M7D E;  1SG5 A;  1QVG A;  2CJ9 A;  2D0Q B;  2KSS A;  3LWI A;  2ROT A;  2RQR A;  2CSI A;  4RTW A;  2FG0 A;  1M3B A;  5IHN A;  1E22 A;  2L3S A;  5FU6 C;  1I8F A;  4LUD A;  1QVF A;  1TG0 A;  2A0F B;  2DU7 A;  4XEO A;  2HEQ A;  2YUQ A;  5I22 A;  2K5I A;  2CIM A;  4YRT A;  2PVO B;  4WTO B;  1PYS A;  4YCU A;  1O75 A;  2DXU A;  2IG0 A;  3HTR A;  1Q82 U;  4C92 A;  3OYH A;  2RQW A;  4E7I A;  1GFC A;  4M7D D;  3P8Y A;  4UP8 A;  4ZNX A;  2MI6 A;  3IKL A;  1X43 A;  2V1Q A;  3OYG A;  2EKH A;  4PJO G;  1BIB A;  2KRS A;  4UP7 A;  1FYN A;  2MWO A;  1J5W A;  2JMA A;  1Y0M A;  1YI2 Q;  4OML A;  1SER A;  2DRK A;  3M4G A;  2AT1 B;  1V76 A;  5IH2 A;  2C8M A;  3HFN A;  1QWE A;  3RUX A;  4TVY A;  1OPK A;  2KNB B;  1ACM B;  3X24 B;  3JCM J;  1R8O B;  1H8K A;  2JM9 A;  2HL3 A;  2MMP A;  3OYI A;  1FMK A;  1X56 A;  2RJF A;  2Q5I A;  4HWT A;  3Q1J A;  1N9W A;  1NPR A;  2GQV A;  3QKJ A;  4OB2 B;  4JLG A;  1QLY A;  2E5Q A;  2W10 A;  2PZ1 A;  4AT1 B;  4JPB W;  1N8R U;  2AKW A;  1UHC A;  3RER A;  4TWA A;  2DE0 X;  2O01 E;  1OZ2 A;  3CC2 A;  4J6X A;  3I56 A;  2DQ0 A;  1N6A A;  3HPW A;  2DZ9 A;  4Z02 A;  5AYF A;  3LW5 E;  2ZR3 A;  1EVK A;  2BE7 D;  2HZY A;  2VVK A;  4KUI A;  3RMS A;  4JRI A;  1H3Z A;  1WHM A;  2LP5 A;  3EHQ A;  4C92 F;  1NJI U;  4BDY A;  3JB9 I;  2X3X D;  2XMF A;  4KQE A;  3EGU A;  4CH5 A;  4II1 A;  1Y96 A;  1YHQ T;  2PTK A;  2QHT A;  2NUT B;  5A0G A;  2HQX A;  3OS2 A;  2FZC B;  1ZSZ A;  3JAM E;  1KQS S;  5IXF A;  1BK2 A;  3FLG A;  1VQ4 A;  5GAM d;  1N8R C;  2XKO C;  2QQB A;  1WXT A;  3DLM A;  2RHX A;  3L2R A;  1UGP B;  1G3T A;  1VUB A;  3MP6 A;  2ALY B;  4PJO A;  2COY A;  3G6E A;  5KYW A;  3GOX A;  3A8O B;  2YRC A;  2BZY A;  1WHK A;  1H64 1;  3M4Y A;  5CKE A;  2YUO A;  2ZIN A;  1NJI C;  2JS2 A;  5KE3 A;  4JDS A;  4TQF A;  3UH0 A;  1YJW T;  2DIG A;  4HVU A;  1YIT A;  3REB B;  1B70 B;  1ZUK A;  3JRZ A;  2OJ2 A;  1BI1 A;  3VRY A;  4ZGD B;  3V7S A;  1IB8 A;  2M0Y A;  3CC2 Q;  3I7F A;  4EO4 A;  3I56 Q;  3OMC A;  3NEL A;  3OS0 A;  1BCM A;  2XTI A;  1U1S A;  4C92 C;  5GAO q;  1WHL A;  1ZBX A;  1AWX A;  1IZ6 A;  1MMN A;  1RAI B;  5GMK e;  4XAX B;  4YRJ A;  1PCX A;  5L8R E;  3REA B;  3QWY A;  1Y57 A;  1NEB A;  3VJP A;  3L1A A;  1OEB A;  1VQN A;  2I4N A;  1XJW B;  1YJW Q;  2LC4 A;  3M4P A;  4ZTJ A;  4BW9 A;  4XTV A;  4AFS C;  5KYY B;  1HC7 A;  2SRC A;  1G3W A;  1D1C A;  5GMK l;  2CP6 A;  3SWN C;  3A32 A;  1LPL A;  1VQ4 Q;  1PC0 A;  3QJY A;  4HVC A;  4H2U A;  5GAM f;  3CCV T;  5J26 A;  2RO0 A;  1MMG A;  1NLP C;  4FYY B;  1KHC A;  4P72 A;  2EYW A;  1ZUY A;  5CKD A;  1OV3 A;  3G6E Q;  1PKS A;  4ORZ A;  1YFS A;  3REU A;  4IUU A;  1GXI E;  3H41 A;  2J6O A;  2FEI A;  4RTT A;  1KQS P;  2L5Q A;  4KR2 A;  2EIF A;  4L59 A;  3VV0 A;  4E51 A;  1YIT Q;  4OMM A;  4J7F A;  3TUP A;  2COW A;  1GCQ A;  2Y4Y A;  4AFQ C;  1V29 B;  4QT7 A;  1SKU B;  5IXB A;  2J7I A;  3HFV A;  4GBQ A;  4ANJ A;  3EH2 A;  4MZT A;  2HAX A;  4LVL A;  3QZ5 B;  2CUD A;  4YRS A;  2LX9 A;  3F70 A;  5GAM j;  3TU4 K;  3PE0 A;  1VQN Q;  2ZPB B;  6AT1 B;  3J80 E;  3SD4 A;  4DEY A;  2RHS B;  1ZSZ C;  2BUD A;  1IO6 A;  2G3R A;  1I0C A;  5DM7 R;  3A7A A;  1ZA1 B;  1YJ9 A;  1WYX A;  1PRM C;  4BUG A;  4CS2 A;  3E9F A;  4WCI A;  1NJ8 A;  5GAM g;  1RAF B;  4PFP A;  1FXX A;  1JRI A;  3CC7 T;  2R57 A;  3NHN A;  3G1Z A;  4OB0 B;  3WQZ A;  1N5Z A;  3FC3 A;  1JJ2 A;  2JOY A;  4NCX A;  2VAS A;  4AFZ C;  2FRY A;  1SF9 A;  4M78 A;  3FRN A;  5FU7 B;  2EQM A;  2H3E B;  4Q15 A;  3PZC A;  1B34 A;  2EPD A;  1UGS B;  1JXM A;  3CCM A;  1OX8 A;  4JLI A;  1AEY A;  4JJB A;  4YCW A;  3LX7 A;  3T9N A;  2ZPI B;  2RH2 A;  5D7U A;  3PCO B;  4P74 A;  4HWS A;  3CCJ A;  3ZFJ A;  2DNU A;  2K2V A;  3OSS C;  3QJ6 A;  1SET A;  1S72 T;  4XTZ A;  2LJ1 A;  5LL6 S;  2LQ8 A;  1Q7Y R;  2A37 A;  3HXV A;  2RD1 A;  1VYV A;  4Y91 A;  1P92 A;  1RI0 A;  4PLL A;  2D0N A;  2QTV A;  1A0N B;  3QZ9 B;  1MV3 A;  4R55 A;  1YJ9 Q;  4QQD A;  1SEM A;  3L4G B;  3LH5 A;  4NOY A;  4XU0 A;  4M7A A;  3CXC A;  4C8Q G;  5FWB A;  1K0S A;  4BWA A;  1EFN A;  1WHG A;  1Z9Z A;  3ICA A;  1BBW A;  2CT3 A;  1LOJ A;  3NFC A;  4LDY A;  3A31 A;  4FW1 A;  1E6H A;  2VYT A;  3C0C A;  4O5V A;  4J8O A;  3M5A A;  4J9I A;  1QCN A;  1K76 A;  3OYJ A;  1GCQ C;  4M78 F;  4WJ3 M;  1EZZ B;  1Q81 R;  1ZX6 A;  3CCM Q;  3QO5 A;  3OBY A;  4OMP A;  2QYZ A;  4H2W A;  5KE2 A;  3AT1 B;  3ZBD A;  3VU3 C;  3OA6 A;  2CP7 A;  4M7D G;  3CCL T;  4YRR A;  5GAM e;  3SEM A;  3FEO A;  1T3S A;  2JS0 A;  1TH7 A;  4PG3 A;  4D8K A;  2DKG A;  1RAA B;  1YJN Q;  2ARS A;  4RMO A;  3VQV A;  2VWF A;  4Y92 A;  3EFO B;  1NG2 A;  4M75 F;  1X2H A;  3H0I A;  1YCY A;  4F16 A;  3OYK A;  3L2V A;  4DOW A;  5I21 A;  1UUE A;  1K73 U;  2BZX A;  1H4S A;  1QVG S;  1EOV A;  3CCL Q;  2RK2 A;  4M7A F;  3PFS A;  3LWH A;  5CR2 A;  5ECA A;  1VQK T;  3WVE B;  1KIK A;  1YWO A;  2DL5 A;  1I4K 1;  4QQ6 A;  1QWF A;  2RQV A;  4PHC A;  4FYW B;  3RKX A;  2YWW A;  4M78 C;  4JUV A;  1VQ5 A;  4B9X A;  1OQK A;  4J9E A;  4PJN A;  4LDU A;  3EFR A;  1QVF S;  2WSE E;  3PMI A;  3JCM d;  3HP9 A;  1NJ1 A;  1FMW A;  4PNO A;  2L2P A;  1KD1 C;  2IY5 A;  8ATC B;  4DQ2 A;  1VQO A;  2EFI A;  4CC2 A;  1N9R A;  4OP0 A;  2KT8 A;  2QHU A;  4ZTZ B;  2HSE B;  1VQK Q;  2HSP A;  3QG1 A;  3IG2 A;  2CZ6 B;  5LJ5 f;  1OU9 A;  4XTW A;  1K8A U;  2A08 A;  4H02 A;  4M75 C;  1LVK A;  1AZG B;  3OYE A;  1OPL A;  2EYY A;  3GLX A;  5GAN 6;  3OYM A;  2PMF A;  3H0H A;  2QQA A;  3QWX X;  2I4M A;  3G4S T;  1Z7M A;  4DPG A;  3GPL A;  2QXF A;  2IIM A;  2XDB A;  1ADJ A;  4XTX A;  2EW3 A;  4M7A C;  2GNC A;  3CCR T;  3VKI A;  1X6B A;  3OYF A;  4H2V A;  1YP5 A;  4HVV A;  4F7U A;  2PUK B;  2RI2 A;  4M4Z A;  1YCS B;  4YRN A;  5HK0 A;  4CH4 A;  2G6F X;  3QNE A;  4A53 A;  1NNH A;  5ELN A;  2CRE A;  2EQJ A;  3L2Q A;  2X3W D;  1SHF A;  3G1J A;  1NPP A;  3GBQ A;  3PNW C;  3KFU A;  1YN8 A;  2V8J A;  5LJ5 j;  3G4S Q;  1VQ9 A;  2E12 A;  5CQX A;  3QSU A;  4FT4 A;  2J6K A;  3OYC A;  3BE3 A;  3JCM f;  4C8Q B;  1W2B A;  1M90 R;  3OYA A;  2YRD A;  1QVG P;  4IIO A;  5KH6 A;  4K86 A;  1VQO Q;  3CCU T;  5KYX B;  1SHG A;  1HSQ A;  1JXO A;  2VKN A;  2XK0 A;  3RGL A;  3VQY A;  2LDM A;  3JB9 D;  5LJ5 g;  2ARU A;  2FVU A;  4J7I A;  2HKQ B;  2DBK A;  4Z88 A;  2RMO A;  2IVW A;  2LMJ A;  3VQX A;  1G5H A;  5CQY A;  4OF1 A;  3CCS T;  2QDY B;  3A98 A;  3TEH B;  4F14 A;  3HXX A;  2LCL A;  2YUN A;  1NYG A;  2ODR C;  4AG2 C;  4YDQ A;  3V8L A;  3HKS A;  2K3Y A;  1W66 A;  4M7D B;  1QVP A;  2C0T A;  4K88 A;  2RM4 A;  5GAO r;  3ME9 A;  1M8V A;  1BBZ A;  1UEC A;  3PVQ A;  1UGQ B;  4F7U F;  3A8M B;  1UE9 A;  3THK A;  5IN1 A;  5GAO l;  2DPP B;  3M4Q A;  3S3N A;  2RI5 A;  5FU6 B;  1WIE A;  1YI2 A;  2KAF A;  1K9A A;  3JCM g;  1MV0 B;  1MUZ A;  3J7A F;  3TSW A;  5GAM h;  2DJQ A;  2NUP B;  3PVL A;  3OW2 A;  4OMQ A;  3OS1 A;  2NUZ A;  2PUO B;  3VYG A;  2EQU A;  2QGG A;  1VQM Q;  3E19 A;  3VS3 A;  1X54 A;  4D8D A;  1E24 A;  5GAN 7;  3EGX B;  2ATC B;  2ZT6 A;  4RCC A;  4R56 A;  3SFM A;  2H3J A;  2DLP A;  3CMA T;  4TQD A;  3R6O A;  3CCE T;  5E3I A;  2LRQ A;  2E65 A;  4IKF A;  2WSC E;  4RKU E;  3L2Z A;  2FL7 A;  2A3L A;  2L3P A;  4PJL A;  1GBQ A;  5FLX E;  2L3Q A;  2ZZF A;  1H92 A;  2O9S A;  4CRI A;  2EQI A;  4BY6 C;  4AH6 A;  4C5I A;  2X35 A;  1G83 A;  3OS5 A;  4P3N A;  3A5Z B;  1Y07 A;  2V26 A;  5GMK j;  4C5G A;  1UG1 A;  3NPF A;  3CCQ T;  2Z0W A;  5K1X A;  4M77 A;  2NUT A;  4BB7 A;  1TU0 B;  4CS4 A;  3V8J A;  3CCE Q;  2ZPG B;  2YSQ A;  4DA4 A;  5J39 A;  2X9H A;  2CP3 A;  2ZPH B;  5LJ5 e;  2D6F A;  3GNG A;  3FIF A;  1HJD A;  4PL6 A;  1UB4 A;  1UGV A;  2HCK A;  2CZ7 B;  1W6X A;  3PIO A;  5C52 B;  1Q7Y C;  2ALY A;  2DIL A;  1XQH A;  1BI0 A;  1AWW A;  3JCM P;  3CCQ Q;  2ZT7 A;  3DB3 A;  4YRQ A;  2JT4 A;  1AZE A;  1ZHI A;  2VXF A;  2XD0 A;  1QMC A;  1SRL A;  1ZBJ A;  1PRL C;  3VS7 A;  4XK8 E;  1B70 A;  1Y7X A;  3JB9 H;  1T3L A;  2RF0 A;  2AKK A;  3RDV A;  4CS3 A;  2KMT A;  5C51 B;  2DTO A;  5CIU A;  4PJM A;  1VQL T;  2DVJ A;  5F5W A;  3LYI A;  1WZO A;  2MAM A;  1ZA2 B;  5HCK A;  1OI1 A;  2WAC A;  5KNN A;  3VS1 A;  2J3L A;  1JJ2 S;  3OYD A;  2GCX A;  4ZIB A;  3REX A;  1IRE B;  1EX4 A;  4MMK A;  3JCM e;  4LD6 A;  2P5I A;  3UGQ A;  1EFW A;  3QII A;  3TEE A;  2CJB A;  2DL8 A;  5KYY A;  1YJW A;  1Q81 C;  1WQW A;  2YDL A;  2GQI A;  4LXC A;  5KCH A;  1QW1 A;  4M77 F;  1VQP T;  3MJX A;  1VQL Q;  4P75 A;  3L2W A;  2HL5 C;  4RG2 A;  4WF2 A;  1NYF A;  4KUL A;  1UEB A;  3MEU A;  2FHD A;  1H3H A;  3MF2 A;  1KFZ A;  4C92 B;  2FO0 A;  2EKO A;  2W0Z A;  1TOV A;  4E7L A;  2EYQ A;  3DB4 A;  4YRG A;  2ZZE A;  3HL8 A;  4B6M A;  4PFO A;  1U3O A;  4B9W A;  2HDA A;  2FZG B;  2DQ3 A;  2K57 A;  4C5H A;  5GAN e;  1YHQ Q;  1TTH B;  1OU8 A;  4ZGE B;  3OYN A;  3UPU A;  2JZ2 A;  4Y28 E;  1H4V B;  2X4J A;  4YRI A;  2A8E A;  3SWN B;  4E6R A;  1HK9 A;  1ADY A;  1ATI A;  1VYT A;  4YRC A;  5FWC A;  3HRS A;  3CXC S;  1D3B B;  4EX5 A;  4EIK A;  2Q7G A;  1S1N A;  4HKE A;  1B8A A;  4C92 E;  2KQW A;  2EGA A;  3HY0 A;  4DOV A;  3HY1 A;  1J3T A;  1AWO A;  4AFU C;  1D0X A;  4IUR A;  2KK4 A;  4RQE A;  3P8B B;  1ABO A;  5KYU B;  4M77 C;  3O5Z A;  5DY9 A;  5IT9 E;  3A8H B;  4CC4 B;  2RHS A;  1KC8 U;  1N27 A;  2RQU A;  2AKW B;  2QQR A;  5GJV B;  1UHF A;  4DBR A;  3HXZ A;  2KDS A;  5D6X A;  3J81 E;  4CH6 A;  2O2O A;  1TXQ A;  4G84 A;  4DBH A;  2F69 A;  5I2S A;  2NS6 A;  3QHS A;  1QQJ A;  4N4I A;  1MND A;  4P73 A;  1KHI A;  4C92 D;  1X2K A;  2OX7 A;  5GMK m;  4QQG A;  4E7H A;  1WXU A;  3HFZ B;  3A8L B;  1TWB A;  2DYI A;  3QYG B;  5C0M A;  1K9M R;  1HXD A;  4PJO F;  3QUI A;  1U06 A;  4HT8 A;  3CEY A;  1M1K R;  1TUD A;  1Z9Q A;  2P4T A;  1RLQ C;  2ZR2 A;  1PKT A;  3C12 A;  3MHX A;  1KC8 C;  1BYM A;  4RTX A;  4IUV A;  1HTT A;  1X2Q A;  1X6G A;  3P8D A;  2ZGW A;  4KGV B;  3CCV Q;  1GCP A;  2Q5H A;  4E47 A;  2QA4 T;  2XG8 D;  3PCO A;  3ZL7 C;  5DLO A;  3CD6 T;  1IGU A;  1B07 A;  3NGP A;  3A74 A;  5CKB A;  4P3P A;  1M3A A;  3M0T A;  1KQ2 A;  1YGB A;  2EL9 A;  5LJ5 h;  1VYU A;  4E7J A;  1NM7 A;  2QTX A;  4J9C A;  1Q95 G;  2QQ9 A;  1M5Q 1;  1MHN A;  1PD1 A;  1RAD B;  3I5R A;  3VQW A;  3L4G A;  2DD4 A;  1WPY A;  3P8V A;  1Q86 R;  1NJ2 A;  2M51 A;  1PWT A;  3X28 B;  4A63 B;  4H2T A;  3L2U A;  4FM4 B;  4YRF A;  1M3C A;  2RHQ B;  1TSF A;  1FYF A;  2K9G A;  2ESW A;  2A36 A;  4OMF B;  1YIJ T;  2CP5 A;  4J9B A;  1D09 B;  4FYV B;  5J3B A;  1QF6 A;  2JUF A;  4X9C A;  5A2Q E;  2RHU A;  3JB9 G;  1S72 A;  2BTT A;  2JTM A;  2CDT A;  1VQ7 T;  2KI7 A;  4PJO C;  2ZPF B;  3WXM B;  3OYY A;  2PVD B;  1M1G A;  1QP2 A;  2M0O A;  3M57 A;  2VV5 A;  4RTY A;  1G51 A;  2AMC A;  2ZXF A;  4P5N A;  2C0O A;  1M27 C;  3JCM h;  5C53 B;  4FW2 A;  3CC7 Q;  2V8K A;  4EMK B;  3PIP A;  3RR6 A;  4KT0 E;  1AOJ A;  1VOM A;  2JJ9 A;  3TQ7 P;  2WSF E;  3I5S A;  3OY9 A;  1JU5 C;  2OTJ T;  1SSH A;  1AHJ B;  1NZ9 A;  3LSS A;  3PMT A;  3JCM X;  2PU9 B;  2DL3 A;  4Q5W A;  2A7Y A;  5HK3 A;  2KR3 A;  3EFO A;  1ASY A;  1RI9 A;  1YJN A;  4DBQ A;  3G71 T;  5A0D A;  4OB1 B;  1SRY A;  4NL2 A;  1W2B S;  5L23 A;  2LCS A;  1VQZ A;  2JM8 A;  3SHW A;  4EDU A;  4Q6G A;  2JTE A;  2ZIM A;  5HKC A;  3RF1 A;  1E7O A;  1YNZ A;  1QKX A;  3X25 B;  3CCL A;  2RJC A;  1G3Y A;  3S3O A;  1PM3 A;  2CP0 A;  4P72 C;  2OTJ Q;  2DD5 A;  2E4H A;  1S72 Q;  2CYZ B;  1EIY A;  2KXD A;  3QDR B;  1Q82 R;  2H8H A;  3NMZ C;  4DBF A;  1CKA A;  3EG0 A;  3RKW A;  3G71 Q;  1QP3 A;  2CH4 A;  2RN8 A;  2BIV A;  2O4X B;  3C94 A;  4PLI A;  2DBM A;  2P84 A;  2V1R A;  3UA7 A;  5GMK h;  2DF6 A;  4HT9 A;  3PTA A;  1KMN A;  4E7Z A;  4KH0 B;  1RIQ A;  4WJ4 A;  3QPH A;  1VQK A;  2DM1 A;  2LTO A;  5LJ5 d;  1LJO A;  1NBE B;  4XEM A;  2JTF A;  4QW2 A;  2BKD N;  1I81 A;  4E7K A;  4YP0 A;  2VUB A;  2QAS A;  2DK3 A;  1B34 B;  5CKH A;  1OOT A;  2F2V A;  3NTH A;  3L42 A;  1O9S A;  1KD1 U;  2XU8 A;  1IXD A;  1MNE A;  1R0C B;  3UWN A;  4BE2 A;  4A4F A;  3OW2 S;  3FB9 A;  1N8R R;  5GJW B;  2DJZ A;  4HCB A;  1VQ6 T;  4HWR A;  1I5O B;  2KT1 A;  1JJC B;  4J15 A;  2CJA A;  4C0D C;  1UTI A;  1NEG A;  4O6J A;  1WXB A;  3JSC A;  3N5B B;  2E3I A;  3VS2 A;  4M75 B;  4NS5 A;  2K2M A;  3SB2 A;  1WFW A;  5LJ3 j;  2L0A A;  3OD1 A;  2R58 A;  4YYE A;  1M4Z A;  4M78 E;  1NJI R;  3HRT A;  4BD3 A;  3G4S A;  2YT6 A;  3R6N A;  4IUP A;  4C8Q A;  3MPU B;  5I11 A;  4IUT A;  4M7A B;  2E6N A;  3A8G B;  3OB9 A;  2L89 A;  3QBY A;  4K11 A;  5GMK i;  5KYX A;  5GAN 3;  2CUB A;  2K4Y A;  2MWP A;  1BB9 A;  3H8Z A;  4P74 C;  2LNH B;  2QK0 A;  4XQ3 A;  5CKF A;  1VQ8 T;  5M9O A;  3VUZ A;  1NLO C;  1PSE A;  4CC3 A;  4L87 A;  1C0A A;  1E6G A;  4M75 E;  3TEH A;  4HXJ A;  2FPF A;  1IL2 A;  3BFM A;  4M78 D;  1FMV A;  2RQT A;  2AK5 A;  4ME7 A;  5GAN 5;  1L0W A;  2HNI A;  4OVA A;  5GAN d;  4KGX B;  4EMH A;  4M7D A;  4M7A E;  3CCU A;  2NLU A;  1LYL A;  2CZ0 B;  1UDL A;  4RTV A;  3W3S A;  1PD0 A;  4X1V A;  4UP9 A;  4OB3 B;  1G2B A;  1B7Y B;  2RJD A;  3U23 A;  1WYD A;  5FRO A;  4C0F A;  3ASK A;  4JS5 A;  1VQ5 T;  2P0L A;  3CCS A;  1G5V A;  1TUC A;  4M75 D;  3LGF A;  4JRQ A;  4BAC A;  3OW2 P;  4MDX A;  1PG5 B;  2FPD A;  5KCO A;  2R5A A;  2DVE A;  4YTL A;  3CCR Q;  4M7A D;  1M2V B;  4C8Q F;  2QEX T;  5CCA A;  1RAH B;  5CK9 A;  3EGX A;  2FYK A;  1VQM A;  4WI1 A;  3TRE A;  3MQZ A;  3HSB A;  4A54 A;  2KY9 A;  3CPW A;  1AD5 A;  3AHU A;  2P0K A;  3WVD B;  2RJE A;  1QVF P;  1FX7 A;  4E7S A;  2DYB A;  1B76 A;  2AKL A;  4KRT A;  1TS9 A;  1AVZ C;  2IPO B;  3QO7 A;  1WDX A;  4H2X B;  4YRK A;  2C06 A;  5GAN f;  2F5K A;  4C92 G;  3CCU Q;  3A5Z A;  2CSQ A;  3E9G A;  4M7D F;  1X2G A;  2YLB A;  3UA6 A;  3CME T;  2RHY A;  4J9F A;  2LJ3 A;  4RMF A;  3A1P A;  7AT1 B;  2EAY A;  4DEX A;  3CC4 T;  3TVT A;  2EGC A;  3CMA A;  2LCC A;  3C4S A;  5LJ3 e;  3CCE A;  3CCS Q;  3OYL A;  2KRO A;  5IAY A;  1FWZ A;  3RL6 A;  1CSK A;  2QHS A;  4LVM A;  3LSQ A;  4LVJ A;  3PT9 A;  1H4T A;  2LT4 A;  5EG2 A;  2X51 A;  1CKB A;  4C8Q C;  2ODR D;  1V1C A;  2HKN A;  2D8H A;  2DFU A;  1M9S A;  4LVK A;  4BY6 B;  3UGT A;  3HTZ A;  3RNJ A;  2CH4 W;  5GAO m;  3I55 T;  1Z7N A;  1SES A;  1OYX A;  1G8X A;  3CMQ A;  3CME Q;  3R07 A;  5FW9 A;  4EMG A;  3CCQ A;  1NJ5 A;  3UDC A;  4YCV A;  3EGD B;  3CC4 Q;  2GGR A;  5GAN j;  1IGQ A;  1OUL A;  3CBM A;  1JQQ A;  1W70 A;  1SPK A;  4N4H A;  5AT1 B;  2FPE A;  3LH0 A;  1UJ0 A;  4QVZ A;  2MK5 A;  3KUF A;  2EQK A;  2XDP A;  4NL3 A;  2J06 A;  4ELZ C;  1YFN A;  1Q7Y U;  1C1A A;  5GAN g;  2E10 A;  3HRU A;  3MEY A;  4JZ3 A;  2QG9 B;  2YHT A;  3I55 Q;  1HYO A;  4M7D C;  5GAN 2;  2MOX A;  2GF7 A;  4AG1 C;  2RK1 A;  4ZN1 A;  4LDV A;  5GAN 4;  1JO8 A;  4F7U E;  4KBM B;  1XTD A;  2RNA A;  3QDF A;  4ELY C;  2HD0 A;  1TUG B;  2P0P A;  1SRM A;  3BW1 A;  1MMA A;  3JV3 A;  2D8J A;  3CMA Q;  2ZCF B;  1YI2 T;  4KGZ B;  4LNS A;  1X55 A;  4JS4 A;  2ZAE A;  1N9S A;  2OTL T;  2GFA A;  5D6W A;  3SDZ A;  1VQL A;  1R0B G;  2HBW A;  3RKY A;  4HVW A;  3QXE B;  1U8R A;  1BI2 A;  2CGH A;  2XGT A;  2XHC A;  1PSF A;  1B3Q A;  3NEN A;  3EG3 A;  2QHV A;  3LLR A;  2AIR B;  3EG9 B;  1X27 A;  4MDW A;  1NJ6 A;  4V2S A;  2EWN A;  2DU5 A;  2PME A;  4C0G A;  2L3R A;  2I4O A;  2E41 A;  3M56 A;  1Q81 U;  1YHQ A;  2E6Z A;  2DIQ A;  2E3H A;  3D7S B;  4R0K A;  3SWN A;  1VQP A;  2J3M A;  2OTL Q;  1WI7 A;  4ATO A;  2Y4X A;  2DL7 A;  2QQS A;  1IHW A;  1WHH A;  1D3B A;  4TVA B;  4RG8 A;  1WX6 A;  4E2F B;  2ZT5 A;  4HA8 A;  3HXY A;  1WJQ A;  5CO7 A;  2YLC A;  1Q82 C;  3ULR B;  2DXT A;  2LQK A;  2A28 A;  3CBP A;  4FIB A;  4LVI A;  4FU6 A;  1JEG A;  3P8H A;  1SSF A;  2DAQ A;  5KYU A;  3KFV A;  5FRM A;  5D6Y A;  2E3C A;  1VIF A;  2DTI A;  1R77 A;  3DLL A;  3BDU A;  3X20 B;  4OMO A;  2DTH A;  1D0Z A;  1AT1 B;  2K79 A;  1F1B B;  3QYH B;  2MCN A;  1KK7 A;  4BE0 A;  2YRV A;  4BI8 B;  2DO3 A;  4YRP A;  2EGE A;  2CZ1 B;  3VS0 A;  3VUB A;  1Y71 A;  1PYS B;  1WLP B;  2JNG A;  3EG2 A;  3JCM c;  3KBG A;  1KD1 R;  1G3S A;  2MPX C;  4YRE A;  2EJG A;  1YB3 A;  1WHJ A;  4ZGJ B;  3HFZ A;  4P3O A;  1K73 R;  2QGF B;  4M77 B;  4X34 A;  2Q7H A;  3BY7 A;  2KEA A;  2CP2 A;  4KUD K;  3M0R A;  1D1B A;  1ARK A;  2OAU A;  3H9N A;  1VQP Q;  2F5T X;  1QE0 A;  3KXT A;  2EYZ A;  3CC2 T;  3I56 T;  1KQ1 A;  3CPF A;  4TVW A;  3MO8 A;  3CCV A;  2RA2 A;  1LCK A;  1G5I A;  1X69 A;  1YFT A;  3A7U A;  1JB0 E;  1BBU A;  2VGM A;  3I35 A;  3JCM b;  1ZQ1 A;  2E1H A;  3O8V A;  5LJ3 h;  2J05 A;  4P71 A;  2KBT A;  3QTC A;  2LQN A;  4QKU A;  1D1A A;  2ZIO A;  5GAO p;  2B86 A;  2CKK A;  2KRM A;  3M59 A;  5DLQ E;  4RDX A;  3LC0 A;  2K7A A;  4M77 E;  3V7R A;  3FJ5 A;  3P8T A;  1PNJ A;  2AZV A;  2DX1 A;  4JJN K;  3RIR A;  3E1S A;  2NWM A;  4X9D A;  2ECZ A;  2F1L A;  2PQW A;  3BDL A;  1VQ4 T;  1K8A R;  2RHQ A;  5ELO A;  4HCZ A;  2LVM A;  3ERR A;  2JW4 A;  3IAL A;  2QA4 A;  2X4W A;  2EJF A;  2XID A;  4MML A;  3CD6 A;  1VA7 A;  1WQ7 A;  3MEA A;  2HMA A;  1JJ2 P;  3ER0 A;  2ZCE A;  3G6E T;  3H0F A;  1NYR A;  3HHT B;  2X4Y A;  3G7Z A;  1WNL A;  4LN2 A;  1OZ3 A;  2HQE A;  2GTJ A;  1I5L A;  4GLK A;  3UFG A;  1Y96 B;  2V8I A;  1M90 U;  3VS5 A;  4M77 D;  2LQW A;  4ZTF A;  1WU7 A;  3M53 A;  5K1P A;  1YIT T;  1ZSZ B;  4M78 G;  4RUG A;  3DSQ A;  4XTU A;  3V8K A;  3TEG A;  4PJJ A;  2GFU A;  4XTY A;  1IRX A;  3RMQ A;  4L5G A;  2LT1 A;  2Q7E A;  4EMK A;  1YIJ A;  2K5F A;  1D0Y A;  2ZZD A;  3CC7 A;  2ENM A;  2LZ6 B;  2XIC A;  4PFZ A;  1RLP C;  3M55 A;  1WA7 A;  1RL2 A;  3VS4 A;  4PJO B;  1VQ7 A;  1ZUU A;  1X01 A;  5KYW B;  4LUE A;  3JCM Q;  2R5M A;  2O88 A;  1I1J A;  1VQN T;  5C6S A;  1XOV A;  2ABL A;  2HBP A;  3FDR A;  4M75 G;  4YPF A;  3MCA B;  1M90 C;  3UF4 A;  3EAE A;  3RES A;  1RAC B;  1YFR A;  8AT1 B;  3CXC P;  2M02 A;  4OGC A;  1M1F A;  1RAB B;  4P75 C;  1KJW A;  1QKW A;  5CAI A;  4M7A G;  1M30 A;  3OMG A;  3PGG A;  2QA4 Q;  3EHR A;  1M8M A;  2FB7 A;  4KR3 A;  3CD6 Q;  1QCO A;  4JJD A;  3OYB A;  11AS A;  2RI3 A;  3M0P A;  3HRK A;  3VYH B;  2VGN A;  1T0H A;  1U5S A;  2OTJ A;  2D9T A;  1HD3 A;  4PJO E;  1K4U S;  4XU1 A;  1BCO A;  3NTI A;  4J9D A;  2OAW A;  2LJ0 A;  1LNX A;  4RTU A;  1RAG B;  3QO8 A;  3IQL A;  2FRW A;  3JB9 J;  2L8D A;  4FL6 A;  2O4X A;  1XNI A;  3G71 A;  4C0Z A;  2P4R A;  1K1Z A;  5IHI A;  4C5E A;  5KYN A;  5GAN 8;  4A4G A;  1YIJ Q;  3M9Q A;  2XDD A;  1BIA A;  4TVR A;  2RHZ A;  5LJ3 d;  1USY A;  2YUP A;  2ZZG A;  2DXB A;  1T0J A;  1VQ7 Q;  2DMO A;  4P71 C;  1ZLM A;  1WGS A;  4IIM A;  4PJO D;  4ZN3 A;  2PNI A;  3DKM A;  3GNF B; 
#chains in the Genus database with same CATH homology
 3VBB A;  1WLE A;  4N0A A;  1KQS A;  2ART A;  4GY5 A;  1YJ9 T;  2K3X A;  3CBO A;  1MGQ A;  2DEQ A;  3MET A;  2MF2 A;  4A4K A;  5GAN h;  1YBY A;  1JJC A;  3S6W A;  3GIB A;  3H6Z A;  1UGR B;  4P73 C;  5GAO n;  4M75 A;  2QI2 A;  4LDW A;  3A7R A;  3CPW S;  1NYQ A;  5HGQ A;  3MF1 A;  3GF5 A;  5FU7 C;  3E9I A;  1X6O A;  5FRN A;  4J6Y A;  4RQF A;  3OSV A;  3E9H A;  3CCM T;  1EIF A;  3QO3 A;  3C95 A;  4EMK C;  1EVL A;  3M58 A;  3GP8 A;  1VQ6 A;  3CCJ T;  4C0D B;  4UPA A;  4HWP A;  4YRM A;  2AHJ B;  4PKC C;  2M16 A;  4QVC A;  5LJ3 f;  2G4C A;  2VC8 A;  2LNV A;  2P0Q A;  4XU3 A;  1YJN T;  4A4E A;  4M78 B;  2RHI A;  2I4L A;  2AMC B;  3JCM W;  4BI4 A;  3M54 A;  4QVD A;  1H4Q A;  2PVG B;  3NTK A;  2RB6 A;  3JCM V;  4JRK A;  1DJ7 B;  2ZPE B;  1VQ8 A;  3OQ5 A;  4F7U G;  1B7Y A;  4JRP A;  3HRI A;  4RCB A;  1GGM A;  3RAC A;  2CS7 A;  3V7C A;  3IKM B;  2ZT8 A;  1NE8 A;  2DZC A;  4H2S A;  2JN0 A;  1W4S A;  2M1H A;  3HXU A;  5HY6 A;  3MEV A;  4D6W A;  3FJP A;  4A4H A;  4FSX A;  3CCR A;  5LJ3 g;  1USY C;  4YRO A;  4OLF A;  1EIY B;  4EPC A;  3JB9 F;  4ZTU B;  3NET A;  3INZ A;  1JBM A;  2ZNI A;  2XI9 A;  4J83 A;  4N0A C;  4BI3 A;  3EFS A;  4TTV A;  2KVQ G;  3OBW A;  3BJU A;  4H2Y A;  3MEW A;  4H2X A;  4VUB A;  2DDZ A;  4N4G A;  1K73 C;  1E1T A;  2QEX A;  4X5O A;  12AS A;  3HXW A;  4LD9 K;  1E1O A;  4HWO A;  4L6V 5;  4HT4 A;  1U1T A;  2EJ9 A;  2DXC A;  5A0L A;  2ZNJ A;  4XU2 A;  1VQO T;  1K9M U;  1KMM A;  1M1K U;  4YRL A;  3CME A;  2E64 A;  1KOG A;  3CC4 A;  1K8A C;  2ZTG A;  4CH3 A;  5CVI A;  4O2D A;  3A5Y A;  3S3M A;  4J5Y A;  3MP1 A;  2IY5 B;  4MZP A;  3URG A;  4K87 A;  3I55 A;  3UT1 A;  4IUQ A;  1K9M C;  1X75 C;  3X26 B;  3TCJ A;  2I2L A;  1WJS A;  1M1K C;  1Q86 U;  4CI0 C;  3MP8 A;  4M77 G;  3ZEH A;  3NEM A;  2B8A A;  1VQ9 T;  2E5A A;  4BDZ A;  2C7I A;  1BKB A;  2E70 A;  4C8Q E;  4G85 A;  4HCC A;  4LDX A;  2M9U A;  4BE1 A;  3LGL A;  4J6W A;  5I2M A;  2X4X A;  1VQM T;  4F7U B;  1VIE A;  1ASZ A;  3HFO A;  2VXE A;  1Q86 C;  1EQR A;  4FT2 A;  1WJR A;  2OTL A;  4TVA A;  4OGE A;  1KG1 A;  4UC4 A;  1BI3 A;  2Y90 A;  4MZM A;  2JVV A;  2K5L A;  4C8Q D;  4M7D E;  1QVG A;  2CJ9 A;  2D0Q B;  2KSS A;  3LWI A;  1E22 A;  5FU6 C;  1I8F A;  1QVF A;  2DU7 A;  4XEO A;  2CIM A;  2K5I A;  4YRT A;  2PVO B;  1PYS A;  4YCU A;  1O75 A;  2DXU A;  2IG0 A;  1Q82 U;  4C92 A;  3OYH A;  4E7I A;  4M7D D;  3P8Y A;  4UP8 A;  2MI6 A;  3IKL A;  3OYG A;  4PJO G;  1BIB A;  4UP7 A;  2MWO A;  1J5W A;  1SER A;  3M4G A;  2C8M A;  3HFN A;  3RUX A;  4TVY A;  3X24 B;  3JCM J;  1R8O B;  2MMP A;  3OYI A;  1X56 A;  2RJF A;  2Q5I A;  4HWT A;  3Q1J A;  1N9W A;  1NPR A;  2GQV A;  3QKJ A;  4JLG A;  4OB2 B;  2E5Q A;  1N8R U;  2AKW A;  3RER A;  4TWA A;  2O01 E;  1OZ2 A;  3CC2 A;  4J6X A;  3I56 A;  2DQ0 A;  1N6A A;  3HPW A;  2DZ9 A;  4Z02 A;  5AYF A;  3LW5 E;  2ZR3 A;  1EVK A;  4KUI A;  3RMS A;  4JRI A;  1H3Z A;  4C92 F;  1NJI U;  4BDY A;  3JB9 I;  4CH5 A;  4KQE A;  4II1 A;  1Y96 A;  1YHQ T;  2QHT A;  5A0G A;  2HQX A;  3OS2 A;  3JAM E;  1KQS S;  3FLG A;  1VQ4 A;  5GAM d;  1N8R C;  2XKO C;  2QQB A;  3DLM A;  2RHX A;  3L2R A;  1UGP B;  1G3T A;  1VUB A;  3MP6 A;  2ALY B;  4PJO A;  3G6E A;  3GOX A;  3A8O B;  1H64 1;  3M4Y A;  5CKE A;  2ZIN A;  1NJI C;  5KE3 A;  4TQF A;  4JDS A;  3UH0 A;  1YJW T;  2DIG A;  1YIT A;  1B70 B;  3JRZ A;  1BI1 A;  4ZGD B;  3V7S A;  3I7F A;  4EO4 A;  3OMC A;  3NEL A;  3OS0 A;  2XTI A;  1U1S A;  4C92 C;  5GAO q;  1ZBX A;  1IZ6 A;  5GMK e;  4XAX B;  4YRJ A;  5L8R E;  3VJP A;  3L1A A;  1VQN A;  2I4N A;  2LC4 A;  3M4P A;  4ZTJ A;  4BW9 A;  4XTV A;  1HC7 A;  1G3W A;  5GMK l;  3SWN C;  3A32 A;  3QJY A;  4HVC A;  4H2U A;  5GAM f;  3CCV T;  5J26 A;  2RO0 A;  1KHC A;  4P72 A;  5CKD A;  1YFS A;  3REU A;  4IUU A;  1GXI E;  2L5Q A;  4KR2 A;  2EIF A;  4L59 A;  3VV0 A;  4E51 A;  4J7F A;  3TUP A;  2Y4Y A;  1V29 B;  3HFV A;  4MZT A;  2HAX A;  4LVL A;  3QZ5 B;  4YRS A;  2LX9 A;  3F70 A;  5GAM j;  3TU4 K;  2ZPB B;  3J80 E;  3SD4 A;  2RHS B;  2BUD A;  2G3R A;  3A7A A;  5DM7 R;  1YJ9 A;  4BUG A;  4CS2 A;  3E9F A;  1NJ8 A;  5GAM g;  1FXX A;  1JRI A;  3CC7 T;  2R57 A;  3G1Z A;  4OB0 B;  3WQZ A;  3FC3 A;  1JJ2 A;  2JOY A;  4NCX A;  4M78 A;  3FRN A;  5FU7 B;  2EQM A;  4Q15 A;  3PZC A;  1B34 A;  1UGS B;  3CCM A;  4JLI A;  4YCW A;  3LX7 A;  3T9N A;  2ZPI B;  2RH2 A;  4P74 A;  3PCO B;  4HWS A;  3CCJ A;  3ZFJ A;  2K2V A;  3QJ6 A;  3OSS C;  1SET A;  1S72 T;  4XTZ A;  5LL6 S;  2LQ8 A;  3HXV A;  2RD1 A;  4Y91 A;  1P92 A;  1RI0 A;  4PLL A;  3QZ9 B;  4R55 A;  4QQD A;  3L4G B;  4NOY A;  4XU0 A;  4M7A A;  3CXC A;  4C8Q G;  4BWA A;  3ICA A;  1BBW A;  1LOJ A;  3NFC A;  4LDY A;  3A31 A;  2VYT A;  4O5V A;  4J8O A;  3M5A A;  3OYJ A;  4M78 F;  4WJ3 M;  3QO5 A;  3OBY A;  4H2W A;  5KE2 A;  3ZBD A;  3VU3 C;  3OA6 A;  4M7D G;  3CCL T;  4YRR A;  5GAM e;  3FEO A;  1TH7 A;  4PG3 A;  2DKG A;  2ARS A;  4RMO A;  3VQV A;  4M75 F;  1X2H A;  1YCY A;  3OYK A;  3L2V A;  4DOW A;  5I21 A;  1K73 U;  1H4S A;  1QVG S;  1EOV A;  2RK2 A;  4M7A F;  3PFS A;  3LWH A;  5CR2 A;  1VQK T;  3WVE B;  1I4K 1;  4QQ6 A;  4PHC A;  3RKX A;  4M78 C;  4JUV A;  1VQ5 A;  4B9X A;  4LDU A;  3EFR A;  1QVF S;  2WSE E;  3PMI A;  3JCM d;  3HP9 A;  1NJ1 A;  4PNO A;  1KD1 C;  2IY5 A;  4DQ2 A;  1VQO A;  2EFI A;  1N9R A;  4OP0 A;  2QHU A;  4ZTZ B;  3IG2 A;  3QG1 A;  2CZ6 B;  5LJ5 f;  4XTW A;  1K8A U;  4H02 A;  4M75 C;  3OYE A;  3GLX A;  5GAN 6;  3OYM A;  2PMF A;  2QQA A;  2I4M A;  3G4S T;  1Z7M A;  4DPG A;  3GPL A;  2QXF A;  2XDB A;  1ADJ A;  4XTX A;  4M7A C;  3CCR T;  3VKI A;  3OYF A;  4H2V A;  4F7U A;  2PUK B;  2RI2 A;  4YRN A;  5HK0 A;  4CH4 A;  3QNE A;  4A53 A;  1NNH A;  5ELN A;  2EQJ A;  3L2Q A;  1NPP A;  3PNW C;  3KFU A;  2V8J A;  5LJ5 j;  1VQ9 A;  2E12 A;  5CQX A;  3QSU A;  4FT4 A;  3OYC A;  3JCM f;  4C8Q B;  1W2B A;  3OYA A;  5KH6 A;  4K86 A;  3CCU T;  2XK0 A;  3RGL A;  3VQY A;  2LDM A;  3JB9 D;  5LJ5 g;  2ARU A;  2FVU A;  4J7I A;  2IVW A;  3VQX A;  1G5H A;  5CQY A;  4OF1 A;  3CCS T;  2QDY B;  3TEH B;  3HXX A;  2LCL A;  2ODR C;  4YDQ A;  3V8L A;  3HKS A;  2K3Y A;  1W66 A;  4M7D B;  1QVP A;  4K88 A;  2RM4 A;  5GAO r;  3ME9 A;  1M8V A;  1UGQ B;  4F7U F;  3A8M B;  5IN1 A;  5GAO l;  2DPP B;  3M4Q A;  3S3N A;  2RI5 A;  5FU6 B;  1YI2 A;  2KAF A;  3JCM g;  3J7A F;  5GAM h;  3OW2 A;  3OS1 A;  2PUO B;  3VYG A;  2EQU A;  3E19 A;  1X54 A;  1E24 A;  5GAN 7;  2ZT6 A;  4RCC A;  4R56 A;  3SFM A;  2H3J A;  3CMA T;  4TQD A;  3R6O A;  3CCE T;  5E3I A;  2LRQ A;  2E65 A;  4IKF A;  2WSC E;  4RKU E;  3L2Z A;  2FL7 A;  2A3L A;  5FLX E;  2ZZF A;  4CRI A;  4BY6 C;  4AH6 A;  4C5I A;  2X35 A;  3OS5 A;  4P3N A;  3A5Z B;  1Y07 A;  5GMK j;  4C5G A;  3CCQ T;  5K1X A;  4M77 A;  4BB7 A;  4CS4 A;  3V8J A;  2ZPG B;  4DA4 A;  5J39 A;  2ZPH B;  5LJ5 e;  2D6F A;  3GNG A;  3FIF A;  4PL6 A;  1UB4 A;  2CZ7 B;  3PIO A;  5C52 B;  1Q7Y C;  2ALY A;  1XQH A;  1BI0 A;  3JCM P;  2ZT7 A;  3DB3 A;  4YRQ A;  1ZHI A;  2VXF A;  2XD0 A;  4XK8 E;  1B70 A;  1Y7X A;  3JB9 H;  4CS3 A;  2KMT A;  5C51 B;  2DTO A;  5CIU A;  1VQL T;  5F5W A;  3LYI A;  2MAM A;  1OI1 A;  2WAC A;  5KNN A;  2J3L A;  1JJ2 S;  3OYD A;  2GCX A;  4ZIB A;  3REX A;  1IRE B;  4MMK A;  3JCM e;  4LD6 A;  2P5I A;  3UGQ A;  1EFW A;  3QII A;  3TEE A;  2CJB A;  1YJW A;  1Q81 C;  1WQW A;  5KCH A;  1QW1 A;  4M77 F;  1VQP T;  4P75 A;  3L2W A;  4RG2 A;  4WF2 A;  4KUL A;  1UEB A;  3MEU A;  2FHD A;  3MF2 A;  4C92 B;  2EKO A;  4E7L A;  2EYQ A;  3DB4 A;  4YRG A;  2ZZE A;  3HL8 A;  4B9W A;  2DQ3 A;  2K57 A;  4C5H A;  5GAN e;  4ZGE B;  3OYN A;  3UPU A;  2JZ2 A;  4Y28 E;  1H4V B;  2X4J A;  4YRI A;  2A8E A;  3SWN B;  1HK9 A;  1ADY A;  1ATI A;  4YRC A;  3HRS A;  3CXC S;  1D3B B;  4EX5 A;  2Q7G A;  4HKE A;  1B8A A;  4C92 E;  2KQW A;  3HY0 A;  4DOV A;  4IUR A;  2KK4 A;  4RQE A;  3P8B B;  4M77 C;  5DY9 A;  5IT9 E;  3A8H B;  2RHS A;  1KC8 U;  1N27 A;  2AKW B;  2QQR A;  3HXZ A;  2KDS A;  5D6X A;  3J81 E;  4CH6 A;  4G84 A;  2F69 A;  5I2S A;  2NS6 A;  3QHS A;  4N4I A;  4P73 A;  1KHI A;  4C92 D;  5GMK m;  4QQG A;  4E7H A;  3HFZ B;  3A8L B;  3QYG B;  5C0M A;  1HXD A;  4PJO F;  3QUI A;  4HT8 A;  3CEY A;  2P4T A;  2ZR2 A;  3C12 A;  3MHX A;  1KC8 C;  1BYM A;  4IUV A;  1HTT A;  3P8D A;  2ZGW A;  2Q5H A;  4E47 A;  2QA4 T;  2XG8 D;  3PCO A;  5DLO A;  3CD6 T;  3A74 A;  5CKB A;  4P3P A;  1KQ2 A;  1YGB A;  2EL9 A;  5LJ5 h;  4E7J A;  2QTX A;  2QQ9 A;  1M5Q 1;  1MHN A;  3VQW A;  3L4G A;  2DD4 A;  1WPY A;  3P8V A;  1NJ2 A;  4YP0 A;  3X28 B;  4H2T A;  3L2U A;  4FM4 B;  4YRF A;  2RHQ B;  1FYF A;  4OMF B;  1YIJ T;  5J3B A;  1QF6 A;  2JUF A;  4X9C A;  5A2Q E;  2RHU A;  3JB9 G;  1S72 A;  2JTM A;  1VQ7 T;  4PJO C;  2ZPF B;  3WXM B;  3OYY A;  2PVD B;  1M1G A;  1QP2 A;  2M0O A;  3M57 A;  2VV5 A;  1G51 A;  2AMC A;  2ZXF A;  4P5N A;  3JCM h;  5C53 B;  2V8K A;  4EMK B;  3PIP A;  4KT0 E;  2WSF E;  3OY9 A;  2OTJ T;  1AHJ B;  1NZ9 A;  3LSS A;  3PMT A;  3JCM X;  2PU9 B;  4Q5W A;  2A7Y A;  5HK3 A;  1ASY A;  1YJN A;  3G71 T;  5A0D A;  4OB1 B;  1SRY A;  4NL2 A;  1W2B S;  1VQZ A;  4Q6G A;  4EDU A;  2ZIM A;  5HKC A;  3RF1 A;  3X25 B;  3CCL A;  2RJC A;  1G3Y A;  3S3O A;  4P72 C;  2DD5 A;  2CYZ B;  1EIY A;  3QDR B;  3RKW A;  1QP3 A;  2BIV A;  2O4X B;  3C94 A;  4PLI A;  5GMK h;  4HT9 A;  3PTA A;  1KMN A;  1RIQ A;  4WJ4 A;  3QPH A;  1VQK A;  2LTO A;  5LJ5 d;  1LJO A;  4XEM A;  2JTF A;  4QW2 A;  2BKD N;  1I81 A;  4E7K A;  2VUB A;  2DK3 A;  1B34 B;  5CKH A;  3NTH A;  3L42 A;  1O9S A;  1KD1 U;  2XU8 A;  4BE2 A;  3UWN A;  4A4F A;  3OW2 S;  3FB9 A;  2DJZ A;  4HCB A;  1VQ6 T;  4HWR A;  1JJC B;  4J15 A;  2CJA A;  4C0D C;  4O6J A;  3JSC A;  3N5B B;  4M75 B;  4NS5 A;  3SB2 A;  5LJ3 j;  3OD1 A;  2R58 A;  4YYE A;  1M4Z A;  4M78 E;  3HRT A;  4BD3 A;  3G4S A;  4IUP A;  4C8Q A;  4IUT A;  4M7A B;  2E6N A;  3A8G B;  3OB9 A;  2L89 A;  3QBY A;  5GMK i;  5GAN 3;  2K4Y A;  2MWP A;  3H8Z A;  4P74 C;  5CKF A;  4XQ3 A;  1VQ8 T;  5M9O A;  3VUZ A;  1PSE A;  4L87 A;  1C0A A;  4M75 E;  3TEH A;  1IL2 A;  3BFM A;  4M78 D;  4ME7 A;  5GAN 5;  1L0W A;  2HNI A;  4OVA A;  5GAN d;  4EMH A;  4M7D A;  4M7A E;  3CCU A;  2NLU A;  1LYL A;  2CZ0 B;  3W3S A;  4UP9 A;  4OB3 B;  1B7Y B;  2RJD A;  1WYD A;  5FRO A;  4C0F A;  3ASK A;  4JS5 A;  1VQ5 T;  2P0L A;  3CCS A;  1G5V A;  4M75 D;  3LGF A;  4JRQ A;  4BAC A;  4MDX A;  5KCO A;  2R5A A;  2DVE A;  4YTL A;  4M7A D;  4C8Q F;  2QEX T;  5CCA A;  5CK9 A;  2FYK A;  1VQM A;  4WI1 A;  3TRE A;  3MQZ A;  3HSB A;  4A54 A;  2KY9 A;  3CPW A;  3AHU A;  2P0K A;  3WVD B;  2RJE A;  1FX7 A;  1B76 A;  3QO7 A;  4H2X B;  4YRK A;  2C06 A;  5GAN f;  2F5K A;  4C92 G;  3A5Z A;  3E9G A;  4M7D F;  1X2G A;  2YLB A;  3CME T;  2RHY A;  4RMF A;  2EAY A;  3CC4 T;  3CMA A;  2LCC A;  3C4S A;  5LJ3 e;  3CCE A;  3OYL A;  5IAY A;  1FWZ A;  3RL6 A;  2QHS A;  4LVM A;  3LSQ A;  4LVJ A;  3PT9 A;  1H4T A;  2LT4 A;  5EG2 A;  4C8Q C;  2ODR D;  1M9S A;  4LVK A;  4BY6 B;  3UGT A;  3HTZ A;  5GAO m;  3I55 T;  1Z7N A;  1SES A;  1OYX A;  3CMQ A;  3R07 A;  4EMG A;  3CCQ A;  1NJ5 A;  3UDC A;  4YCV A;  5GAN j;  3CBM A;  4N4H A;  3LH0 A;  4QVZ A;  3KUF A;  2EQK A;  2XDP A;  4NL3 A;  4ELZ C;  1Q7Y U;  5GAN g;  2E10 A;  3HRU A;  3MEY A;  2YHT A;  4M7D C;  5GAN 2;  2GF7 A;  4ZN1 A;  2RK1 A;  5GAN 4;  4LDV A;  4F7U E;  4KBM B;  1XTD A;  4ELY C;  2HD0 A;  2P0P A;  3BW1 A;  2ZCF B;  1YI2 T;  4LNS A;  1X55 A;  4JS4 A;  1N9S A;  2OTL T;  2GFA A;  5D6W A;  3SDZ A;  1VQL A;  3RKY A;  3QXE B;  1U8R A;  1BI2 A;  2CGH A;  2XGT A;  2XHC A;  1PSF A;  3NEN A;  2QHV A;  3LLR A;  4MDW A;  1NJ6 A;  4V2S A;  2EWN A;  2DU5 A;  2PME A;  4C0G A;  2L3R A;  2I4O A;  2E41 A;  3M56 A;  1Q81 U;  1YHQ A;  2E6Z A;  2DIQ A;  3SWN A;  1VQP A;  2J3M A;  4ATO A;  2Y4X A;  2QQS A;  1D3B A;  4TVA B;  4RG8 A;  2ZT5 A;  4HA8 A;  3HXY A;  1WJQ A;  5CO7 A;  2YLC A;  1Q82 C;  2DXT A;  2LQK A;  3CBP A;  4LVI A;  4FIB A;  4FU6 A;  3P8H A;  1SSF A;  2DAQ A;  5FRM A;  5D6Y A;  2E3C A;  1VIF A;  2DTI A;  3DLL A;  3BDU A;  3X20 B;  2DTH A;  3QYH B;  4BE0 A;  2YRV A;  4BI8 B;  2DO3 A;  4YRP A;  2CZ1 B;  3VUB A;  1Y71 A;  1PYS B;  2JNG A;  3JCM c;  3KBG A;  1G3S A;  4YRE A;  2EJG A;  1YB3 A;  4ZGJ B;  3HFZ A;  4P3O A;  4M77 B;  4X34 A;  2Q7H A;  3BY7 A;  4KUD K;  2OAU A;  2F5T X;  1QE0 A;  3KXT A;  3CC2 T;  3I56 T;  1KQ1 A;  3CPF A;  4TVW A;  3MO8 A;  3CCV A;  2RA2 A;  1G5I A;  1YFT A;  3A7U A;  1JB0 E;  1BBU A;  2VGM A;  3JCM b;  1ZQ1 A;  2E1H A;  3O8V A;  5LJ3 h;  4P71 A;  3QTC A;  2ZIO A;  5GAO p;  2CKK A;  3M59 A;  5DLQ E;  4RDX A;  3LC0 A;  4M77 E;  3V7R A;  3P8T A;  4JJN K;  3RIR A;  3E1S A;  4X9D A;  2PQW A;  3BDL A;  1VQ4 T;  2RHQ A;  5ELO A;  4HCZ A;  2LVM A;  3ERR A;  3IAL A;  2QA4 A;  2X4W A;  2EJF A;  2XID A;  4MML A;  3CD6 A;  1WQ7 A;  3MEA A;  3ER0 A;  2ZCE A;  3G6E T;  1NYR A;  3HHT B;  2X4Y A;  3G7Z A;  1WNL A;  1OZ3 A;  2HQE A;  1I5L A;  3UFG A;  4GLK A;  1Y96 B;  2V8I A;  1M90 U;  4M77 D;  4ZTF A;  1WU7 A;  3M53 A;  5K1P A;  1YIT T;  4M78 G;  3DSQ A;  4XTU A;  3V8K A;  3TEG A;  2GFU A;  4XTY A;  3RMQ A;  4L5G A;  2LT1 A;  2Q7E A;  4EMK A;  1YIJ A;  2K5F A;  2ZZD A;  3CC7 A;  2XIC A;  3M55 A;  1RL2 A;  4PJO B;  1VQ7 A;  1X01 A;  3JCM Q;  2R5M A;  1VQN T;  5C6S A;  1XOV A;  2HBP A;  3FDR A;  4M75 G;  4YPF A;  3MCA B;  1M90 C;  3EAE A;  3RES A;  1YFR A;  4OGC A;  1M1F A;  4P75 C;  5CAI A;  4M7A G;  3OMG A;  3PGG A;  4KR3 A;  2FB7 A;  3OYB A;  11AS A;  2RI3 A;  3HRK A;  3VYH B;  2VGN A;  2OTJ A;  2D9T A;  4PJO E;  4XU1 A;  3NTI A;  1LNX A;  3QO8 A;  3JB9 J;  2L8D A;  4FL6 A;  2O4X A;  1XNI A;  3G71 A;  4C0Z A;  4C5E A;  5GAN 8;  4A4G A;  3M9Q A;  2XDD A;  1BIA A;  4TVR A;  2RHZ A;  5LJ3 d;  1USY A;  2ZZG A;  2DXB A;  4P71 C;  1WGS A;  4PJO D;  4ZN3 A;  3HY1 A;  3DKM A;  3GNF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...